Table 3.
Tryptic + GluC peptide ions detected for spike protein from lab grown specimen, their sequences and location
|
m/z
(mono.) experimental |
m/z
(mono.) theoretical |
Difference (ppm) | Residuesa | Sequence | Domainb |
|---|---|---|---|---|---|
| 846.4690 | 846.4680 | + 1.2 | 1020–1028 | ASANLAATK | S2 undefined |
| 1045.4650 | 1045.4659 | − 0.9 | 390–398 | LCFTNVYAD | S1 subunit receptor-binding domain (RBD) |
| 1139.6001 | 1139.5996 | + 0.4 | 559–567 | FLPFQQFGR | S1 undefined |
| 1206.6671 | 1206.6663 | + 0.7 | 517–528 | LLHAPATVCGPK | S1 subunit receptor-binding domain (RBD)—partial |
| 1234.5052 | 1234.5045 | + 0.6 | 159–169 | VYSSANNCTFE | S1 subunit N-terminal domain (NTD) |
| 1290.6985 | 1290.6974 | + 0.7 | 726–737 (1) | ILPVSMTKTSVD | S2 undefined |
| 1495.7545 | 1495.7540 | + 0.3 | 22–34 | TQLPPAYTNSFTR | S1 subunit N-terminal domain (NTD) |
| 1576.7071 | 1576.7060 | + 0.7 | 647–661 | AGCLIGAEHVNNSYE | S1 subunit C-terminal domain (CTD) |
| 1727.8529 | 1727.8520 | + 0.5 | 686–702 | SVASQSIIAYTMSLGAE | S2 subunit N-terminus at furin cleavage site |
| 1743.8478 | 1743.8469 | + 0.5 | 686–702 (+O) | SVASQSIIAYTMSLGAE | S2 subunit N-terminus at furin cleavage site |
| 1801.9139 | 1801.9133 | + 0.3 | 341–355 (1) | VFNATRFASVYAWNR | S1 subunit receptor-binding domain (RBD) |
| 1976.9871 | 1976.9858 | + 0.7 | 664–682 | IPIGAGICASYQTQTNSPR | S1 subunit C-terminus at furin cleavage site |
| 2396.3092 | 2396.3080 | + 0.5 | 1–21 (+O) | MFVFLVLLPLVSSQCVNLTTR | S1 subunit N-terminal domain (NTD) |
| 2443.1995 | 2443.1987 | + 0.3 | 703–725 | NSVAYSNNSIAIPTNFTISVTTE | Undefined |
| 3044.6021 | 3044.6011 | + 0.3 | 951–979 (1) | VVNQNAQALNTLVKQLSSNFGAISSVLND | HR1 domain—partial |
| 3209.6026 | 3209.6035 | − 0.3 | 584–614 (1) | ILDITPCSFGGVSVITPGTNTSNQVAVLYQD | S1 subunit receptor-binding domain (RBD)—partial |
| 3328.6968 | 3328.6981 | − 0.4 | 703–733 (+O) (1) | NSVAYSNNSIAIPTNFTISVTTEILPVSMTK | Undefined |
aBased on NCBI protein sequence QHD43416.1 where residues denoted (+O) are associated with an oxidized methionine residues and those with a (1) containing one missed cleavage site; all others contain no missed cleavage sites. Bolded entries represent regions that allow variants to be distinguished as identified in Table 2
bAs defined in UniPro knowledge base (uniprokb) at https://covid-19.uniprot.org/uniprotkb/ and ref. Acta Pharmacologica Sinica