Table 3.

Cell-Penetrating Peptides modified nanoparticles for CNS diseases

CPPs-nanoparticles	CPPs	CPPs Sequence	Ligand	Nanoparticles	Cargos	Cell model	Animal model	Therapeutic use	Refs.
TGN-NP	TGN	TGNYKALHPHNG	–	PEG-PLGA nanoparticles	–	bEnd.3	Nude mice, ICR mice	Glioma	[182]
AsTNP	TGN	TGNYKALHPHNG	AS1411	PEG-PCL nanoparticles	Docetaxel	C6, bEnd.3	C6 bearing mice	Glioma	[141]
Tf-PFV-Lip	PFV	PFVYLI	Tf	Liposomes	Doxorubicin, Erlotinib	In vitro BBB model, 3D tumor model	–	Glioma	[183]
ILNPs	IL-13p	TAMRAVDKLLLHLKKLFREGQFNRNFESIIICRDRT	–	Liposomes	Docetaxel	U87, HUVEC, 3D tumor model	U87 bearing mice	Glioma	[140]
cFd-Lip	dNP2	KIKKVKKKGRKKIKKVKKKGRK-cys	Folic acid (FA)	Liposomes	Paclitaxel	4T1, NIH 3T3, bEnd.3, 3D tumor model	Breast tumor bearing mice, breast cancer brain metastasis models	Breast cancer and brain metastasis	[184]
cFd-Lip	dNP2	KIKKVKKKGRKKIKKVKKKGRK-cys	FA	Liposomes	Paclitaxel	bEnd.3, C6	C6 bearing mice	Glioma	[185]
MT1-NP	MT1-AF7p	HWKHLHNTKTFLC	iRGD	PEG-PLA nanoparticles	Paclitaxel	C6	C6 bearing mice	Glioma	[186]
CNP, ANP	CPP, ACPP	CRRRRRRRRR, EEEEEEEEC6GSGRSAGRRRRRRRRC6C	–	Nanoparticles	Paclitaxel	C6	C6 bearing mice	Glioma	[187]
DGL-PEG-LNP	NoLS	KKRTLRKNDRKKRC	–	Nanoparticles	Plasmid DNA encoding inhibitor of growth 4 (ING4)	BCEC	U87 bearing mice	Glioma	[33]
RGE-LS	RGERPPR	RGERPPR	–	Liposomes	Doxorubicin	U87	U87 bearing mice,	Glioma	[188]
TBCNT@OXA	TAT	YGRKKRRQRRR	–	Carbon nanotube	Oxaliplatin	HBMEC, C6	C6 bearing mice	Glioma	[189]
TR-Lip	TR	c(RGDfK)- AGYLLGHINLHHLAHL(Aib)HHIL-Cys	–	Liposomes	Paclitaxel	C6, bEnd.3, CSCs	C6 bearing mice	Glioma	[190]
RGE-PEG / PGG-PTX NPs	RGERPPR	RGERPPR	–	Nanoparticles	polymer-drug conjugates (PGG-PTX)	U87, HUVECs	U87 bearing mice	Glioma	[191]
pSiNPs	SIWV	SIWV	–	Nanoparticles	SN-38	U87	U87 bearing mice	Glioma	[192]
Tf-Pen lip	Pen	RQIKIWFQNRRMKWKK	Tf	Liposomes	Doxorubicin, Erlotinib	U87, bEnd.3	U87 bearing mice	Glioma	[193]
Tf-Pen lip	Pen	RQIKIWFQNRRMKWKK	Tf	Liposomes	5-Fluorouracil	U87, bEnd.3	U87 bearing mice	Glioma	[194]
iNGR-SSL	iNGR	CC(Acm)RNGRGPDC(Acm)	–	Liposomes	Doxorubicin	U87, HUVECs	U87 bearing mice	Glioma	[195]
P1NS/TNC-FeLP	P1NS	Cys-GRKKRRQRRRPQ	TN-C	Thermosensitive liposomal	Doxorubicin	bEnd.3, CRL-2299, C8-D1A, CRL-2541, U87, HTB-14	-	Glioma	[196]
TF-CPP-SSL	CPP	GGRRRRRRRRR-amide	Tf	Liposome	Doxorubicin	C6, HUVECs	C6 bearing mice	Glioma	[197]