Key resources table.
| Reagent type (species) or resource |
Designation | Source or reference | Identifiers | Additional information |
|---|---|---|---|---|
| Antibody | Mouse monoclonal anti-MBP | BioLegend | Cat# SMI-94R | |
| Antibody | Mouse monoclonal anti–β-Amyloid | BioLegend | Cat# SIG-39220 | |
| Antibody | Rabbit polyclonal anti-PLP | Abcam | Cat# ab105784 | |
| Antibody | Goat polyclonal anti-Iba1 | Abcam | Cat# ab107159 | |
| Antibody | Rabbit polyclonal anti-Hmgcs1 | Abcam | Cat# ab155787 | |
| Antibody | Rabbit polyclonal anti-Fdps | Abcam | Cat# ab153805 | |
| Antibody | Rabbit polyclonal anti-Lss | Abcam | Cat# ab80364 | |
| Antibody | Mouse monoclonal anti-RNA polymerase II CTD repeat YSPTSPS | Abcam | Cat# ab817 | |
| Antibody | Rabbit monoclonal anti-MAG | Cell Signal Technology | Cat# 9043 | |
| Antibody | Rabbit polyclonal anti-GFP | Cell Signal Technology | Cat# 2555 | |
| Antibody | Rabbit monoclonal anti-Pdgfrα | Cell Signal Technology | Cat# 3174 | |
| Antibody | Mouse monoclonal anti-Ki67 |
Cell Signal Technology | Cat# 9449 | |
| Antibody | Rabbit polyclonal anti-Aspa | Millipore | Cat# ABN1698 | |
| Antibody | Rabbit polyclonal anti-Olig2 | Millipore | Cat# AB9610 | |
| Antibody | Mouse monoclonal anti-NeuN | Millipore | Cat# MAB377 | |
| Antibody | Mouse monoclonal anti-Apc (CC-1) | Millipore | Cat# OP80 | |
| Antibody | Rabbit polyclonal anti-Gstpi | MBL International | Cat# 311 | |
| Antibody | Mouse monoclonal anti-Qki (Pan) | Sigma-Aldrich | Cat# SAB5201536 | |
| Antibody | Rabbit polyclonal anti-Hmgcs2 | Sigma-Aldrich | Cat# SAB2107997 | |
| Antibody | Rabbit polyclonal anti-Srebp2 | Sigma-Aldrich | Cat# HPA031962 | |
| Antibody | Mouse monoclonal anti–β-actin | Sigma-Aldrich | Cat# A5441 | |
| Antibody | Mouse monoclonal anti-Flag | Sigma-Aldrich | Cat# F1804 | |
| Antibody | Rabbit polyclonal anti-Hmgcr | Thermo Fisher Scientific | Cat# PA5-37367 | |
| Antibody | Rabbit polyclonal anti-Srebp2 | Cayman Chemical | Cat# 10007663 | |
| Antibody | Mouse monoclonal anti-Gfap | BD Biosciences | Cat# 556330 | |
| Antibody | Normal rabbit IgG | Santa Cruz Technology | Cat# sc-2027 | |
| Antibody | Rabbit polyclonal anti–Qki-5 | This paper | immunized with a short synthetic peptide (CGAVATKVRRHDMRVHPYQRIVTADRAATGN) | |
| Antibody | Mouse monoclonal anti-AnkG | Sigma-Aldrich | MABN466 | |
| Antibody | Rabbit polyclonal anti–Sox9 | Sigma-Aldrich | AB5535 | |
| Antibody | Rabbit polyclonal anti-Caspr |
Gift from Dr. Rasband lab | ||
| Antibody | Mouse monoclonal anti-PanNav |
Gift from Dr. Rasband lab | (K58/35) | |
| Chemical compound | Tamoxifen | Sigma-Aldrich | Cat# T5648 | |
| Chemical compound | 4-hydroxytamoxifen | Sigma-Aldrich | Cat# H7904 | |
| Chemical compound | Poly-L-ornithine | Sigma-Aldrich | Cat# P3655 | |
| Chemical compound | 3,3',5-Triiodo-L-thyronine | Sigma-Aldrich | Cat# T2877 | |
| Chemical compound | Anti-Flag M2 Magnetic Beads | Sigma-Aldrich | Cat# M8823 | |
| Chemical compound | Citrate buffer | Poly Scientific R&D Corp | Cat# s2506 | |
| Chemical compound | FluoroMyelin Red | Thermo Fisher Scientific | Cat# F34652 | |
| Chemical compound | Penicillin-Streptomycin | Thermo Fisher Scientific | Cat# 15140122 | |
| Recombinant protein | Laminin Mouse Protein, Natural | Thermo Fisher Scientific | Cat# 23017015 | |
| Chemical compound | Neurobasal Medium | Thermo Fisher Scientific | Cat# 21103049 | |
| Chemical compound | B-27 | Thermo Fisher Scientific | Cat# 17504044 | |
| Chemical compound | GlutaMAX Supplement | Thermo Fisher Scientific | Cat# 35050061 | |
| Chemical compound | Puromycin Dihydrochloride | Thermo Fisher Scientific | Cat# A1113802 | |
| Recombinant protein | Dynabeads Protein G | Thermo Fisher Scientific | Cat# 10004D | |
| Chemical compound | HardSet Antifade Mounting Medium with DAPI | Vector Laboratories | Cat# H1500 | |
| Chemical compound | NeuroCult Basal Medium | Stemcell Technologies | Cat# 05700 | |
| Chemical compound | NeuroCult Proliferation Supplement | Stemcell Technologies | Cat# 05701 | |
| Recombinant protein | Recombinant Human EGF | ProteinTech | Cat# AF-100-15 | |
| Recombinant protein | Recombinant Human FGF-basic (146 a.a.) | ProteinTech | Cat# 100-18C | |
| Chemical compound | DNase (RNase-free) | Qiagen | Cat# 79254 | |
| Chemical compound | cOmplete, Mini Protease Inhibitor Cocktail | Roche Diagnostics | Cat# 11836153001 | |
| Chemical compound | RNase A | Thermo Fisher Scientific | Cat# 12091021 | |
| Chemical compound | Proteinase K (PK) Solution | Promega | Cat# MC5005 | |
| Commercial assay |
Neural Tissue Dissociation Kit | Miltenyi Biotec | Cat# 130-092-628 | |
| Commercial assay |
In-Fusion HD Cloning Plus | Takara Bio | Cat# 638910 | |
| Commercial assay |
RNeasy Mini Kit | Qiagen | Cat# 74104 | |
| Commercial assay |
QIAquick PCR Purification Kit | Qiagen | Cat# 28104 | |
| Commercial assay |
SuperScript III First-Strand Synthesis SuperMix for qRT-PCR | Thermo Fisher Scientific | Cat# 11752250 | |
| Commercial assay |
SuperSignal West Pico PLUS Chemiluminescence System | Thermo Fisher Scientific | Cat# 34579 | |
| Commercial assay |
iTaq Universal SYBR Green Supermix | Bio-rad Laboratories | Cat# 1725122 | |
| Commercial assay |
DC Protein Assay Kit | Bio-rad Laboratories | Cat# 5000121 | |
| Commercial assay |
Total Cholesterol Assay Kits | Cell Biolabs | Cat# STA-390 | |
| Commercial assay |
KAPA Hyper Prep Kit | Kapa Biosystems | Cat# 004477 | |
| Commercial assay |
In Situ Cell Death Detection Kit |
Millipore Sigma |
11684795910 | |
| Deposited data | Gene expression profile | This paper | GEO: GSE145116 | |
| Deposited data | Gene expression profile | This paper | GEO: GSE145117 | |
| Deposited data | ChIP sequencing data | This paper | GEO: GSE144756 | |
| Deposited data | ChIP sequencing data | Zhou et al., 2020 | GEO: GSE126577 | |
| Experimental model | Mouse: B6.(Cg)-Nestin-CreERT2 | Imayoshi et al., 2008 | N/A | |
| Experimental model | Mouse: B6.(Cg)-Plp1-CreERT2 | The Jackson Laboratory | Stock No.: 005975 | |
| Experimental model | Mouse: B6.129-Rosa26-CreERT2 | The Jackson Laboratory | Stock No.: 008463 | |
| Experimental model | Mouse: B6.129(Cg)-ROSAmT/mG | The Jackson Laboratory | Stock No.: 007676 | |
| Experimental model | Mouse: B6.(Cg)-Qk-loxP | Shingu et al., 2017 | N/A | |
| Recombinant DNA reagent |
pLKO-puro Flag-Srebp2 | Addgene | Cat# 32018 | |
| Recombinant DNA reagent |
pLKO-puro 3X Flag-Srebp2 | This paper | N/A | |
| Software and algorithm |
ImageJ | National Institutes of Health | https://imagej.nih.gov/ij/ | |
| Software and algorithm |
HISAT2 | Johns Hopkins University | https://ccb.jhu.edu/software/hisat2/index.shtml | |
| Software and algorithm |
StringTie | Johns Hopkins University | https://ccb.jhu.edu/software/stringtie/ | |
| Software and algorithm |
DESeq2 | Bioconductor | http://bioconductor.org/packages/DESeq2/ | |
| Software and algorithm |
IPA | Qiagen | https://www.qiagenbioinformatics.com/products/ingenuity-pathway-analysis/ | |
| Software and algorithm |
Trim Galore | Babraham Institute | http://www.bioinformatics.babraham.ac.uk/projects/trim_galore/ | |
| Software and algorithm |
Bowtie | Johns Hopkins University | http://bowtie-bio.sourceforge.net/tutorial.shtml | |
| Software and algorithm |
SAMtools | Li et al., 2009 | https://github.com/samtools/samtools | |
| Software and algorithm |
MACS2 | Feng et al., 2012 | https://github.com/taoliu/MACS/ | |
| Software and algorithm |
deeptools | Ramírez et al., 2016 | https://github.com/deeptools/deepTools | |
| Software and algorithm |
ngsplot | Shen et al., 2014 | https://github.com/shenlab-sinai/ngsplot | |
| Software and algorithm |
Prism 8 | GraphPad Software | https://www.graphpad.com/scientific-software/prism/ | |
| Software and algorithm |
HOMER | UCSD | http://homer.ucsd.edu/homer |