Skip to main content
. 2021 Sep 3;17(9):e1009909. doi: 10.1371/journal.ppat.1009909

Table 1. Sequences and MICs (μM) for the peptides and azithromycin used in this work.

Peptides MICa/MICac (μM) MICb/MICbc (μM) FICI Sequence Source
Api1b 128/128 >32/8 1.125 GNNRPVYIPQPRPPHPRL [18]
Oncocin 128/128 >32/8 1.125 VDKPPYLPRPRPPRRIYNR [25]
Pyrrhocoricin 128/128 >32/8 1.125 VDKGSYLPRPTPPRPIYNRN-NH2 [26]
EC5 128/8 >32/8 0.188 RLLFRKIRRLKR [15]
D-EC5 128/128 >32/8 1.125 rllfrkirrlkr This study
Bac8c 128/128 4/1 1.250 RIWVIWRR-NH2 [16]
RW-BP100 128/128 8/2 1.250 RRLFRRILRWL-NH2 [17]
D-RW-BP100 128/128 8/2 1.250 rrlfrrilrwl-NH2 This study
D-RW-BP100R 128/128 4/1 1.250 lwrlirrflrr-NH2 This study
LL-37 128/64 8/2 0.75 [LL-37, 37 aa] [27]
KR-12-a2 128/8 32/4 0.188 KRIVQRIKKWLR-NH2 [13]
L-11 128/4 32/4 0.156 RIVQRIKKWLR-NH2 [14]
D-11 128/4 32/4 0.156 rivqrikkwlr-NH2 [14]
D-11R 128/4 32/4 0.156 rlwkkirqvirk-NH2 [14]
L-11-R5W 128/128 4/1 1.250 RIVQWIKKWLR-NH2 This study
D-11-k(r) 128/4 32/4 0.156 rivqrirrwlr-NH2 This study
PEP9 128/128 >32/8 1.125 NGVQPKYK [28]
PEP10 128/128 >32/8 1.125 KIAKVALKALK [29]
ADP-1 128/128 16/4 1.125 GIGKHVGKALKGLKGLLKGLGEC [30]
ADP-1a 128/128 >32/8 1.125 LKGLKGLLKGLGEC This study
ADP-1b 128/128 >32/8 1.125 KHVGKALKGLK This study
ADP-1c 128/128 >32/8 1.125 LKGLKGLLKGL This study

MICa: the MIC of azithromycin, MICb: the MIC of the peptide, MICac: the MIC of azithromycin in the combination, MICbc: the MIC of the peptide in the combination, the synergy effects were bolded in FICI. Peptides with capital letters mean they are synthesized with L-type amino acids, peptides with lowercase letters mean they are synthesized with D-type amino acids, red marks mean amino acid changes. D-11 and its variants were derived from the sequence that was bolded in LL-37 peptide.