Skip to main content
eLife logoLink to eLife
. 2021 May 11;10:e64891. doi: 10.7554/eLife.64891

In vitro reconstitution reveals major differences between human and bacterial cytochrome c synthases

Molly C Sutherland 1,2,†,, Deanna L Mendez 1,, Shalon E Babbitt 1,†,, Dustin E Tillman 1,§, Olga Melnikov 1, Nathan L Tran 1, Noah T Prizant 1, Andrea L Collier 1, Robert G Kranz 1,
Editors: Michael A Marletta3, Iqbal Hamza4
PMCID: PMC8112865  PMID: 33973521

Abstract

Cytochromes c are ubiquitous heme proteins in mitochondria and bacteria, all possessing a CXXCH (CysXxxXxxCysHis) motif with covalently attached heme. We describe the first in vitro reconstitution of cytochrome c biogenesis using purified mitochondrial (HCCS) and bacterial (CcsBA) cytochrome c synthases. We employ apocytochrome c and peptide analogs containing CXXCH as substrates, examining recognition determinants, thioether attachment, and subsequent release and folding of cytochrome c. Peptide analogs reveal very different recognition requirements between HCCS and CcsBA. For HCCS, a minimal 16-mer peptide is required, comprised of CXXCH and adjacent alpha helix 1, yet neither thiol is critical for recognition. For bacterial CcsBA, both thiols and histidine are required, but not alpha helix 1. Heme attached peptide analogs are not released from the HCCS active site; thus, folding is important in the release mechanism. Peptide analogs behave as inhibitors of cytochrome c biogenesis, paving the way for targeted control.

Research organism: Other

eLife digest

From tiny bacteria to the tallest trees, most life on Earth carries a protein called cytochrome c, which helps to create the energy that powers up cells. Cytochrome c does so thanks to its heme, a molecule that enables the chemical reactions required for the energy-creating process.

Despite both relying on cytochrome c, animals and bacteria differ in the enzyme they use to attach the heme to the cytochrome. Spotting variations in how this ‘cytochrome c synthase’ works would help to find compounds that deactivate the enzyme in bacteria, but not in humans. However, studying cytochrome c synthase in living cells is challenging.

To bypass this issue, Sutherland, Mendez, Babbitt et al. successfully reconstituted cytochrome c synthases from humans and bacteria in test tubes. This allowed them to examine in detail which structures the enzymes recognize to spot where to attach the heme onto their target. The experiments revealed that human and bacterial synthases actually rely on different parts of the cytochrome c to orient themselves. Different short compounds could also block either the human or bacterial enzyme.

Variations between human and bacterial cytochrome c synthase could lead to new antibiotics which deactivate the cytochrome and kill bacteria while sparing patients. The next step is to identify molecules that specifically interfere with cytochrome c synthase in bacteria, and could be tested in clinical trials.

Introduction

The structure of cytochrome c (cyt c), as well as its key function in electron transport for aerobic respiration, have been known for over half a century (Dickerson et al., 1971; Ernster and Schatz, 1981). Scores of newly discovered and extraordinary electron transport chains with unique cyt c proteins in bacteria are now known, such as extracellular multiheme nanowires comprised of many c-type hemes (e.g. Deane, 2019; Wang et al., 2019). In addition to its role in respiration, cyt c is known to play other important functions, such as activation of programmed cell death in eukaryotes (apoptosis) (Ow et al., 2008; Tait and Green, 2010). Regardless of its function, each c-type heme contains two thioether attachments to a conserved CysXxxXxxCysHis (CXXCH) motif, where the histidine acts as an axial ligand to the heme iron in the native cyt c (Figure 1—figure supplement 1a,bDickerson et al., 1971). It is generally agreed that the covalently attached heme makes these energy conversion proteins particularly stable (e.g. Allen et al., 2005). In fact, recent engineering of novel and stable heme-based catalysts has used c-heme polypeptides produced in vivo (Kan et al., 2017; Kan et al., 2016; Watkins et al., 2017).

To form c-heme, heme is attached stereochemically to each CXXCH motif and it appears that in the case of cyt c, folding into its native structure occurs after attachment (Kranz et al., 2009). Cyt c biogenesis requires accessory proteins that are needed to attach the heme group and complete maturation. Three pathways have been discovered and characterized genetically, called Systems I, II, III (Figure 1—figure supplement 1b,c) (reviewed in Kranz et al., 2009; Ferguson et al., 2008; Kranz et al., 1998; Bowman and Bren, 2008; Simon and Hederstedt, 2011; Verissimo and Daldal, 2014; Gabilly and Hamel, 2017). Systems I and II have evolved in bacteria, while System III is in most mitochondria. Each system possesses a cyt c synthase (Figure 1—figure supplement 1c, orange), which attaches the two vinyl groups of heme to cysteines of CXXCH. However, the cyt c biogenesis process, starting with CXXCH recognition, to heme attachment, to release and final folding, remains largely unknown. While in vivo studies have suggested some requirements (Babbitt et al., 2017; Babbitt et al., 2016; Corvest et al., 2010; San Francisco et al., 2013), such cyt c genetic studies do not examine problems of instability, recognition, release, or folding of the cyt c variants. Direct testing of substrates without these limitations awaited the development of in vitro reconstitution. The mitochondrial System III is composed of a cyt c synthase called HCCS (holocyt c synthase) in the intermembrane space (Figure 1a and Figure 1—figure supplement 1cPollock et al., 1998; Dumont et al., 1987; Babbitt et al., 2015). Bacterial systems are unrelated to HCCS and more complicated, heme attachment occurs ‘outside’ the cells; thus, these pathways export the heme and attach it to secreted, unfolded cyt c. System II is composed of a large integral membrane protein complex called CcsBA (Beckett et al., 2000; Dreyfuss et al., 2003; Xie and Merchant, 1996) (sometimes called ResBC [Ahuja et al., 2009; Le Brun et al., 2000]), which is proposed to both export heme and then attach it to cyt c CXXCH motifs (Feissner et al., 2006; Frawley and Kranz, 2009). Specific factors for thiol reduction of the CXXCH motifs have also been proposed (Bonnard et al., 2010; Kranz et al., 2009).

Figure 1. Cyt c is biosynthesized in vitro by mitochondrial HCCS.

(a) Schematic of the in vitro heme attachment reaction of HCCS with apocytochrome c (apocyt c). Mitochondrial cyt c synthase, HCCS, positions heme (orange) and attaches it to apocyt c. Cyt c is released and folds into its native structure. Insets show the UV–vis spectra of heme. (b) UV–vis spectra of heme signal from the anaerobic reaction of WT and H154A HCCS (±heme loading [HL]) with apocyt c as outlined in a black line – initial, red line – 1 hr post-addition of DTT. Inset shows magnification of the β/α region. (c) In vitro biosynthesis of cyt c was monitored by heme stain. WT HCCS biosynthesized 12 kDa cyt c product (lanes 3 and 8). HCCS H154A, a mutant defective for heme binding, did not (lanes 5 and 10). Total protein for in vitro reaction shown by Coomassie. For (b) and (c), representative data is shown from three biological replications (independent purifications of HCCS). (d) Time course of HCCS in vitro activity. A single trial showed heme-stained cyt c product is first observed after 10 min (red, lane 5). Sypro stain shows total protein levels, α -cyt c shows total cyt c in reaction. The apocyt c dimer observed upon SDS–PAGE is due to aggregation and does not impact the results or conclusions. (e) HPLC profiles of the indicated reaction products representative of two trials.

Figure 1.

Figure 1—figure supplement 1. Cyt c attachment to heme and cyt c biogenesis pathways (Systems I, II, and III).

Figure 1—figure supplement 1.

(a) Heme c synthesis (one vinyl group shown with one thiol of CXXCH): cys thiol attachment to α   carbon of the vinyl group of heme. (b) schematic of the reaction that takes place between apocyt c and heme, mediated by Systems I, II, or III. (c) Proposed models for cytochrome c biogenesis by Systems I, II, and III. Models include trafficking and oxidation states of heme, as well as the subpathways for apocytochrome reduction (in red for system I and system II). Representative genera possessing each system are listed under the models. (a, c) modified from Kranz et al., 2009 as indicated.
© 2009, American Society for Microbiology permissions
Panel a is reproduced from Figure 5, Kranz et al., 2009, with permission from the American Society for microbiology. It is not covered by the CC-BY 4.0 licence and further reproduction of this panel would need permission from the copyright holder.
© 2009, American Society for Microbiology permissions
Panel c is reproduced from Figure 2, Kranz et al., 2009, with permission from the American Society for microbiology. It is not covered by the CC-BY 4.0 licence and further reproduction of this panel would need permission from the copyright holder.

Figure 1—figure supplement 2. Titration of heme loading (HL) in GST-HCCS.

Figure 1—figure supplement 2.

WT (blue, n = 7) and H154A (orange, n = 3). Exogenous heme at indicated concentration (x-axis) was added to GST-HCCS during batch purification with glutathione agarose for 20 hr. GST-HCCS was washed, eluted, and heme content of the final sample was measured from spectra of the purified HCCS, as determined by the Soret absorbance. Error bars are the standard deviation.

Figure 1—figure supplement 3. HCCS in vitro biosynthesized cyt c has heme attached and is properly folded.

Figure 1—figure supplement 3.

(a) The reaction of 10 µM HCCS and 20 µM apocyt c (initial, black) was initiated with 5 mM DTT and incubated for 1 hr at 37°C (red, final). The inset shows the pyridine hemochrome assay spectra absorbance at 550 nm consistent with the attachment of two thioether bonds. This data is representative of three biological replicates. (b) Apocyt c (initial, black) was incubated with GST-HCCS glutathione agarose for 1 hr at 37°C. After centrifugation, a UV–vis spectra of the supernatant was taken exhibiting a peak at 550 nm consistent with that of cyt c. Inset: The oxidized spectra of the supernatant has a peak at 695 nm, consistent with heme Fe2+ axial coordination by cyt c Met81. This was the result of one replicate. This supports the conclusion that cyt c is released by HCCS and properly folded.

Figure 1—figure supplement 4. In-vitro biosynthesis of cyt c by HCCS is temperature dependent.

Figure 1—figure supplement 4.

Aerobic reaction with 3 µM HCCS (+HL) and 20 µM apocyt c were initiated with 3 mM DTT and monitored over a period of 4 hr at the indicated time points and temperatures. Cyt c biosynthesis was measured using the alpha peak height (abs 550 nm – abs 535 nm). 0°C (blue), 22°C (orange), 37°C (purple), 42°C (yellow). The experiment is the average of three biological replicates. The error bars are the standard deviation.

Figure 1—figure supplement 5. HCCS function is dependent on the presence of DTT (aerobic conditions).

Figure 1—figure supplement 5.

(a) 0 mM, (b) 0.1 mM, (c) 1 mM, and (d) 3 mM DTT were added to a reaction of 3 µM HCCS and 6.5 µM apocyt c. Cyt c biosynthesis was monitored by appearance of a 550 nm peak. The initial (black) sample represents the reaction prior to DTT addition and final (red) is after a 1 hr incubation with DTT at 37°C. This is a single replicate.

Figure 1—figure supplement 6. Aerobic in vitro reaction with HCCS + apocyt c.

Figure 1—figure supplement 6.

(a) As in Figure 1b, apocyt c and HCCS (± HL) were combined (black). The reaction was initiated with 5 mM DTT and allowed to react for 1 hr at 37°C (red). HCCS matured apocyt c, while HCCS H154A did not. (b) Heme stain showed evidence of matured cyt c in lanes 3 and 9. This data is representative of three biological replicates.

Figure 1—figure supplement 7. Model for HCCS function proposed previously based on in vivo results (Babbitt et al., 2015; San Francisco et al., 2013).

Figure 1—figure supplement 7.

(a) Four-step model of HCCS function. UV–vis spectra corresponding to each step are shown. Step 1, HCCS binds to heme via residue H154. Step 2, HCCS binds to apocyt c and His19 (of CXXCH) forms the second axial ligand to heme, positioning the cysteine residues for attachment. Step 3, thioether formation between cysteine residues and heme vinyl groups to form covalent attachment to heme. Step 4, Holocyt c is released from HCCS and folds into its native structure with M81 forming the second axial ligand. (b) The reduced spectra of a heme attached 11-mer derived from apocyt c (microperoxidase-11 [MP-11] is a commercially available purified proteolyzed cyt c peptide [Sigma]).
© 2015, Elsevier permissions
Panel a is reproduced with permission from Figure 2, Babbitt et al., 2015, with permission from Elsevier. It is not covered by the CC-BY 4.0 licence and further reproduction of this figure would need permission from the copyright holder.

Large gaps in the cyt c biogenesis field remain such as CXXCH recognition requirements by each cyt c synthase and whether other general factors in the cell are needed for recognition, heme attachment, and folding. While specific proteins have been identified and functions hypothesized for each system (reviewed in Babbitt et al., 2015; Ferguson et al., 2008; Gabilly and Hamel, 2017; Kranz et al., 2009; Verissimo and Daldal, 2014), there has been no in vitro reconstitution studies with purified cyt c synthases, which will be needed to address these gaps. Only recently was our group able to purify the cyt c synthases, after recombinant expression in Escherichia coli (Frawley and Kranz, 2009; Merchant, 2009; Richard-Fogal et al., 2009; San Francisco et al., 2013; Sutherland et al., 2018b). Here we develop and characterize the first in vitro reconstitutions of cyt c synthases, using purified human HCCS and the bacterial CcsBA. No protein factors other than the cyt c synthases are needed in vitro for attachment and folding into a native cyt c structure. In vitro reactions with a variety of peptides containing CXXCH show that the CXXCH substrates for each cyt c synthase are quite different and that post-attachment folding of cyt c is important in release from the synthase active sites. Key differences between HCCS and CcsBA include thiol (cysteine) requirements and the alpha helix sequence adjacent to CXXCH. Peptide analogs behave as inhibitors. Because bacteria and humans (mitochondria) use very different cyt c synthases, shown here to recognize distinct features of the CXXCH substrate, specific inhibitors could constitute targeted antimicrobials, facilitating chemical control of cyt c levels in selected organisms.

Results

In vitro reconstitution of HCCS using apocyt c as substrate

Using purified human HCCS, we reconstituted cyt c synthase activity with equine apocyt c as substrate, initially assaying formation of a peak at 550 nm, diagnostic of cyt c’s typical UV–vis spectra (Figure 1a). Recombinant human HCCS (GST-tagged) is functional in vivo, attaching heme to co-expressed apocyt c (San Francisco et al., 2013) in E. coli. We have previously shown that HCCS co-purifies with heme, which is liganded to His154 (San Francisco et al., 2013). UV–vis spectra of purified HCCS shows a 423 nm and broad 560 nm absorption, typical of heme proteins, while HCCS H154A variant does not bind heme (Figure 1b, −HL). We developed a ‘heme-loading (HL)’ protocol to increase the levels of heme bound in HCCS (+HL, ~30% occupied) above the co-purified levels of endogenous heme (−HL, ~10% occupied). HL was also advantageous since the HL protocol removes excess heme, thus minimizing spectral interference from free heme in reactions. HL was shown to depend on the natural His154 ligand (Figure 1b, +HL black line), and loading was saturated at 2–5 µM heme (Figure 1—figure supplement 2). Initial reconstitutions were performed with wild type (wt) HCCS (±HL) and the HCCS His154Ala variant that does not bind heme (Figure 1b). Upon incubation for 1 hr in the presence of apocyt c and dithiothreitol (DTT), a sharp 550 nm peak emerged, indicative of a c-type cytochrome (Figure 1b, red with wt). This occurred with wt HCCS containing endogenous heme (−HL) and in vitro loaded heme (+HL), while HCCS H154A did not produce the 550 nm peak. A second method to determine if heme has been covalently attached to the apocyt c is to separate reactions with denaturing sodium dodecyl sulphate–polyacrylamide gel electrophoresis (SDS–PAGE) followed by heme staining, whereby covalently attached heme electrophoreses with the polypeptide (Figure 1c). Reactions with wt HCCS (−HL and +HL) and apocyt c confirmed that heme is covalently attached to cyt c (12 kDa) in the 1 hr reaction (Figure 1c, lanes 3, 8). As expected, no cyt c was formed with the HCCS H154A variant (Figure 1c, lanes 5, 10). Pyridine hemochrome spectra is often used to determine if two, one, or no covalent bonds to heme are present, with two thioether bonds showing a 550 nm peak (c-heme) and 560 nm for none (b-heme). The in vitro synthesized product has two thioether bonds, indicated by a 550 nm peak in pyridine hemochrome spectra (Figure 1—figure supplement 3a).

In vitro reconstitutions were studied for optimal conditions and requirements. Synthesis is optimal at 37°C (Figure 1—figure supplement 4), required DTT (Figure 1—figure supplement 5), with the cyt c product observed in 10 min (e.g. Figure 1d, lane 5). While cyt c is formed in both aerobic (Figure 1—figure supplement 6) and anaerobic conditions (Figure 1b,c), we decided to use anaerobic conditions for all studies since peptide substrates (below) under aerobic conditions required varying DTT concentrations, likely due to distinct thiol reducing requirements of individual peptides in air.

To further characterize HCCS, substrates and products, we employed analytical HPLC size exclusion chromatography (SEC), whereby UV–vis spectra of each separated species was recorded (Figure 1e). HCCS (brown profile) elutes earlier than cyt c (green profile), and because these are 424 nm (heme) profiles, it is observed in the reaction (blue profile) that heme in HCCS decreases while cyt c product increases. These results also demonstrate that the cyt c product is released from the HCCS active site since it elutes at the same time as purified cyt c (holocyt c). We conclude that we have recapitulated in vitro the four-step process proposed previously (Figure 1—figure supplement 7) for HCCS-mediated cyt c biogenesis: heme binding (step 1), apocyt c binding (step 2), thioether formation (step 3), and release (step 4) (Babbitt et al., 2015; San Francisco et al., 2013). Next, we further characterize the released cyt c product to establish whether proper folding to the native state resulted from in vitro biogenesis.

We developed a HCCS-tethered (to glutathione beads) release assay to isolate HCCS reaction product(s), confirm that cyt c is released, and obtain high yields for product characterization (Figure 2a). Spectra of the released product (Figure 2b) is identical to holocyt c. SDS–PAGE of stages in the bead release protocol (Figure 2c) showed a released product of 12 kD that heme stained and reacted with cyt c antisera (Figure 2c, lane 2). We determined spectrally that the released cyt c has folded properly, forming the Met81 ligand as well as His19 (Figure 1—figure supplement 3b). Redox titrations (Figure 2d) showed that the redox potential of the cyt c in vitro product is the same as cyt c produced in vivo, +253 mV (Figure 2d). Analyses of supernatants (released), washes, and bead-retained material allowed for an estimate that at least 62% of cyt c is released from HCCS (Figure 2c). Since heme in all cyt c’s is attached stereochemically (Figure 2e), we performed circular dichroism (CD) spectra to compare the released (in vitro) product to cyt c made in vivo (Figure 2f). CD absorption of heme (~420 nm) is reduced in globins when heme binds in multiple orientations compared to a single orientation (Aojula et al., 1986; Nagai et al., 2014). Cyt c synthesized in vitro by HCCS shows an identical CD spectral profile as in vivo synthesized (Figure 2f). We conclude that in vitro reconstitution with purified HCCS results in stereochemical heme attachment, release, and proper folding of cyt c.

Figure 2. Cyt c biosynthesized in vitro is released by mitochondrial HCCS.

Figure 2.

(a) Schematic of HCCS released product assay. In vitro reaction is carried out with bead tethered GST-HCCS. Centrifugation separates the beads (GST-HCCS) and supernatant (e.g. released products). (b) UV–vis spectra of supernatant from the released product assay shows characteristic 550 nm cyt c peak, indicating cyt c is matured and released from GST-HCCS beads. (c) SDS–PAGE analysis of released product assay fractions. Lane two shows released cyt c as compared to purified holocyt c (lane 8). (b) and (c) are representative of three biological replicates. The standard deviation is provided. (d) The redox potential of the released cyt c was determined by a modified Massey method (Efimov et al., 2007) and determined to be +253 mV, similar to the published value for cyt c. This is data from one of three biological replicates. (e) Schematic of heme attached to cyt c from PDB: 3ZCF with heme rotated 180o (from Babbitt et al., 2015). (f) Circular dichroism (CD) spectra of in vivo (orange, gray, yellow) vs in vitro (blue) biosynthesized cyt c. In vivo cyts c represent three independent preparations.

© 2015, Elsevier permissions

Panel e is reproduced with permission from Figure 1, Babbitt et al., 2015, with permission from Elsevier. It is not covered by the CC-BY 4.0 licence and further reproduction of this figure would need permission from the copyright holder.

Peptide analogs of apocyt c are recognized by HCCS and heme is covalently attached

In vitro reconstitution of the cyt c synthases provides an opportunity to investigate chemically synthesized apocyt c peptides and analogs as substrates. For example, there are in vivo genetic results suggesting that alpha helix 1, adjacent to the CXXCH motif (Figure 3a), of native cyt c is necessary for maturation by HCCS (San Francisco et al., 2013; Zhang et al., 2014; Kleingardner and Bren, 2011). In fact, the bacterial cyt c has a natural deletion of Met13 in alpha helix 1, recently shown in vivo to be the basis for the inability of HCCS to mature bacterial cyt c (Babbitt et al., 2016; Verissimo et al., 2012). We wanted to determine if cyt c peptides are recognized in vitro and if so the minimal sequence for recognition and heme attachment. Initially, we examined three peptides, an 11mer, 16mer, and 20mer with the 11mer lacking the sequence of alpha helix 1 (Figure 3a). Heme stains of tricine SDS–PAGE were used to detect whether heme was covalently attached to peptides (Figure 3b). After 1 hr, reactions showed that the 16mer (Figure 3b, lane 6) and 20mer (Figure 3b, lane 8) possessed an intense heme-stained peptide of 2.8 kDa, whereas the 11mer did not (Figure 3b, lane 4). Spectral analyses showed that the 11mer reaction looked like HCCS alone (no peptide added), whereas the reactions with the 16mer and 20mer showed a 552–553 nm peak (Figure 3c). We have previously shown that some recombinant HCCS is co-purified with cyt c remaining bound (and heme attached) (San Francisco et al., 2013). UV/vis absorption of these HCCS/cyt c complexes exhibits a peak in the reduced state of 553–555 nm (Figure 1—figure supplement 7), whereas a purified heme attached peptide shows a 550 nm peak (Figure 1—figure supplement 7b). Spectral results of HCCS reactions with 16mer and 20mer peptides (i.e. 552–553 nm peaks, see Figure 3c) suggest heme is covalently attached to the peptides, but that they remain in complex with HCCS, unlike full-length cyt c produced in vitro. To further test CXXCH peptide recognition, we tested a 56mer (with alpha helix 1 and 2 of cyt c) and a 9mer (Figure 3—figure supplement 1). While the 56mer was recognized and heme attached, the 9mer was not, consistent with the in vivo results that alpha helix 1 is required for heme attachment (Babbitt et al., 2016). Because HCCS reaction with the 56mer yields a 555 nm absorption (Figure 3—figure supplement 1a), it is likely not released.

Figure 3. HCCS requires alpha helix 1 of cyt c for heme attachment to peptides containing CXXCH.

(a) Sequence of three CXXCH containing peptides with alpha helix 1 and CXXCH designated. Three-dimensional structures of peptides with heme were generated from the cyt c 3D crystal structure PDB: 3ZCF, alpha helical structure is predicted, but not experimentally confirmed. In vitro reaction (as in Figure 1a) of HCCS and the peptides in 3 (a) was performed and analyzed by (b) SDS–PAGE followed by heme stain and (c) UV–vis spectra to assess heme signal. Black – initial, red – 1 hr post-addition of DTT. Inset shows magnification of the β/α region. Data is representative of three biological replicates.

Figure 3.

Figure 3—figure supplement 1. Attachment of heme to peptides by HCCS.

Figure 3—figure supplement 1.

(a) In vitro assay was performed with HCCS with the labeled peptides. The final UV–vis heme spectra is shown. A peak at 550–555 nm indicates that heme has covalently bound to cyt c peptide. Peaks at 560 nm indicate the presence of b-heme. (b) In-gel heme stains of initial and final samples separated on a 15% Tris–tricine gel demonstrate heme attachment when present. Coomassie stain was performed after heme staining and shows total protein levels in the in vitro reactions in addition to some staining left over from the heme stain. (c) ImageJ quantitation of three sets of heme-stained gels represented in (b). Error bars are the standard deviation of the data.
Figure 3—figure supplement 1—source data 1. ImageJ Pixel analysis of heme stained bands.
Figure 3—figure supplement 2. HCCS anaerobic in vitro attachment of heme to CXXCH variant peptides.

Figure 3—figure supplement 2.

C15S refers to Cys15Ser; DC15 refers to Cys15 D-Cys15 replacing L-Cys15; HoC15 refers to homocysteine replacing L-Cys15. (a) Heme stain and Coomassie showing that 20mer peptides WT (lane 2), C15S (lane 4), DC15 (lane 6), -HoC15 (lane 8), C18S (lane 10), HoC18 (lane 14) are heme attached, while C15S/C18S is not (lane 16). (b–h) Spectra of the respective peptide reactions with HCCS. The inset contains the pyridine of the final sample. A value of 550 nm indicates two thioether bonds are formed with heme, while 555 nm indicates no thioether bond formation. A value of 552–553 nm indicates a single thioether bond. These data are representative of three biological replicates.
Figure 3—figure supplement 3. In vitro HCCS attachment of heme to C15S 20mer and analysis of release.

Figure 3—figure supplement 3.

(a) Release assay as in Figure 4b. Briefly, C15S 20mer is added to HCCS bound to glutathione agarose (beads) and reacted for 1 hr. Heme staining shows that the majority of matured C15S 20mer remains on the beads and is eluted with HCCS, indicating that matured C15S is mostly complexed with HCCS. (b) The UV–vis absorbance of the supernatant shows some absorbance at 555 and 560 nm, but much more is present in the eluted HCCS fraction. Remarkably, the 555/560 nm doublet is also observed in a C15S variant of cyt c in vivo, co-purified with HCCS (Babbitt et al., 2017; San Francisco et al., 2013). (c) HPLC separation by the Agilent bio sec-3 of the respective reactions. In each case, the HCCS eluted before the released substrate (if present). The spectra shown were taken as the sample was eluted from the column in real time. The C15S 20mer has a peak of 555 and 560 nm and elutes at 6.5 min indicating a complex with HCCS. (d) A summary table of matured released substrate as quantitated by comparing the heme densitometry in the supernatant to the signal was found on the beads, or eluted, from the beads. n provides the number of biological replicates performed on each peptide and the standard deviation is provided.
Figure 3—figure supplement 3—source data 1. Summary of percent released substrate.

To confirm that heme-attached peptides remain bound to HCCS, we used both HPLC SEC and the bead release assay described above (Figure 2a). HPLC separation (Figure 4a) showed that HCCS with the 20mer reaction (blue profile) eluted at the same time as HCCS alone (brown profile), not unexpected since a small 2.8 kD unreleased product would not significantly alter size exclusion properties. However, the spectra of the 20mer reaction from the HPLC SEC shows the signature of a HCCS-bound cyt c product, with a peak at 553 nm. This supports the conclusion that the heme attached 20mer remains bound to HCCS upon HPLC SEC, explaining why no heme-peptide product elutes separately (Figure 4a, compare blue and green profiles). Results of the bead release assay also show there is very little release of the heme-attached peptides from HCCS. Spectra of the reaction supernatant (red) exhibits very little heme (Figure 4b), unlike with full cyt c (Figure 2b, red). However, eluted HCCS from the beads show a spectra consistent with heme-attached peptide still bound, with a 555 nm peak (Figure 4b, purple). Quantitation of the level of heme-attached 20mer released from HCCS was carried out using the bead release assay (Figure 4c), with 14 ± 3% of the heme-attached peptide released from HCCS.

Figure 4. Peptides not released by HCCS can inhibit HCCS in vitro biosynthesis of cyt c.

Figure 4.

(a) The 20mer reaction was analyzed by SEC-HPLC (blue) and compared to HCCS alone (brown). The ‘heme attached peptide’ serves as a positive control for a released peptide (green). It is commercially available MP-11 (Sigma), an 11mer with heme attached that is purified from trypsinized cyt c. Insets show the spectra of the respective peaks. (b) The ‘released product assay’ (see Figure 2a) was performed with HCCS and the 20mer peptide. Glutathione eluted beads had a heme signal of 555 nm (purple) indicating a complex of HCCS with 20mer. The supernatant has little heme signal (red). (c) Tris–Tricine SDS–PAGE of the reaction supernatant (lane 1) and the elution from the beads (lane 4) shows that 14 ± 3% of the 20mer is released from HCCS. (b and c) are representative of seven trials and the estimated release is based on all trials. The standard deviation is provided. (d) Schematic of peptide inhibition assay with HCCS. T– The in vitro reaction components HCCS and peptide are combined under anaerobic conditions, T1a – Addition of DTT initiates the reaction. Reaction incubates for 1 hr at 37 C, then the reaction is measured. T1b– Apocyt c is added to the reaction to determine whether the peptide inhibits HCCS heme attachment to apocyt c. DTT is added to the reaction after T1b and incubated at 37 C for 1 hr. T2– The final reaction products were analyzed by SDS–PAGE to determine if holocyt c was matured. (e) Reactions were separated by Tris–tricine SDS–PAGE and heme- and protein-stained. The 16 and 20mers inhibit HCCS maturation of apocyt c (lanes 11, 12, 15, 16). The 11mer or no peptide do not inhibit maturation of apocyt c (lanes 3, 4, 7, 8) (see boxed bands with holocyt c). The data is representative of three biological replicates.

Synthetic peptides as inhibitors of cyt c synthase activity

We evaluated whether peptides recognized by HCCS would act as inhibitors of heme attachment to subsequent addition of apocyt c. We carried out reactions with the three peptides for 1 hr, then added apocyt c, taking samples throughout (Figure 4d). The 11mer behaved as expected, as if no other substrate was present, with synthesis of cyt c occurring (in Figure 4e, compare lanes 1–4 and 5–8 boxed bands). This also suggests that the 11mer is not recognized by HCCS, in that it does not prevent apocyt c from binding. However, both the 16mer (Figure 4e, lanes 9–12) and 20mer (lanes 13–16) showed heme attached to the peptides, but not to the apocyt c. We consider this inhibition of cyt c biogenesis (see Discussion). We conclude that alpha helix 1 is necessary and sufficient for recognition and attachment to the adjacent CXXCH motif. Our findings suggest that folding of cyt c is required for optimal release from the HCCS active site (see Discussion).

In vitro reconstitution of CcsBA using apocyt C as substrate

Our previous studies with CcsBA have used recombinant GST-tagged CcsBA (from Helicobacter), shown to be functional in vivo and co-purify with endogenous heme (Feissner et al., 2006; Frawley and Kranz, 2009; Sutherland et al., 2018b). We concluded that CcsBA is both a heme exporter and a cyt c synthase with two heme binding sites (Figure 6a). To increase CcsBA yields for in vitro and future structural studies, we explored various tagging and expression strategies, ultimately selecting a C-terminal hexahistidine tagged CcsBA which gave high yields (Figure 5a). For unknown reasons, yields were higher when the GST ORF (with stop codon), as well as a new ribosome binding site upstream of ccsBA were used (threefold higher than GST-tagged or without the GST gene: Figure 5a,b). The purified hexahistidine tagged CcsBA still possessed the natural proteolysis site we have previously characterized (Frawley and Kranz, 2009; Sutherland et al., 2018b), resulting in two polypeptides (Figure 5c, lane 4, boxed). The GST*CcsBA:His construct is hereafter referred to as CcsBA:His. Using the anaerobic in vitro reconstitution conditions described above for HCCS, both the purified GST-CcsBA and metal-affinity purified CcsBA:His, both with endogenous heme, were active for heme attachment to apocyt c in vitro (Figure 6a–d). For further studies here, we used the CcsBA:His due to its higher yields. We have previously shown that while wt CcsBA has heme in both the P-His/WWD and TM-His sites (Figure 6a), the P-His variants possess heme only in the TM-His site (Sutherland et al., 2018b). GST:CcsBA P-His mutants are unable to attach heme in vivo to cyt c4, yet co-purified with heme (Sutherland et al., 2018b). Since heme is proposed to attach to apocyt c from the P-His/WWD site (Figure 6a), we tested whether the P-His variant functions in vitro, representing ideal negative controls for genuine in vitro attachments. Importantly, the GST:CcsBA P-His variant did not attach heme to apocyt c in vitro (Figure 6b). In vitro reactions with the wt CcsBA:His shows initial spectral signatures of b-heme (Figure 6c, black spectra). Within 1–3 hr, the wt CcsBA shows two peaks of reduced heme, one at 560 nm and a 550 nm peak that is characteristic of covalent heme attached in c-type cytochromes (Figure 6c, red spectra). It is likely that the b-heme (in the TM-His site) is responsible for the absorption remaining at 560 nm. These results were confirmed by SDS–PAGE and heme stains at the different time points (Figure 6d), confirming that the wt CcsBA formed cyt c. We conclude that purified wt CcsBA acts as a cyt c synthase in vitro and that heme is attached from the P-His/WWD domain, as hypothesized from in vivo results.

Figure 6. In vitro biosynthesis of cyt c by the bacterial synthase, CcsBA.

Figure 6.

(a) Schematic of the heme attachment reaction of CcsBA with apocyt c. Note, CcsBA has two heme binding sites, one in the periplasmic WWD domain (P-heme site, orange heme) and one in the transmembrane region (TM-heme site, green heme). CcsBA is proposed to traffick heme from the TM-heme site to the P-heme site for attachment to apocyt c. CcsBA model was generated by docking the TM-region (Sutherland et al., 2018b), with a cartoon of the periplasmic region. CcsBA is combined with apocyt c under anaerobic conditions and the reaction is initiated with DTT. UV–vis spectra (insets) show the initial reaction before (black) and after addition of DTT (red). After 3 hr, reaction products are holocyt c and monoheme CcsBA. (b) In vitro reaction with WT and P-His1/2Gly GST:CcsBA (5 µM) and apocyt c (20 µM). Samples were analyzed at 0, 1, 3 hr post-addition of DTT, separated by SDS–PAGE and maturation of holocyt c monitored by heme stain. CcsBA P-His1/2Gly is defective for heme binding in the P-heme site. (c) In vitro reaction with CcsBA:His (5 or 10 µM) and apocyt c (20 µM). Black, initial spectra; blue, 1 hr; red, 3 hr; 550 nm peak indicative of holocyt c; inset shows magnification of the β/α region. (d) Samples from (c) were analyzed at 0, 1, 3 hr post-DTT addition and analyzed as in (b, e), time course of in vitro reaction with CcsBA:His (5 µM) and apocytc (20 µM). Samples were taken at indicated timepoints and analyzed as in (b, f), UV–vis spectra of selected timepoints from (e), 550 nm peak indicative of holocyt c. Magnification of the β/α region is shown. (g), HPLC SEC separation of CcsBA (orange) and an in vitro reaction (blue). Monitored at 412 nm to detect heme. Insets show full spectra of indicated fractions.

Figure 5. Construction of CcsBA with a C-terminal 6XHis affinity tag.

Figure 5.

(a) Schematics of CcsBA constructs used for overexpression and affinity purification. Gray, GST ORF; red, ccsB; blue ccsA; purple, C-terminal 6XHis tag. Site of natural proteolysis is shown with expected molecular weights of polypeptides. *Insertion of a stop/RBS/start cassette. UV–vis spectra Soret (~412 nm) is used to determine relative heme levels of 50 µg of purified CcsBA protein from the indicated construct. Spectra are representative of three independent purifications. (b) Affinity purifications of constructs in a. Affinity tag used for purification and relevant polypeptides are labeled. Boxed lane four is the His-tagged CcsBA used for these studies (except in Figure 6b). Data is representative of three biological replicates.

A time course of in vitro reactions with wt CcsBA shows that the covalent attachment to apocyt c is measurable at 20 min, reaching a maximum at approximately 3 hr (Figure 6e). Spectra at selected time points confirm these results (Figure 6f, see 550 nm formation). To determine whether cyt c is released from CcsBA and folds into its native state, we performed HPLC SEC on CcsBA alone and from a 3 hr reaction with apocyt c (Figure 6g). CcsBA in vitro synthesized cyt c is released and elutes at the same position as purified cyt c. The cyt c product (Figure 6g, last inset) is spectrally identical to cyt c produced by HCCS in vitro and to purified cyt c generated in vivo. We conclude that apocyt c is matured and released by CcsBA in vitro, with folding of cyt c into its native state.

Peptide analogs of apocyt c are recognized by CcsBA and heme is covalently attached

Similar to HCCS studies, we used the 11, 16, and 20mer peptides (Figure 3a) and heme staining of tricine SDS–PAGE, to determine whether CcsBA attaches heme to peptide substrates and if so, what sequence or structural requirements are important. In CcsBA in vitro reactions, the 20mer, 16mer, and 11mer peptides each resulted in covalent heme after 3 hr in vitro reactions (Figure 7a). Spectral analyses also showed formation of 550 nm peaks (Figure 7b), including reactions with the 11mer, which was not recognized by HCCS. Because the 560 nm peak also remains in reactions, likely due to heme in the TM-His site, we used second-derivative spectra to delineate and quantitate the levels of attached heme present (Figure 7b, last panel, 550 nm), also confirming that all peptides possess the 550 nm absorption characteristic of c-type heme. The 56mer (alpha helix 1 and 2 of cyt c) and 9mer were also recognized and attached to heme by CcsBA (Figure 7—figure supplement 1). We conclude that the bacterial CcsBA cyt c synthase does not require the alpha helix 1 and that the recognition requirements are different than the mitochondrial HCCS (see Figure 7—figure supplement 2 for parallel reactions of HCCS and CcsBA.)

Figure 7. CcsBA recognition of peptides containing CXXCH for heme attachment.

Peptides are described in Figure 3a. (a) Ten micromolar of CcsBA was incubated with 20 µM of the indicated peptide for 3 hr. Samples were taken at 0 and 3 hr and separated by Tris–tricine SDS–PAGE. Heme attached peptides were detected in lanes 4, 6, and 8 of the heme-stained gel (red). Total protein stain was completed after heme stain. Thus, coomassie stain shows signal from the heme, as well as total protein (blue). (b) UV–vis spectra of the samples in (a). Peaks at 550 nm are indicative of heme attached peptides while the peak at 560 nm reflects CcsBA-bound heme, possibly in the transmembrane domain Inset shows magnification of the β/α region. The second derivative of the spectra at 3 hr (‘final’) quantifies the signal at 550 nm, indicative of covalently attached heme. (a) and (b) are representative of three biological replicates.

Figure 7.

Figure 7—figure supplement 1. Attachment of heme to peptides by CcsBA.

Figure 7—figure supplement 1.

(a) In vitro assay was performed with CcsBA with the indicated peptides. The final UV–vis heme spectra is shown. A peak at 550–555 nm indicates that heme has covalently bound to cyt c peptide. Peaks at 560 nm indicate the presence of b-heme. (b) In-gel heme stains of initial and final samples separated on a 15% Tris–tricine gel demonstrate heme attachment when present. Coomassie stain was performed after heme staining and shows total protein levels in the in vitro reactions in addition to some staining left over from the heme stain. (c) ImageJ Quantitation of three sets of heme-stained gels represented in (b). Error bars are the standard deviation of the data.
Figure 7—figure supplement 1—source data 1. Image J Pixel analysis of heme-stained bands.
Figure 7—figure supplement 2. CcsBA and HCCS in vitro heme attachment to peptides.

Figure 7—figure supplement 2.

(a) Heme and coomassie stain of anaerobic in vitro reactions of CcsBA and HCCS showing that CcsBA matures the 20, 16, and 11mers, while HCCS matures the 16 and 20mers under the same conditions at 3 hr. (b) The second derivative of the heme absorbance spectra of the CcsBA and peptide reactions. Minima between 550–555 is due to heme attached peptides. (c) Second derivative of HCCS and peptide reactions, showing 552–553 nm peaks due to heme-attached peptides remaining bound to HCCS, as described in the text. (d–g) CcsBA and peptide spectra initially (black) and after 3 hr (red). (h–k) HCCS and peptide spectra initially (black) and after 3 hr (red). These reactions have been performed with more than three biological replicates.
Figure 7—figure supplement 3. CcsBA anaerobic in vitro attachment of heme to CXXCH peptide variants.

Figure 7—figure supplement 3.

C15S refers to Cys15Ser; DC15 refers to Cys15 d-Cys15 replacing l-Cys15; HoC15 refers to homocysteine replacing l-Cys15. (a) Heme stain of CcsBA and CXXCH variant 20mer peptides (red) showing that WT 20mer (lane 2) and HoC15 (lane 8) are matured. (b) The second derivative of the final reaction absorbance spectra of peptide CcsBA reactions. The matured peptides in a exhibit corresponding peaks at 550 nm in the respective spectra. (c–j) UV–vis spectra of anaerobic reaction spectra of CcsBA and CXXCH variants. The initial spectra is black and the final spectra after 3 hr is red. Peaks at 560 nm correspond to heme bound by CcsBA, while a peak shoulder at 550 nm correspond to a heme-peptide reaction. Insets magnify the α -peak of the same spectra. These data are representative of three biological replicates.

Recognition of peptide analogs with CXXCH cysteine and histidine substitutions, including non-natural thiol amino acids, by HCCS and CcsBA

The ability to biosynthesize heme-attached CXXCH peptides in vitro by HCCS and CcsBA facilitated a more detailed analysis of the cysteines and histidine in the substrates. For example, cysteine substitutions in the chemically synthesized peptides would determine whether each cysteine is required and whether non-standard thiol amino acids are recognized (Table 1). Homocysteine (HoC) has an additional carbon between the thiol and alpha carbon, while d-cysteine (D-C) rotates the thiol sidechain (see Table 1 for structures). All substitutions were synthesized in the 20mer background since both HCCS and CcsBA could attach heme to it and the product is easily detected on heme stains of tricine SDS–PAGE. That is, if the peptide product has a covalent attachment, it will migrate at 2.8 kD and stain for heme (Figure 3b; Figure 7a; Figure 7—figure supplement 2). This method does not indicate whether a modified thiol (HoC or D-C) has a covalent attachment, so we also performed UV–vis and pyridine hemochrome spectroscopy to provide evidence of thioether formation. Figure 3—figure supplement 2 and Figure 7—figure supplement 3 show results of in vitro reactions of HCCS and CcsBA with the peptide analogs, as summarized in Table 1.

Table 1. Attachment of heme to peptides* by HCCS and CcsBA.

                                                   HCCS CcsBA
Peptide name Peptide sequence Attachment α-Peak (nm) # cov
attachments**
Attachment α-Peak (nm) # cov
attachments**
graphic file with name elife-64891-inf1.jpg Minimal recognition primary/secondary sequences (lengths)
HH Cyt c GDVEKGKKIFVQK CAQCHTVE Attached 550 2 Attached 550, 560 2
56-mer GDVEKGKKIFIMK CSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKG Attached 555 2 Attached 550, 560 2
20 mer GDVEKGKKIFIMK CSQCHTV Attached 553–554 2*** Attached 550, 560 2
16 mer KGKKIFIMK CSQCHTV Attached 552 2 Attached 551, 560 2
11 mer IMK CSQCHTVE Not attached 559 0 Attached 550, 560 2
nine mer K CSQCHTVE Not attached 559 0 Attached 550, 560 2
Cysteine substitutions
20 mer Cys15S GDVEKGKKIFIMK SSQCHTV Attached 555,559.5 1*** Not attached n.a. 0
20 mer DCys15 GDVEKGKKIFIMK(D-C)SQCHTV Attached 555 2*** Not attached 560 0
20 mer HoCys15 GDVEKGKKIFIMK HoCSQCHTV Attached 555 1*** Attached 550, 560 2
20 mer Cys18S GDVEKGKKIFIMK CSQSHTV Attached 559 1*** Not attached 560 0
20 mer DCys18 GDVEKGKKIFIMK CSQ(D-C)HTV Attached 554 1*** Not attached 560 0
20 mer HoCys18 GDVEKGKKIFIMK CSQHoCHTV Attached 558 1*** Not attached 560 0
20 mer Cys15S/Cys18S GDVEKGKKIFIMK SSQSHTV Not attached 559 0 Not attached 560 0
Histidine (of CXXCH) and lysine (K→D) substitutions for testing interaction models
20mer H19A GDVEKGKKIFIMK CSQCATV Not attached 560 0 Not attached 560 0
20mer H19M GDVEKGKKIFIMK CSQCMTV Attached 559 2 Not attached 560 0
20mer H19K GDVEKGKKIFIMK CSQCKTV Not attached 560 0 Not attached 560 0
20mer K6A, K8D, K9D, K14D GDVEAGDDIFIMD CSQCHTV Not attached 560 0 Not attached 560 0

*Supplementary file 2 contains additional information about peptides, eg. purity, synthesis co, and presence or absence of an N-terminal biotin-AHX tag.

**Number of covalent attachments determined by the final reaction spectra absorbance blue shifted from 560 nm and the presence of a heme stainable peptide.

***Pyridine hemochrome was performed to determine this number.

In the case of HCCS, all 20mer peptide variants possessed at least one covalent attachment with the exception of the SXXSH variant (Table 1, blue highlights). This indicates that HCCS does not require both cysteines for recognition, a conclusion consistent with in vivo results of engineered cyt c substrate variants (Babbitt et al., 2014). Importantly, the HCCS/peptide complexes exhibit spectral signatures of purified HCCS/cyt c co-complex variants produced in vivo (Babbitt et al., 2017). For example, HCCS reactions with the SXXCH peptide shows a split alpha peak at 555/560 nm (Figure 3—figure supplement 2b), just as shown in vivo with the HCCS/Cys15Ser variant (Babbitt et al., 2017). Pyridine hemochrome spectra of HCCS reaction products were used to show whether the non-natural thiols were covalently attached. Both homocysteine and the DCys18 (Figure 3—figure supplement 2f,g), thiols were not attached, possessing only a single thioether, resulting in a hemochrome spectral peak of 552 nm that reflected attachment to Cys15. However, the DCys15 variant possessed two thioether attachments, thus both thiols reacted (Figure 3—figure supplements 2c, 550 nm pyridine hemochrome peak). This indicates that rotation of the first thiol (Cys 15) of the CXXCH substrate is more permissive at the active site of HCCS.

Lastly, we examined the role of the conserved H19 of the CXXCH motif. 20mer peptide were synthesized with H19M, H19A, and H19K substitutions. The H19A and H19K variants did not attach heme, while the H19M variant attached heme at low levels (Figure 3—figure supplement 1), suggesting methionine can act as a weak ligand in HCCS.

In the case of the bacterial CcsBA, an entirely different set of rules emerge for CXXCH substrate recognition (Table 1, compare blue to orange highlighted variants). Only one 20mer cysteine variant showed any covalent attachment: the first cysteine thiol replaced with a homocysteine (Figure 7—figure supplement 3f). The HoCys15 variant has two covalent linkages (550 nm peak), suggesting that the first thiol is more permissive in distance from the alpha carbon (i.e. of the first cysteine of CXXCH). Because DCys15 was not attached, unlike with HCCS, rotation of the first thiol may be less permissive at the CcsBA active site. No 20mers with histidine substitutions possess covalently attached heme with CcsBA (Figure 7—figure supplement 1).

Discussion

It has been known for decades that the covalent, thioether attachment of heme in c-type cytochromes (to a CXXCH motif), requires accessory factors, including thioredoxins and cyt c synthases. A unique feature of cyt c biogenesis is that folding into its native structure occurs after cofactor (heme) attachment. Many elegant in vitro studies have concerned the folding of purified cyt c, typically after denaturation and renaturation to follow the folding pathway (e.g. Hu et al., 2016; Pletneva et al., 2005; Yamada et al., 2013). However, in vitro heme attachment by cyt c synthases has not been studied with purified components. Due in part to their membrane location, only recently have we been able to purify the detergent-solubilized synthases, mitochondrial HCCS (San Francisco et al., 2013) and bacterial CcsBA (Frawley and Kranz, 2009). CcsBA is an integral membrane protein that functions as a heme exporter and synthase, making its reconstitution particularly challenging. Here we have successfully reconstituted cyt c biogenesis with purified HCCS and CcsBA. Initially, we used apocyt c as substrate and endogenous heme that is co-purified with recombinant HCCS and CcsBA. For HCCS, we were also able to load heme into the active site, requiring His154, a process proposed as step one in biogenesis (Figure 1—figure supplement 7). Besides DTT for maintaining a reducing environment, no accessory factors other than HCCS and CcsBA are necessary. In vitro reactions result in stereochemical heme attachment, release of cyt c from the synthases, and proper folding into its native cyt c conformation. The cyt c possesses His19 (of CXXCH) and Met81 as axial ligands and its redox potential is identical to native cyt c purified from mitochondria (+253 mV).

In vitro reconstitution conditions (anaerobic, DTT) enabled the use of CXXCH containing peptides to study biogenesis and the substrate requirements for HCCS and CcsBA. In vitro reactions with HCCS and apocyt c proceed through all four steps (Figure 1—figure supplement 7), including step 4, release with cyt c folding. However, a 20mer peptide with CXXCH is very poorly released by HCCS, thus halting the process after step 3. In vivo we have demonstrated that single cysteine variants of cyt c (CXXCH motif) are released less than the wt cyt c, since more HCCS/cyt c complex and less cyt c product is purified (Babbitt et al., 2014). We proposed that thioether formation and consequent heme distortion contributes to release. Using cysteine peptide variants, we demonstrate in vitro that peptides with two thioethers release more than those with the single thioethers (Figure 3—figure supplement 3). Full cyt c is released at least 62 ± 5%, 20mer 14 ± 3%, and the SXXCH variant 5 ± 2% from HCCS. We conclude that folding of cyt c is necessary for optimal release from the HCCS active site (step 4).

For CcsBA, we have proposed that biogenesis involves heme trafficking from an internal membrane site, liganded by two TM-His residues, to an external domain called the WWD/P-His site (Figure 6aFrawley and Kranz, 2009; Sutherland et al., 2018b). Subsequently, it is proposed that heme from the WWD/P-His site is stereochemically attached to apocyt c (CXXCH) (Sutherland et al., 2018b). Preliminary data on the spectral properties of peptides with heme attached by CcsBA appear to be released, unlike HCCS. Perhaps this release is mediated by the highly conserved WWD domain in the bacterial synthase, which interfaces with the edge of heme that faces the CXXCH substrate.

In vitro reconstitution with CXXCH peptides and analogs have shown that the substrate requirements for HCCS and CcsBA are quite different. There have been some in vivo studies that suggested that HCCS may require an N-terminally extended region (from CXXCH), yet such approaches do not rule out, for example, folding or stability issues (Babbitt et al., 2016; Kleingardner and Bren, 2011; Zhang et al., 2014). A direct, in vitro approach was needed. Here we synthesized multiple CXXCH peptides (Figure 3a): an 11mer lacking the N-terminal alpha helix 1 sequence, and a 16 and 20mer, which possess it. HCCS only recognizes and attaches heme to the 16 and 20mer but not the 11mer or a 9mer, while CcsBA attaches to all four peptides (Table 1, Figure 3—figure supplement 1). Structure of this alpha helix 1 sequence is predicted by PEP-FOLD (Shen et al., 2014; Thévenet et al., 2012) to form an alpha helix, consistent with experimental structure of cytochrome c. We conclude that the alpha helix 1 is a critical component recognized by HCCS, and that these peptides (16 and 20mers) present necessary and sufficient structures for recognition (Figure 3a). We used a Gremlin co-evolution/Rosetta approach (Ovchinnikov et al., 2017; Ovchinnikov et al., 2015) to determine the structure of HCCS, facilitated by almost a billion years of HCCS evolution (Babbitt et al., 2015). Heme was modeled into HCCS, constraining the His154 as an axial ligand, leaving the sixth ligand site open, likely bound to a weak ligand such as water (Figure 8a). Figure 8b displays the minimal 16mer substrate with heme. Heme binds to HCCS via His154 in step 1 (Figure 1—figure supplement 7), before binding of the 16mer substrate (step 2). The surface at the proposed active site of HCCS is acidic (Figure 8a), potentially interacting electrostatically with the basic features of alpha helix 1 (Figure 8b). Moreover, during step 2 of proposed model for HCCS function (Figure 1—figure supplement 7), His19 of apocyt c forms the second axial ligand to heme at the HCCS active site. In all peptides with alpha helix 1, spectral analysis indicated that His 19 formed this second axial ligand. We have confirmed the requirement for His19, testing three His19 variants of the 20mer peptide, H19M, H19A, and H19K (Figure 3—figure supplement 1). Only the H19M variant showed a low amount of attached heme, with a spectrum that also implies methionine can replace the weak ligand in HCCS (Figure 3—figure supplement 1). The minimal 16mer peptide, including the His19 ligand, is modeled into HCCS in Figure 8c. These models provide an initial structural basis for HCCS function, including testable predictions. For example, to test the electrostatic hypothesis, we changed all basic lysines to aspartates, retaining a predicted alpha helix 1 (Figure 3—figure supplement 1, Table 1). Heme was not attached to this peptide by HCCS, suggesting that the positive charge in alpha helix 1 is important.

Figure 8. Modeled structure of HCCS using GREMLIN/Rosetta approach.

Figure 8.

(a) Electrostatic view of HCCS structure. Acidic surfaces are red; basic surfaces are blue. Heme is modeled with H154 ligand, within a pocket surrounded by acidic residues. Ribbon diagram of HCCS structure with domain II shown in teal and heme in yellow. The axial heme ligand H154 (orange) is shown. (b) Sequence and structure of the 16mer peptide substrate from cytochrome c; structure derived from PBD 3ZCF. Heme is shown in yellow, thioether bonds to Cys15 and Cys18 are indicated in orange with His19 serving as the axial ligand to heme. Positively charged (basic) residues (K) are blue. (c) Binding of the 16mer (or apocyt c), (step 2 of the four-step model) is displayed whereby H19 of cyt c ligands heme and positions cysteines for thioether attachment. (Top) Electrostatic view and interactions of HCCS structure and 16mer cyt c peptide with key interactions with HCCS and heme (yellow) and the 16mer peptide (green). (Bottom) A ribbon diagram with key interactions between HCCS H154 (purple) and heme (yellow), as well as formation of holo16mer peptide (green).

For CcsBA, a limited sequence that includes CXXCH is necessary and sufficient. Results using peptide analogs with non-standard thiol amino acids are consistent with a more stringent requirement for the CXXCH motif for CcsBA. In this respect, because bacteria often recognize hundreds of c-type cytochromes (i.e. CXXCH motifs) it makes evolutionary sense to recognize only the CXXCH motif, than to have a more demanding three-dimensional structure.

We investigated the importance of the two thiols in CXXCH for recognition and thioether formation by synthesizing peptide analogs containing cysteine substitutions. Since the 20mer had heme attached by both HCCS and CcsBA, we used it as the base sequence for cysteine substitutions, as summarized in Table 1. Serine, homocysteine, and d-cysteine were substituted for each cysteine (of CXXCH). All substitutions were recognized by HCCS, having at least a single thioether, a result we attribute to the extended recognition requirement (alpha helix 1) and the His19 axial ligand (of CXXCH). We propose that this allows less dependency on the CXXCH motif. In contrast, CcsBA only recognized and attached heme to the variant with the first cysteine substituted by homocysteine. We propose that this is consistent with a more demanding recognition of the CXXCH motif at the active site of CcsBA. Clearly the serine substitutions cannot form thioethers. Consistent with this, for HCCS only the remaining cysteine had a thioether bond to heme. For HCCS, the only thiol amino acid analog with a thioether was d-cysteine substituted for the first cysteine (20mer DCys15 in Table 1). This suggests some rotational flexibility at the first thiol, but no ‘vertical’ flexibility since the homocysteine at Cys15 did not form a thioether. In contrast, for CcsBA, since only the homocysteine at Cys15 was attached, it may possess less rotational flexibility but more ‘vertical’ flexibility at the first cysteine at its active site. It is remarkable that in spite of the commonly proposed universal CXXCH motif for all c-type cytochromes, the bacterial and mitochondrial cyt c synthases have evolved quite different recognition determinants and thus, mechanisms. As discussed above, this is likely due to the limited c-type cyts in mitochondria (i.e. cyt c/cyt c1) but the large repertoire of c-type cyts in bacteria, each possessing CXXCH, and sometimes dozens of CXXCH motifs in a single bacterial protein.

Multiple approaches were used to demonstrate that CXXCH peptides with alpha helix one are not released by HCCS, with single cysteine substitutions even more tightly bound (see also Figure 3—figure supplement 3). Evidence is presented that peptides recognized by HCCS inhibit heme attachment to subsequently added cyt c. Thus, peptides are inhibitors. The basis for such inhibition will require more investigations, but two possible mechanisms are noted here. First, the peptides specifically use the heme at the HCCS active site, thus precluding use by cyt c. Such a mechanism of inhibition might be considered specific dead-end use of a substrate. Second, in principle, tightly bound peptides that are not released may inhibit subsequent binding of new heme and cyt c substrates; thus, they act as substrate analog type inhibitors. Future studies will further explore these possibilities with both the mitochondrial HCCS and bacterial cyt c synthases.

Materials and methods

Key resources table.

Reagent type (species) or
resource
Designation Source or reference Identifiers Additional information
Strain, strain background (Escherichia coli) NEB 5-α New England Biolabs fhuA2 Δ(argF-lacZ)U169 phoA glnV44 Φ80 Δ(lacZ)M15 gyrA96 recA1 relA1 endA1 thi-1 hsdR17 Electrocompetent cells
Strain, strain background (E. coli) C43(DE3) doi:10.1006/jmbi.1996.0399; Miroux and Walker, 1996 F – ompT hsdSB (rB- mB-) gal dcm (DE3) Electrocompetent cells
Strain, strain background (E. coli) RK103 doi:10.1111/j.1365–2958.2006.05132.x MG1655 Δccm::kanR , deleted for all ccm genes Electrocompetent cells, protein expression, functional assays
Strain, strain background (E. coli) MS36 doi:10.1128/mBio.02134–18 C43 Δccm::kanR , deleted for all ccm genes Electrocompetent cells, protein expression, functional assays
Antibody Anti-equine heart cytochromec (Rabbit polyclonal) doi:10.1074/jbc.M116.741231 (1:10,000)
Recombinant DNA reagent pRGK332 (plasmid) doi:10.1111/j.1365–2958.2006.05132.x pBAD Bordetella pertussis cytochrome c4:His
Recombinant DNA reagent pRGK368 (plasmid) doi:10.1128/JB.01388–06; Richard-Fogal et al., 2007 pGEX Helicobacter hepaticus GST:CcsBA
Recombinant DNA reagent pRGK403 (plasmid) doi:10.1073/pnas.1213897109 pGEX GST:HCCS
Recombinant DNA reagent pRGK420 (plasmid) doi:10.1073/pnas.1213897109 pGEX GST:HCCS H154A
Recombinant DNA reagent pMCS97 (plasmid) This study pGEX H. hepaticus GST:CcsBA:His See Materials and Methods and Supplementary file 1
Recombinant DNA reagent pMCS64 (plasmid) This study pGEX H. hepaticus GST*CcsBA:His See Materials and Methods and Supplementary file 1
Recombinant DNA reagent pMCS154 (plasmid) doi:10.1128/mBio.02134–18 pGEX H. hepaticus GST:CcsBA:His
Recombinant DNA reagent pMCS558 (plasmid) This study pGEX H. hepaticus *CcsBA:His See Materials and Methods and Supplementary file 1
Recombinant DNA reagent MCS598 (plasmid) This study pGEX H. hepaticus GST*CcsBA:His P-His1/2G See Materials and Methods and Supplementary file 1
Sequence-based reagent pGEX GST*F This study PCR Primer tcggatctggttccgcgttgaaggaggaaggatccatgatgaat
Sequence-based reagent pGEX GST*R This study PCR Primer attcatcatggatccttcctccttcaacgcggaaccagatccga
Sequence-based reagent pGEX CcsBA 6HisF This study PCR Primer gagtgcttgatatgccccatttacatcaccatcaccatcactaactcgagcggc
Sequence-based reagent pGEX CcsBA 6HisR This study PCR Primer gccgctcgagttagtgatggtgatggtgatgtaaatggggcatatcaagcactc
Sequence-based reagent MSP5 This study PCR Primer gtgcttaaatcttattggctcaacattggcgtctccgtcatca
Sequence-based reagent MSP6 This study PCR Primer tgatgacggagacgccaatgttgagccaataagatttaagcac
Sequence-based reagent MSP7 This study PCR Primer ttattatctcacaggtatgggcagctatgccgcaggagaa
Sequence-based reagent MSP8 This study PCR Primer ttctcctgcggcatagctgcccatacctgtgagataataa
Peptide, recombinant protein Holo-MP11 Sigma-Aldrich Cat. #M6756 See Supplementary file 2
Peptide, recombinant protein Biotin-56-mer RS-synthesis See Supplementary file 2
Peptide, recombinant protein Biotin-20 mer RS-synthesis See Supplementary file 2
Peptide, recombinant protein 20-mer RS-synthesis See Supplementary file 2
Peptide, recombinant protein Biotin-16 mer RS-synthesis See Supplementary file 2
Peptide, recombinant protein 11 mer RS-synthesis See Supplementary file 2
Peptide, recombinant protein nine mer-biotin RS-synthesis See Supplementary file 2
Peptide, recombinant protein 20 mer Cys15S RS-synthesis See Supplementary file 2
Peptide, recombinant protein 20 mer DCys15 CS Bio Co See Supplementary file 2
Peptide, recombinant protein 20 mer HoCys15 CS Bio Co See Supplementary file 2
Peptide, recombinant protein 20 mer Cys18S CS Bio Co See Supplementary file 2
Peptide, recombinant protein 20 mer DCys18 CS Bio Co See Supplementary file 2
Peptide, recombinant protein 20 mer HoCys18 CS Bio Co See Supplementary file 2
Peptide, recombinant protein 20 mer Cys15S/Cys18S CS Bio Co See Supplementary file 2
Peptide, recombinant protein 20mer H19A RS-synthesis See Supplementary file 2
Peptide, recombinant protein 20mer H19M RS-synthesis See Supplementary file 2
Peptide, recombinant protein 20mer H19K RS-synthesis See Supplementary file 2
Peptide, recombinant protein 20mer K6A, K8D, K9D, K14D RS-synthesis See Supplementary file 2
Peptide, recombinant protein Pierce-glutathione agarose Thermo Scientific Cat. #16101
Peptide, recombinant protein Talon Resin TaKaRa Cat. #635503
Chemical compound, drug Hematin Fisher Cat. #AAA1851803
Chemical compound, drug N, N, N’, N’-tetramethylbenzidine (TMBZ) Sigma Cat. #1086220001
Chemical compound, drug Equine horse-heart cytochrome c Sigma Cat. #C2506
Chemical compound, drug 2,6-dichloroindophenolate hydrate (DCPIP) Sigma Cat. #D-1878
Commercial assay or kit Pierce-SuperSignal West Femto ECL reagent Thermo Scientific Cat. #PI34096

Bacterial growth conditions

Escherichia coli strains were grown in Luria-Bertani (LB; Difco) broth with selective antibiotics and inducing reagents as required. Antibiotic/induction concentrations: carbenicillin, 50 µg/ml; chloramphenicol, 20 µg/ml, isopropyl β -D-1-thiogalactopyranoside (IPTG; Gold Biotechnology), 1.0 mM or 0.1 mM; arabinose (alfa Aesar), 0.2% (wt/vol).

Construction of strains and plasmids

Cloning was performed using E. coli NEB-5  α with the QuikChange II site-directed mutagenesis kit (Agilent Technologies) following the manufacturer’s instructions. Strains, plasmid, and primer lists are provided in Supplementary file 1 in supplemental material.

Protein purifications

GST-HCCS purifications were performed as previously described (San Francisco et al., 2013). Briefly, starter cultures (100 ml) were grown overnight at 37°C and 200 rpm. Starter cultures were used to inoculate 1 l of LB supplemented with appropriate antibiotics. One liter cultures were grown at 37°C and 120 rpm for 1 hr, and next expression of GST-HCCS was induced with 0.1 mM IPTG. Cells were harvested after 5 hr by centrifugation at 4500 g and cell pellets were stored at −80°C. Cell pellets were resuspended in PBS supplemented with 1 mM phenylmethansulfonul fluoride (PMSF), lysed by sonication (Branson250 sonicator), and cleared of cell debris by centrifugation at 24,000 g for 30 min at 4°C. Separation of soluble and membrane fractions was achieved by high-speed ultracentrifugation at 100,000 g for 45 min at 4°C. Membrane pellets were solubilized in 50 mM Tris pH 8, 150 mM NaCl, and 1% Triton X-100 for 1 hr on ice. Solubilized membranes were added to glutathione agarose (Pierce) for batch pulldown. Note, GST-HCCS used for in vitro reactions were heme loaded at this step by addition of 5 µM hemin during batch pulldown (see below). Columns were washed by gravity flow and eluted in 50 mM Tris pH8, 150 mM NaCl, and 0.02% Triton X-100 supplemented with 20 mM glutathione. Elution was concentrated using Amicon Ultra Centrifugal Filters (Millipore), and protein concentration was determined by Bradford assay (Sigma).

GST-CcsBA and GST-CcsBA:His purifications were performed as previously described (Frawley and Kranz, 2009; Sutherland et al., 2018b). Briefly, 5 ml starter cultures were grown for ~8 hr at 37°C with rocking. Starter cultures were diluted 1:200 into 1 l LB with selective antibiotics and grown overnight at 24°C and 240 rpm to saturation. Expression of GST-CcsBA was induced with 1 mM IPTG for 6 hr, cells were harvested at 4500 g, and cell pellets were stored at −80°C. Cell pellets were resuspended in Resin Buffer (20 mM Tris pH8, 100 mM NaCl) supplemented with 1 mM PMSF and 1 mg/ml egg white lysozyme (Sigma-Aldrich). Cells were lysed, cleared of debris, and separation of membrane fraction was performed as described for GST-HCCS above. Membrane pellets were solubilized in Resin Buffer with 1% n-dodecyl-β-d-maltopyranoside (DDM; Anatrace) and batch purified for 2 hr with glutathione agarose (Pierce). Columns were washed by gravity flow using Resin Buffer with 0.02% DDM and eluted in Resin Buffer with 0.02% DDM and 20 mM glutathione. Elution was concentrated using Amicon Ultra Centrifugal Filters (Millipore), and protein concentration was determined by Bradford assay (Sigma).

GST-CcsBA:His, GST*CcsBA:His and *CcsBA:His were performed as described above for GST-CcsBA with the following modifications. Batch pulldowns were performed using Talon Affinity Metal Resin (Takara). Gravity flow washes were performed in Resin buffer with 0.02% DDM supplemented with 0 mM imidazole (wash 1), 2 mM imidazole (wash 2), and 5 mM imidazole (wash 3). Protein was eluted in Resin Buffer with 0.02% DDM and 125 mM imidazole. Elution was concentrated using Amicon Ultra Centrifugal Filters (Millipore), and protein concentration was determined by Bradford assay (Sigma).

Heme loading of HCCS

To increase heme co-purification of GST-HCCS, exogenous heme was added to the affinity purification, resulting in ‘heme loaded’ HCCS. During binding of the solubilized membrane preparations to glutathione agarose, hemin (1.3 mg/ml in DMSO) was added to a final concentration of 5 µM. Heme loading increases HCCS heme co-purification from ~10% to ~30%. To determine the optimal concentration of hemin, a range of values was tested (see Figure 1—figure supplement 2). After batch affinity purification, the column was washed (removing unbound hemin) and eluted as described in protein purification section.

Heme staining, SYPRO Ruby, and Coomassie protein staining and immunoblotting

Samples were prepared in loading dye at 1:1 (v/v) that did not contain reducing agents and were not boiled to maintain heme signals. Samples were separated by SDS–PAGE or Tricine SDS–PAGE (peptides). Heme staining was performed by transfer to nitrocellulose and detection of heme signal using the SuperSignal Femto kit (Pierce) (Feissner et al., 2003), with imaging on a LI-COR odyssey Fc (LI-Cor Biosciences) or by in-gel heme stain with N, N, N’, N’-tetramethylbenzidine (TMBZ) (Feissner et al., 2003; Francis and Becker, 1984; Thomas et al., 1976). Total protein was detected by staining SDS–PAGE gels with Coomassie stain or nitrocellulose blots with SYPRO Ruby Blot Stain according to the manufacturer’s instructions (Molecular Probes). Immunoblots using an antibody specific to equine heart cytochrome c (Cocalico Biologics) were performed as previously described (Babbitt et al., 2016).

UV–vis absorption spectroscopy

UV–vis absorption spectroscopy was obtained with a Shimadzu UV-1800 spectrophotometer. Spectra were recorded in the assay buffer and under aerobic or anaerobic conditions as indicated. Heme quantification by Soret absorbance was performed with 50 µg of protein. Pyridine hemochrome assays were performed as previously described (Berry and Trumpower, 1987) in the assay buffer. If needed, sodium dithionite powder was used for protein reduction. Maturation of peptides by CcsBA was assessed by measuring the maximum or minimum of the second derivative of the final reaction spectrum.

In vitro reconstitution of synthase function

In vitro reconstitutions were performed aerobically (HCCS) or anaerobically (HCCS and CcsBA). For anaerobic reactions, all reagents were equilibrated with N2 (95%) and H2 (5%) in a Coy anaerobic airlock chamber. Affinity purified synthase (HCCS or CcsBA) was combined with apo equine heart cytochrome c or apo peptide at indicated concentrations. Apo cyt c and peptide concentrations used were determined to be within the range for maximal heme attachment as determined by a titration. An initial spectra and sample for SDS–PAGE analysis were obtained. Five millimolar DTT was added to initiate the reaction. Reactions were placed at 37°C, and spectra and gel samples were taken at indicated time points. Gel samples were immediately placed in loading dye (1:1 v/v) to stop the reaction.

Apo equine heart cytochrome c preparation

Apocytochrome c preparation was modified from Babul and Stellwagen, 1972. Cytochrome c from equine (horse) heart was obtained from Sigma, and a 1 ml 10 mg/ml solution was prepared in water. To remove heme, 200 µl of glacial acetic acid and 1.5 ml of 0.8% silver sulfate were added and the solution was incubated at 44°C for 4 hr. Sample was dialyzed in 0.2 M acetic acid overnight at 4°C. To precipitate apo cytochrome c and remove silver, sample was transferred to a conical tube and 10 volumes of cold acid acetone were added. Apo cytochrome c was pelleted by spinning at 15,000 rpm for 20 min at 4°C. The pellet was washed with acid acetone and pelleted three times. The apoprotein was resuspended in 0.2M acetic acid (~1 ml), and solid urea was added until the solution turned clear. A 25-fold molar excess of 2-mercaptoethonal was added and incubated at room temperature to remove silver sulfate. Apo cytochrome c was clarified by centrifugation at 12,000 rpm for 10 min at room temperature. Supernatant was dialyzed in 0.2 M acetic acid overnight and buffer exchanged into PBS by concentration in an Amicon Concentrator with 3 kDa molecular weight cutoff. Protein concentration was determined using a BSA standard curve and Coomassie protein staining on SDS–PAGE.

High-performance liquid chromatography

Affinity purified proteins or indicated in vitro reactions were resolved on an Agilent 1100 HPLC system equipped with an Agilent SEC-3 column in the purification or in vitro reaction buffer.

In vitro HCCS-tethered released product reaction

To determine whether in vitro synthesized cytochrome c (or peptide) was released from the synthase, GST-HCCS bound to glutathione agarose (75 µl) was combined with apocyt c (or peptide) under standard in vitro conditions (100 µl volume in addition to the 75 µl of beads). After a 1 hr reaction, the glutathione agarose-bound GST-HCCS were pelleted, and the supernatant was collected. Subsequently, the beads were washed to allow for analysis of protein retained on the beads. The bead fraction and supernatant were separated by SDS–PAGE and heme stained to determine which fraction contained heme attached cyt c. The amount of holo cyt c/peptide matured and released was quantitated using Image J (Rasband, 1997) by determining the ratio of the supernatant derived heme band with the total peptide band signal (beads plus supernatant). The supernatant was further analyzed by UV–vis spectroscopy.

CD spectroscopy of released cytochrome c

The supernatant from the released product assay (above) was extracted and pooled in an anaerobic environment and then concentrated in a 3K VivaspinTurbo cutoff filter (Sartorius) to obtain 300 μl of 0.4 mg/ml cyt c as determined by heme absorbance at 550 nm (ext. coef. 29.5 mM−1 cm−1). The near UV (500–300 nm) signal was measured on a Jasco J-815 at room temperature in the reaction buffer (20 mM Tris pH 8.0, 100 mM NaCl, 0.02% DDM, 5 mM DTT). The machine sensitivity was 100 mdeg, the data pitch was 0.5 nm, the scanning mode was continuous, the scanning speed was 50 nm/min, the response rate was 1 s, the bandwidth was 1 nm, and five accumulations were taken (Mendez et al., 2017). A blank sample was subtracted. To compare the absorbance of the released assay product to human cyt c, each CD spectra was subtracted from a blank sample and divided by the absorbance of the protein in the CD machine. The samples were overlaid and coincide with each other.

Determination of heme redox potential

Redox potential of in vitro synthesized equine heart cytochrome c was determined by a modified Massey method as described in Sutherland et al., 2016, with the following modifications: The absorbance change of heme was monitored at the alpha peak at 550 nm (negligible contribution from reference dye) and the reduction of the reference dye, dichlorophenolindophenol, at 636 nm (negligible contribution from heme).

In vitro inhibition assay

To determine whether the CXXCH containing peptides inhibited maturation of cytochrome c (i.e. heme attachment), a two-step reaction was performed. Step 1: 10 μM GST-HCCS (30% heme occupancy) was combined with 10 μM apo peptide for a 1 hr in vitro reaction. After 1 hr, UV–vis spectra were performed, and a sample was collected for gel analysis. Step 2: 20 μM apo cytochrome c was added to the reaction. After 1 hr, UV–vis spectra were performed and a sample was collected for gel analysis. To determine whether cytochrome c maturation was inhibited or not inhibited by the peptide, heme stain and Coomassie total protein stain were performed.

In vivo functional (heme attachment) assays

Assays were performed as in Sutherland et al., 2018b. Detailed methods are provided in Supplemental Methods.

Generation of the modeled structure of HCCS

The HCCS structure was produced using Rosetta, which was informed by structural motifs (Robetta) and coevolutionary data (Gremlin) as has been described (Ovchinnikov et al., 2017; Ovchinnikov et al., 2015; Sutherland et al., 2018b; Sutherland et al., 2018a), and will be detailed later.

Acknowledgements

We thank Jen Hsu and Jeff Orf for technical assistance on the HCCS in vitro assay and Hani S Zaher and Kyusik Kim for use of their HPLC. This work was funded by the National Institutes of Health (R01 GM47909 to RGK).

Funding Statement

The funders had no role in study design, data collection and interpretation, or the decision to submit the work for publication.

Contributor Information

Molly C Sutherland, Email: msuther@udel.edu.

Robert G Kranz, Email: Kranz@wustl.edu.

Michael A Marletta, University of California, Berkeley, United States.

Iqbal Hamza, University of Maryland, United States.

Funding Information

This paper was supported by the following grant:

  • National Institutes of Health R01 GM47909 to Robert G Kranz.

Additional information

Competing interests

No competing interests declared.

Washington University (Robert Kranz and Deanna Mendez, inventors) has applied for a provisional patent titled "PEPTIDE-BASED INHIBITORS OF CYTOCHROME BIOGENESIS". APPLICATION NUMBER: 63158593.

Washington University (Robert Kranz and Deanna Mendez, inventors) has applied for a provisional patent titled "PEPTIDE-BASED INHIBITORS OF CYTOCHROME BIOGENESIS". APPLICATION NUMBER: 63158593.

Author contributions

Conceptualization, Investigation, Methodology, Writing - original draft, Writing - review and editing.

Conceptualization, Investigation, Methodology, Writing - original draft, Writing - review and editing.

Conceptualization, Investigation, Methodology, Writing - review and editing.

Investigation, Writing - review and editing.

Investigation, Writing - review and editing.

Investigation, Writing - review and editing, Carried out HCCS structural predictions.

Investigation, Writing - review and editing.

Investigation, Writing - review and editing.

Conceptualization, Supervision, Funding acquisition, Investigation, Methodology, Writing - original draft, Writing - review and editing.

Additional files

Supplementary file 1. Relevant strains, plasmids, and primers.
elife-64891-supp1.docx (19.8KB, docx)
Supplementary file 2. Apo peptides used for in vitro assays.
elife-64891-supp2.docx (14.3KB, docx)
Transparent reporting form

Data availability

Data generated is provided in the manuscript. Source data files are provided for Figure 2C/Figure 4C/Figure 3—figure supplement 1C; Figure 3—figure supplement 1C; Figure 7—figure supplement 1C.

References

  1. Ahuja U, Kjelgaard P, Schulz BL, Thöny-Meyer L, Hederstedt L. Haem-delivery proteins in cytochrome c maturation system II. Molecular Microbiology. 2009;73:1058–1071. doi: 10.1111/j.1365-2958.2009.06833.x. [DOI] [PubMed] [Google Scholar]
  2. Allen JWA, Barker PD, Daltrop O, Stevens JM, Tomlinson EJ, Sinha N, Sambongi Y, Ferguson SJ. Why isn't ‘standard’ heme good enough for c-type and d1-type cytochromes? Dalton Transactions. 2005;11:3410–3418. doi: 10.1039/b508139b. [DOI] [PubMed] [Google Scholar]
  3. Aojula HS, Wilson MT, Drake A. Characterization of haem disorder by circular dichroism. Biochemical Journal. 1986;237:613–616. doi: 10.1042/bj2370613. [DOI] [PMC free article] [PubMed] [Google Scholar]
  4. Babbitt SE, San Francisco B, Mendez DL, Lukat-Rodgers GS, Rodgers KR, Bretsnyder EC, Kranz RG. Mechanisms of mitochondrial holocytochrome c Synthase and the Key Roles Played by Cysteines and Histidine of the Heme Attachment Site, Cys-XX-Cys-His. Journal of Biological Chemistry. 2014;289:28795–28807. doi: 10.1074/jbc.M114.593509. [DOI] [PMC free article] [PubMed] [Google Scholar]
  5. Babbitt SE, Sutherland MC, San Francisco B, Mendez DL, Kranz RG. Mitochondrial cytochrome c biogenesis: no longer an enigma. Trends in Biochemical Sciences. 2015;40:446–455. doi: 10.1016/j.tibs.2015.05.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  6. Babbitt SE, Hsu J, Kranz RG. Molecular basis behind inability of mitochondrial holocytochrome c synthase to mature bacterial cytochromes: defining a critical role for cytochrome c α HELIX-1. Journal of Biological Chemistry. 2016;291:17523–17534. doi: 10.1074/jbc.M116.741231. [DOI] [PMC free article] [PubMed] [Google Scholar]
  7. Babbitt SE, Hsu J, Mendez DL, Kranz RG. Biosynthesis of single thioether c-Type cytochromes provides insight into mechanisms intrinsic to holocytochrome c synthase (HCCS) Biochemistry. 2017;56:3337–3346. doi: 10.1021/acs.biochem.7b00286. [DOI] [PMC free article] [PubMed] [Google Scholar]
  8. Babul J, Stellwagen E. Participation of the protein ligands in the folding of cytochrome c. Biochemistry. 1972;11:1195–1200. doi: 10.1021/bi00757a013. [DOI] [PubMed] [Google Scholar]
  9. Beckett CS, Loughman JA, Karberg KA, Donato GM, Goldman WE, Kranz RG. Four genes are required for the system II cytochrome c biogenesis pathway in Bordetella pertussis, a unique bacterial model. Molecular Microbiology. 2000;38:465–481. doi: 10.1046/j.1365-2958.2000.02174.x. [DOI] [PubMed] [Google Scholar]
  10. Berry EA, Trumpower BL. Simultaneous determination of hemes a, b, and c from pyridine hemochrome spectra. Analytical Biochemistry. 1987;161:1–15. doi: 10.1016/0003-2697(87)90643-9. [DOI] [PubMed] [Google Scholar]
  11. Bonnard G, Corvest V, Meyer EH, Hamel PP. Redox processes controlling the biogenesis of c-type cytochromes. Antioxidants & Redox Signaling. 2010;13:1385–1401. doi: 10.1089/ars.2010.3161. [DOI] [PubMed] [Google Scholar]
  12. Bowman SE, Bren KL. The chemistry and biochemistry of heme c: functional bases for covalent attachment. Natural Product Reports. 2008;25:1118. doi: 10.1039/b717196j. [DOI] [PMC free article] [PubMed] [Google Scholar]
  13. Corvest V, Murrey DA, Bernard DG, Knaff DB, Guiard B, Hamel PP. c-type cytochrome assembly in Saccharomyces cerevisiae: a key residue for apocytochrome c1/lyase interaction. Genetics. 2010;186:561–571. doi: 10.1534/genetics.110.120022. [DOI] [PMC free article] [PubMed] [Google Scholar]
  14. Deane C. The new face of nanowires. Nature Chemical Biology. 2019;15:551. doi: 10.1038/s41589-019-0299-1. [DOI] [PubMed] [Google Scholar]
  15. Dickerson RE, Takano T, Eisenberg D, Kallai OB, Samson L, Cooper A, Margoliash E. Ferricytochrome c. I. general features of the horse and bonito proteins at 2.8 A resolution. The Journal of Biological Chemistry. 1971;246:1511–1535. doi: 10.1016/S0021-9258(19)77002-1. [DOI] [PubMed] [Google Scholar]
  16. Dreyfuss BW, Hamel PP, Nakamoto SS, Merchant S. Functional analysis of a divergent system II protein, Ccs1, involved in c-Type Cytochrome Biogenesis. Journal of Biological Chemistry. 2003;278:2604–2613. doi: 10.1074/jbc.M208652200. [DOI] [PubMed] [Google Scholar]
  17. Dumont ME, Ernst JF, Hampsey DM, Sherman F. Identification and sequence of the gene encoding cytochrome c heme lyase in the yeast Saccharomyces cerevisiae . The EMBO Journal. 1987;6:235–241. doi: 10.1002/j.1460-2075.1987.tb04744.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  18. Efimov I, Papadopoulou ND, McLean KJ, Badyal SK, Macdonald IK, Munro AW, Moody PC, Raven EL. The redox properties of ascorbate peroxidase. Biochemistry. 2007;46:8017–8023. doi: 10.1021/bi7006492. [DOI] [PubMed] [Google Scholar]
  19. Ernster L, Schatz G. Mitochondria: a historical review. Journal of Cell Biology. 1981;91:227s–255s. doi: 10.1083/jcb.91.3.227s. [DOI] [PMC free article] [PubMed] [Google Scholar]
  20. Feissner R, Xiang Y, Kranz RG. Chemiluminescent-based methods to detect subpicomole levels of c-type cytochromes. Analytical Biochemistry. 2003;315:90–94. doi: 10.1016/S0003-2697(02)00658-9. [DOI] [PubMed] [Google Scholar]
  21. Feissner RE, Richard-Fogal CL, Frawley ER, Loughman JA, Earley KW, Kranz RG. Recombinant cytochromes c biogenesis systems I and II and analysis of haem delivery pathways in Escherichia coli . Molecular Microbiology. 2006;60:563–577. doi: 10.1111/j.1365-2958.2006.05132.x. [DOI] [PubMed] [Google Scholar]
  22. Ferguson SJ, Stevens JM, Allen JWA, Robertson IB. Cytochrome c assembly: a tale of ever increasing variation and mystery? Biochimica Et Biophysica Acta (BBA) - Bioenergetics. 2008;1777:980–984. doi: 10.1016/j.bbabio.2008.03.020. [DOI] [PubMed] [Google Scholar]
  23. Francis RT, Becker RR. Specific indication of hemoproteins in polyacrylamide gels using a double-staining process. Analytical Biochemistry. 1984;136:509–514. doi: 10.1016/0003-2697(84)90253-7. [DOI] [PubMed] [Google Scholar]
  24. Frawley ER, Kranz RG. CcsBA is a cytochrome c synthetase that also functions in heme transport. PNAS. 2009;106:10201–10206. doi: 10.1073/pnas.0903132106. [DOI] [PMC free article] [PubMed] [Google Scholar]
  25. Gabilly ST, Hamel PP. Maturation of plastid c-type Cytochromes. Frontiers in Plant Science. 2017;8:1313. doi: 10.3389/fpls.2017.01313. [DOI] [PMC free article] [PubMed] [Google Scholar]
  26. Hu W, Kan ZY, Mayne L, Englander SW. Cytochrome c folds through foldon-dependent native-like intermediates in an ordered pathway. PNAS. 2016;113:3809–3814. doi: 10.1073/pnas.1522674113. [DOI] [PMC free article] [PubMed] [Google Scholar]
  27. Kan SB, Lewis RD, Chen K, Arnold FH. Directed evolution of cytochrome c for carbon–silicon bond formation: Bringing silicon to life. Science. 2016;354:1048–1051. doi: 10.1126/science.aah6219. [DOI] [PMC free article] [PubMed] [Google Scholar]
  28. Kan SBJ, Huang X, Gumulya Y, Chen K, Arnold FH. Genetically programmed chiral organoborane synthesis. Nature. 2017;552:132–136. doi: 10.1038/nature24996. [DOI] [PMC free article] [PubMed] [Google Scholar]
  29. Kleingardner JG, Bren KL. Comparing substrate specificity between cytochrome c maturation and cytochrome c heme lyase systems for cytochrome c biogenesis. Metallomics. 2011;3:396. doi: 10.1039/c0mt00086h. [DOI] [PMC free article] [PubMed] [Google Scholar]
  30. Kranz R, Lill R, Goldman B, Bonnard G, Merchant S. Molecular mechanisms of cytochrome c biogenesis: three distinct systems. Molecular Microbiology. 1998;29:383–396. doi: 10.1046/j.1365-2958.1998.00869.x. [DOI] [PubMed] [Google Scholar]
  31. Kranz RG, Richard-Fogal C, Taylor JS, Frawley ER. Cytochrome c biogenesis: mechanisms for covalent modifications and trafficking of heme and for heme-iron redox control. Microbiology and Molecular Biology Reviews. 2009;73:510–528. doi: 10.1128/MMBR.00001-09. [DOI] [PMC free article] [PubMed] [Google Scholar]
  32. Le Brun NE, Bengtsson J, Hederstedt L. Genes required for cytochrome c synthesis in Bacillus subtilis . Molecular Microbiology. 2000;36:638–650. doi: 10.1046/j.1365-2958.2000.01883.x. [DOI] [PubMed] [Google Scholar]
  33. Mendez DL, Babbitt SE, King JD, D'Alessandro J, Watson MB, Blankenship RE, Mirica LM, Kranz RG. Engineered holocytochrome c synthases that biosynthesize new cytochromes c . PNAS. 2017;114:2235–2240. doi: 10.1073/pnas.1615929114. [DOI] [PMC free article] [PubMed] [Google Scholar]
  34. Merchant SS. His protects heme as it crosses the membrane. PNAS. 2009;106:10069–10070. doi: 10.1073/pnas.0905189106. [DOI] [PMC free article] [PubMed] [Google Scholar]
  35. Miroux B, Walker JE. Over-production of proteins in Escherichia coli: mutant hosts that allow synthesis of some membrane proteins and globular proteins at high levels. Journal of Molecular Biology. 1996;260:289–298. doi: 10.1006/jmbi.1996.0399. [DOI] [PubMed] [Google Scholar]
  36. Nagai M, Nagai Y, Imai K, Neya S. Circular dichroism of hemoglobin and myoglobin: CD of hemoglobin and myoglobin. Chirality. 2014;26:438–442. doi: 10.1002/chir.22273. [DOI] [PubMed] [Google Scholar]
  37. Ovchinnikov S, Kinch L, Park H, Liao Y, Pei J, Kim DE, Kamisetty H, Grishin NV, Baker D. Large-scale determination of previously unsolved protein structures using evolutionary information. eLife. 2015;4:e09248. doi: 10.7554/eLife.09248. [DOI] [PMC free article] [PubMed] [Google Scholar]
  38. Ovchinnikov S, Park H, Varghese N, Huang PS, Pavlopoulos GA, Kim DE, Kamisetty H, Kyrpides NC, Baker D. Protein structure determination using metagenome sequence data. Science. 2017;355:294–298. doi: 10.1126/science.aah4043. [DOI] [PMC free article] [PubMed] [Google Scholar]
  39. Ow YP, Green DR, Hao Z, Mak TW. Cytochrome c: functions beyond respiration. Nature Reviews. Molecular Cell Biology. 2008;9:532–542. doi: 10.1038/nrm2434. [DOI] [PubMed] [Google Scholar]
  40. Pletneva EV, Gray HB, Winkler JR. Snapshots of cytochrome c folding. PNAS. 2005;102:18397–18402. doi: 10.1073/pnas.0509076102. [DOI] [PMC free article] [PubMed] [Google Scholar]
  41. Pollock WB, Rosell FI, Twitchett MB, Dumont ME, Mauk AG. Bacterial expression of a mitochondrial cytochrome c. trimethylation of lys72 in yeast iso-1-cytochrome c and the alkaline conformational transition. Biochemistry. 1998;37:6124–6131. doi: 10.1021/bi972188d. [DOI] [PubMed] [Google Scholar]
  42. Rasband WS. ImageJ. US national institutes of health, Bethesda, MD . 1997. [September 14, 2020]. http://imagej.nih.gov/ij/
  43. Richard-Fogal CL, Frawley ER, Feissner RE, Kranz RG. Heme concentration dependence and metalloporphyrin inhibition of the system I and II cytochrome c assembly pathways. Journal of Bacteriology. 2007;189:455–463. doi: 10.1128/JB.01388-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
  44. Richard-Fogal CL, Frawley ER, Bonner ER, Zhu H, San Francisco B, Kranz RG. A conserved haem redox and trafficking pathway for cofactor attachment. The EMBO Journal. 2009;28:2349–2359. doi: 10.1038/emboj.2009.189. [DOI] [PMC free article] [PubMed] [Google Scholar]
  45. San Francisco B, Bretsnyder EC, Kranz RG. Human mitochondrial holocytochrome c synthase's heme binding, maturation determinants, and complex formation with cytochrome c . PNAS. 2013;110:E788–E797. doi: 10.1073/pnas.1213897109. [DOI] [PMC free article] [PubMed] [Google Scholar]
  46. Shen Y, Maupetit J, Derreumaux P, Tufféry P. Improved PEP-FOLD approach for peptide and miniprotein structure prediction. Journal of Chemical Theory and Computation. 2014;10:4745–4758. doi: 10.1021/ct500592m. [DOI] [PubMed] [Google Scholar]
  47. Simon J, Hederstedt L. Composition and function of cytochrome c biogenesis system II. FEBS Journal. 2011;278:4179–4188. doi: 10.1111/j.1742-4658.2011.08374.x. [DOI] [PubMed] [Google Scholar]
  48. Sutherland MC, Rankin JA, Kranz RG. Heme trafficking and modifications during system I cytochrome c Biogenesis: Insights from Heme Redox Potentials of Ccm Proteins. Biochemistry. 2016;55:3150–3156. doi: 10.1021/acs.biochem.6b00427. [DOI] [PMC free article] [PubMed] [Google Scholar]
  49. Sutherland MC, Jarodsky JM, Ovchinnikov S, Baker D, Kranz RG. Structurally mapping endogenous heme in the CcmCDE membrane complex for cytochrome c biogenesis. Journal of Molecular Biology. 2018a;430:1065–1080. doi: 10.1016/j.jmb.2018.01.022. [DOI] [PMC free article] [PubMed] [Google Scholar]
  50. Sutherland MC, Tran NL, Tillman DE, Jarodsky JM, Yuan J, Kranz RG. Structure-Function analysis of the bifunctional CcsBA heme exporter and cytochrome c Synthetase. mBio. 2018b;9:e02134-18. doi: 10.1128/mBio.02134-18. [DOI] [PMC free article] [PubMed] [Google Scholar]
  51. Tait SW, Green DR. Mitochondria and cell death: outer membrane permeabilization and beyond. Nature Reviews Molecular Cell Biology. 2010;11:621–632. doi: 10.1038/nrm2952. [DOI] [PubMed] [Google Scholar]
  52. Thévenet P, Shen Y, Maupetit J, Guyon F, Derreumaux P, Tufféry P. PEP-FOLD: an updated de novo structure prediction server for both linear and disulfide bonded cyclic peptides. Nucleic Acids Research. 2012;40:W288–W293. doi: 10.1093/nar/gks419. [DOI] [PMC free article] [PubMed] [Google Scholar]
  53. Thomas PE, Ryan D, Levin W. An improved staining procedure for the detection of the peroxidase activity of cytochrome P-450 on sodium dodecyl sulfate polyacrylamide gels. Analytical Biochemistry. 1976;75:168–176. doi: 10.1016/0003-2697(76)90067-1. [DOI] [PubMed] [Google Scholar]
  54. Verissimo AF, Sanders J, Daldal F, Sanders C. Engineering a prokaryotic apocytochrome c as an efficient substrate for Saccharomyces cerevisiae cytochrome c heme lyase. Biochemical and Biophysical Research Communications. 2012;424:130–135. doi: 10.1016/j.bbrc.2012.06.088. [DOI] [PMC free article] [PubMed] [Google Scholar]
  55. Verissimo AF, Daldal F. Cytochrome c biogenesis system I: an intricate process catalyzed by a maturase supercomplex? Biochimica Et Biophysica Acta (BBA) - Bioenergetics. 2014;1837:989–998. doi: 10.1016/j.bbabio.2014.03.003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  56. Wang F, Gu Y, O’Brien JP, Yi SM, Yalcin SE, Srikanth V, Shen C, Vu D, Ing NL, Hochbaum AI, Egelman EH, Malvankar NS. Structure of microbial nanowires reveals stacked hemes that transport electrons over micrometers. Cell. 2019;177:361–369. doi: 10.1016/j.cell.2019.03.029. [DOI] [PMC free article] [PubMed] [Google Scholar]
  57. Watkins DW, Jenkins JMX, Grayson KJ, Wood N, Steventon JW, Le Vay KK, Goodwin MI, Mullen AS, Bailey HJ, Crump MP, MacMillan F, Mulholland AJ, Cameron G, Sessions RB, Mann S, Anderson JLR. Construction and in vivo assembly of a catalytically proficient and hyperthermostable de novo enzyme. Nature Communications. 2017;8:358. doi: 10.1038/s41467-017-00541-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
  58. Xie Z, Merchant S. The Plastid-encoded ccsA gene is required for heme attachment to chloroplast c-type cytochromes. Journal of Biological Chemistry. 1996;271:4632–4639. doi: 10.1074/jbc.271.9.4632. [DOI] [PubMed] [Google Scholar]
  59. Yamada S, Bouley Ford ND, Keller GE, Ford WC, Gray HB, Winkler JR. Snapshots of a protein folding intermediate. PNAS. 2013;110:1606–1610. doi: 10.1073/pnas.1221832110. [DOI] [PMC free article] [PubMed] [Google Scholar]
  60. Zhang Y, Stevens JM, Ferguson SJ. Substrate recognition of holocytochrome c synthase: n-terminal region and CXXCH motif of mitochondrial cytochrome c . FEBS Letters. 2014;588:3367–3374. doi: 10.1016/j.febslet.2014.07.026. [DOI] [PMC free article] [PubMed] [Google Scholar]

Decision letter

Editor: Iqbal Hamza1
Reviewed by: Iqbal Hamza2, Amy E Medlock3

In the interests of transparency, eLife publishes the most substantive revision requests and the accompanying author responses.

Acceptance summary:

This manuscript provides the molecular mechanisms for how two seemingly disparate cytochrome c synthases, a human mitochondrial (HCCS) and bacterial (CcsBA), utilizes surprisingly similar steps for covalent attachment of heme to cytochrome c.

Decision letter after peer review:

Thank you for submitting your article "in vitro reconstitution reveals major differences between human and bacterial cytochrome c synthases" for consideration by eLife. Your article has been reviewed by 3 peer reviewers, including Iqbal Hamza as the Reviewing Editor and Reviewer #1, and the evaluation has been overseen by Michael Marletta as the Senior Editor. The following individual involved in review of your submission has agreed to reveal their identity: Amy E. Medlock (Reviewer #2).

The reviewers have discussed their reviews with one another, and the Reviewing Editor has drafted this to help you prepare a revised submission.

Essential Revisions:

As you can see below, all three reviewers recommended publication of the manuscript. They all agreed that the work is thorough and rigorous. The parallel work with the human and bacterial CCS provides a broad and universal appeal. The recommendations by the reviewers should not result in any additional experiments, but the revised manuscript should provide better clarity and presentation, especially with the figure layout. We look forward to the revised manuscript.

Reviewer #1:

This is a thoughtful and elegant study of how human (HCCS) and bacterial (CcsBA) cytochrome c synthases provide heme and catalyze covalent attachment of heme to its cognate cytochrome c recipient. The study is comprehensive and is well-done. I have only a few suggestions to help improve the readability of this manuscript and its overall impact.

1. The authors have performed a comprehensive analyses using physicochemical and spectroscopic methods comparing their assay-generated holo cyt c to purified cyt c. Is there a functional assay to evaluate whether the holo cyt c generated in their assays are actually biologically active?

2. I had a difficult time seeing the figures and reading some of the figure legends (Figure 2 is especially poorly-written).

3. In Figure 2h, the authors first added the peptide (11, 16, and 20mers) before performing a competition with apocyt c to determine how well heme transfer versus release occurs with HCCS. Have the authors performed this experiment in the presence of increasing concentrations of apocytc? What will be effect of the peptides if apocyt c was added simultaneously with the peptide for "hemylation"?

Reviewer #2:

The goal of the authors was to construct an in vitro system for cytochrome c maturation in order to identify and compare the attachment elements necessary for the human and bacterial systems. This work is a large technical advance and thus allowed the characterization of the different cytochrome c biogenesis systems at a much finer level than was previously possible. The key finding in the manuscript are supported by the data and set the stage for future studies to evaluate the mechanisms of cytochrome maturation inhibition and the development of therapeutics to target cytochrome c.

The manuscript by Sutherland et al. entitled "in vitro reconstitution reveals major differences between human and bacterial cytochrome c synthases" describes the first in vitro systems for the reconstitution of cytochrome c by the human system (system III) and a bacterial system (system II). These in vitro systems revealed several important aspects of HCCS (system III) and CcsBA (system II). First, besides the reductant (DTT), both synthases can function in vitro without any other protein or protein cofactor. Second, they produce holo-cytochrome c that structurally, as evaluated by CD, and functionally, as evaluated by redox titrations, is identical to holoprotein produced in vivo. The development of the in vitro maturation of cytochrome c then allowed the detailed analysis of the necessary recognition sequence or elements for HCCS (system III) and CcsBA (system II) cytochrome c maturation. Synthetic peptides of varying lengths with the CXXCH motif were used to determine the minimal structural or sequence units necessary. Elements necessary for recognition between HCCS and CcsBA differed at both the amino acid and length or secondary structure levels. While HCCS required alpha helix 1 and only one cysteine in the CXXCH motif, CcsBA required both cysteines and the histidine of the CXXCH motif, but not helix 1. Interestingly these peptides inhibited cytochrome c maturation, in the case of HCCS by not being released from the enzyme. The development of this in vitro system, characterization of the minimal recognition sequences for HCCS and CcsBA, comparison of HCCS and CcsBA recognition motifs and inhibition of synthases by peptides are an important discovery and relevant for considering cytochrome c maturation as a target for antimicrobial compounds. The concerns outlined below should be easily addressed by the authors and would likely require minor edits to the text. Thus this work warrant publication in eLife with the following revisions.

1. A claim of the paper is that helix 1 is necessary, yet no experiments were done to determine if the helix forms in the peptides. Has the formation of the helix in the peptides, in which it is proposed to form, been investigated (such as by CD or crystallization)? If not, can the conclusion be modified to address this?

2. For the 16mer, it appears that only the biotin-16mer (Figure 2a and Table S2) was used for the studies whereas the Biotin-20mer and the 20mer are listed. Does the Biotin-20mer behave identically to the 20mer? Discussion and confirmation of this in the text is important to show that the biotin tag doesn't affect the peptide structure and thus the recognition.

3. For the CcsBA system the time necessary for in vitro cytochrome c biogenesis is 3 hours while the HCCs is 1 hour. Why the difference? Could the system be a missing factor? This could be addressed within the text.

4. Statistical information is missing. While quantification on a number of experiments was performed, no statistical analysis is included. One example is in the results lines 285 to 286 and discussion lines 484 to 487, the release of cytochrome c, the 20mer and the 20mer SXXCH are discussed and data presented in Figures 2e and S4. While multiple experiments were performed no statistical analysis was provided. This should be added to understand the accuracy of these measurements and support for the conclusion.

5. Based on the lack of release of peptides by HCCS it is concluded that the folding of the protein is necessary for optimal release. If helix 1 is formed and necessary for attachment, this suggests that some secondary structural elements are formed and that tertiary structure is necessary for release. As noted above investigation of the structural elements of the peptides would strengthen and this could be added to the text.

6. In the Results section there is no summary of the H and K mutants, it would be helpful to add one or two sentences as this is a significant part of the discussion and basis for the model presented in Figure 5.

Reviewer #3:

The manuscript has two main thrusts. Firstly, the authors developed an in vitro assay for cytochrome c biosynthesis, namely the covalent attachment of heme to apocytochrome c catalyzed by cytochrome c synthase. They reconstituted the synthases from both human (mitochrondrial) and bacterial enzymes, which are structurally unrelated proteins despite catalyzing the same reaction. Secondly, they use this reconstitution assay to probe features of cytochrome c synthesis by the two enzymes and show numerous differences in the mechanism by the two enzymes. A practical implication of this is the use of bacterial-specific peptide inhibitors for antibiotic therapy.

The reconstitution conditions are described thoroughly and are well-controlled. They show that the enzyme bound to glutathione beads behaves similarly to the free protein and, overall, that the in vitro assay recapitulates what occurs in cells.

Using peptides containing the CXXCH heme attachment site of cytochrome c as substrates for the human synthase (HCCS), the authors show that peptides require the alpha helix adjacent to the attachment site for heme attachment. However, the reaction product was not released from the enzyme. This suggests that cytochrome c folding is needed for product release. These peptides were able to inhibit heme attachment to cytochrome c by HCCS.

The bacterial cytochrome c synthase from Helicobacter (CcsBA) was also reconstituted in vitro. Bacterial cytochrome c biogenesis involves numerous accessory proteins, and therefore it is useful to know that CcsBA was sufficient to catalyze heme attachment. Unlike the human enzyme, it was able to attach heme to a peptide lacking the alpha helix, which correlates with the fact that the bacterial cytochrome c normally lacks the helix adjacent to the CXXCH binding site. Thus, the mitochondrial and bacterial cytochrome c synthases recognize different parts of the apo-cytochrome c substrate.

Differences between the two enzymes were also observed using peptides with thiol substitutions within the CXXCH site. These substitutions included serine, D-cysteine and homocysteine. The mitochrondrial enzyme HCCS was able to catalyze a covalent heme linkage to all of the substituted peptides except for SXXSH. By contrast, the bacterial synthase showed a more stringent thiol requirement, only reacting effectively with one of the homocysteine substitutions. Even here there were differences between the two enzymes, with the bacterial and mitochrondrial enzymes forming 2 and 1 thioether linkages, respectively.

In summary, the quality of the work is high, and it is clearly described. The in vitro reconstitution of holo-cytochrome c synthesis opens up numerous avenues to explore. The identified differences between the human and bacterial enzymes has mechanistic and evolutionary implications.

This study is novel, thorough and well-written and so I have no major suggestions.

eLife. 2021 May 11;10:e64891. doi: 10.7554/eLife.64891.sa2

Author response


Reviewer #1:

This is a thoughtful and elegant study of how human (HCCS) and bacterial (CcsBA) cytochrome c synthases provide heme and catalyze covalent attachment of heme to its cognate cytochrome c recipient. The study is comprehensive and is well-done. I have only a few suggestions to help improve the readability of this manuscript and its overall impact.

1. The authors have performed a comprehensive analyses using physicochemical and spectroscopic methods comparing their assay-generated holo cyt c to purified cyt c. Is there a functional assay to evaluate whether the holo cyt c generated in their assays are actually biologically active?

As reviewer #2 indicates, “functionality (is) evaluated by redox titrations”. The cyt c synthesized in vitro had identical potential as the published (and in vivo produced here).

2. I had a difficult time seeing the figures and reading some of the figure legends (Figure 2 is especially poorly-written).

We have divided up and enlarged figures to increase readability. We have revised figure legends to improve clarity. Figures are divided as follows: Figure 1 into 2 parts (a-e and f-k), Figure 2 into 2 parts (a-c and d-h), Figure 3 into 2 parts (b-c and a, d-i) to make the figures more accessible to the reader. We thank the reviewer for this suggestion.

3. In Figure 2h, the authors first added the peptide (11, 16, and 20mers) before performing a competition with apocyt c to determine how well heme transfer versus release occurs with HCCS. Have the authors performed this experiment in the presence of increasing concentrations of apocytc? What will be effect of the peptides if apocyt c was added simultaneously with the peptide for "hemylation"?

We did not perform the exact experiments that the reviewer is asking for. The conditions presented in this experiment are 10mM HCCS (30% heme occupancy) 10mM peptide and 20 mM apo cyt c. We have clarified the methods to include the assay concentrations (10mM HCCS, 10mM peptide, 20mM Apo cyt c) (see lines 657-660 final manuscript file). Although not included in the manuscript, we have varied the amount of peptide in the experiment during the initial assay development. Peptide was titrated using 1, 3, 10 mM concentrations. Lower peptide concentrations resulted in increased cyt c yield. We interpret this to mean that when heme present in the synthase, cyt c will be made, thus peptide inhibition is due the peptide consuming heme. This is addressed as a possibility in the Discussion.

Reviewer #2:

[…] The concerns outlined below should be easily addressed by the authors and would likely require minor edits to the text. Thus this work warrant publication in eLife with the following revisions.

1. A claim of the paper is that helix 1 is necessary, yet no experiments were done to determine if the helix forms in the peptides. Has the formation of the helix in the peptides, in which it is proposed to form, been investigated (such as by CD or crystallization)? If not, can the conclusion be modified to address this?

We have not experimentally determined the structure of the 11-, 16-, and 20mer peptides. The structures in Figure 3 are derived from the crystal structure of human cytochrome c (PDB: 3ZCF), as noted in the Figure legend 3 (see lines 715-717 final manuscript file). As noted, PEP-FOLD programs were used to predict alpha helical structures of peptides, these are consistent with the secondary structures in native cyt c. We have added language to the text to make it more clear what caveats there are to the alpha helical structure of the peptides (see discussion). Regardless of the alpha helical secondary structure, recognition by HCCS clearly also requires key sidechains within this sequence (e.g. 20mer peptide with K6A, K8D, K9D, K14D substitutions and in vivo work on F11). Although these sidechains are likely recognized in the context of alpha helix 1 structure, the helical structure of this sequence does not impact our results or conclusions thereof.

2. For the 16mer, it appears that only the biotin-16mer (Figure 2a and Table S2) was used for the studies whereas the Biotin-20mer and the 20mer are listed. Does the Biotin-20mer behave identically to the 20mer? Discussion and confirmation of this in the text is important to show that the biotin tag doesn't affect the peptide structure and thus the recognition.

The biotin tag does not impact recognition, as demonstrated with key peptides +/- biotin. We did not have all peptides synthesized +/- biotin.

3. For the CcsBA system the time necessary for in vitro cytochrome c biogenesis is 3 hours while the HCCs is 1 hour. Why the difference? Could the system be a missing factor? This could be addressed within the text.

The reviewer has made a point that may turn out interesting in the future. The synthesis over time for CcsBA (old Figure 3g, new Figure 6e) shows that after 1 hr, significant cyt c has heme attached. Although it takes another 2 hrs to reach maximum, the timeframe compared to HCCS is not indicative of a missing factor. More likely, it has to do with the different proteins themselves (CcsBA vs HCCS). For example, we could speculate that some of the heme attached in CcsBA may be coming from the internal TM-heme site that is transported into the P-heme site during the reaction. This will take significantly more investigation.

4. Statistical information is missing. While quantification on a number of experiments was performed, no statistical analysis is included. One example is in the results lines 285 to 286 and discussion lines 484 to 487, the release of cytochrome c, the 20mer and the 20mer SXXCH are discussed and data presented in Figures 2e and S4. While multiple experiments were performed no statistical analysis was provided. This should be added to understand the accuracy of these measurements and support for the conclusion.

The standard deviation has been added to new Figures 2c, 4c, and Figure 3—figure supplement 3. The text has also been changed to reflect these numbers and their standard deviations.

5. Based on the lack of release of peptides by HCCS it is concluded that the folding of the protein is necessary for optimal release. If helix 1 is formed and necessary for attachment, this suggests that some secondary structural elements are formed and that tertiary structure is necessary for release. As noted above investigation of the structural elements of the peptides would strengthen and this could be added to the text.

We considered a lengthy discussion on the features necessary for release—for example, it could be different secondary structures that “pull” the heme attached peptide out via specific interactions (eg the C-term alpha helix interacts with alpha helix 1 as a folding intermediate), or it could be the final folding into 3D, or even the Met81 ligand interaction in the folding pathway. We decided that these would be speculative, and this release step will require significantly more study for comment.

6. In the Results section there is no summary of the H and K mutants, it would be helpful to add one or two sentences as this is a significant part of the discussion and basis for the model presented in Figure 5.

We have moved the description of the H mutants to the Results section. We have chosen to leave the K mutants in the discussion as they specifically test the electrostatic hypothesis proposed in Figure 8. We felt that discussion of the K mutant prior to this would be a point of confusion for readers.

Associated Data

    This section collects any data citations, data availability statements, or supplementary materials included in this article.

    Supplementary Materials

    Figure 3—figure supplement 1—source data 1. ImageJ Pixel analysis of heme stained bands.
    Figure 3—figure supplement 3—source data 1. Summary of percent released substrate.
    Figure 7—figure supplement 1—source data 1. Image J Pixel analysis of heme-stained bands.
    Supplementary file 1. Relevant strains, plasmids, and primers.
    elife-64891-supp1.docx (19.8KB, docx)
    Supplementary file 2. Apo peptides used for in vitro assays.
    elife-64891-supp2.docx (14.3KB, docx)
    Transparent reporting form

    Data Availability Statement

    Data generated is provided in the manuscript. Source data files are provided for Figure 2C/Figure 4C/Figure 3—figure supplement 1C; Figure 3—figure supplement 1C; Figure 7—figure supplement 1C.


    Articles from eLife are provided here courtesy of eLife Sciences Publications, Ltd

    RESOURCES