| REAGENT or RESOURCE | SOURCE | IDENTIFIER |
|---|---|---|
| Antibodies | ||
| Rabbit anti-mouse influenza B HA | Sino Biological Inc. | 11053-RP01 |
| HRP-conjugated anti-mouse IgG1, IgG2a, IgG2b | Jackson Immunoresearch Laboratories | 115-035-205, 115-035-206, 115-035-207 |
| HRP-conjugated anti-mouse IgG | Cytiva Lifescience | NA9311ML |
| anti-mouse IgA | Life Technologies | LS626720 |
| Tetramethylbenzidine (TMB) substrate | Cell Signaling Technology | 7004 |
| Rabbit polyclonal anti-influenza B NP | Genetex | GTX128538 |
| HRP-conjugated anti-rabbit IgG antibody | Cytiva | NA9341ML |
| Fixable Viability Dye eFluor 506 | eBioscience | 65-0866-14 |
| anti-mouse CD16/CD32 | eBioscience | 16-0161-86 |
| AF647-conjugated anti-mouse Ly77/GL7 (clone GL7) | BD Biosciences | 561529 |
| PE-Cy7-conjugated anti-mouse CD45R/B220 (clone RA3-6B2) | BD Biosciences | 552772 |
| Bacterial and virus strains | ||
| B/Victoria/2/87, | Icahn School of Medicine at Mount Sinai (Ermler et al., 2017 | N/A |
| B/Yamagata/16/88 | Icahn School of Medicine at Mount Sinai (Ermler et al., 2017 | N/A |
| B/Brisbane/60/08 | Icahn School of Medicine at Mount Sinai (Ermler et al., 2017 | N/A |
| mouse-adapted B/Florida/4/06 | Icahn School of Medicine at Mount Sinai (Ermler et al., 2017 | N/A |
| Biological samples | ||
| Tissue samples from DBA/2J mice used in this study; the animals were purchased from Jackson lab | This study | N/A |
| Chemicals, peptides, and recombinant proteins | ||
| FFGAIAGFL | New England Peptides | P1 |
| YYSTAASSL | New England Peptides | P2 |
| DRICTGITSSNSPHVVKTATQGEVNVTGVIPLTTTP TKSYFANLKGTRTRGKLC |
New England Peptides | HA1 linker (N-term |
| EADCLHEKYGGLNKSKPYYTGEHAKAIGNCPIWVK TPLKLANGTKYRPPAKLLKER |
New England Peptides | HA1 linker (C-term |
| B/Florida/4/06 HA2 protein | Sinobiologcals | Cat: 11053-V01H2 |
| Critical commercial assays | ||
| Promega ADCC Reporter Bioassay | Promega | M1212 |
| Bio-GloTM luciferase assay | Promega | G7941 |
| Adeno-X Rapid Titer Kit | Takara Bio USA Inc | 632250 |
| Gateway®-adapted ViraPowerTM adenoviral expression system | Life Technologies | V49320 |
| ProcartaPlex Multiplex Immunoassay kit | Life Technologies | EPX170-26087-901 |
| Deposited data | ||
| Division of Regulatory Research (CG-IBV data) | Health Canada, Ottawa, Canada | N/A |
| Experimental models: Cell lines | ||
| FcγRIV effector cell | Promega | M1212 |
| MDCK | ATCC | CCL-34 |
| HeLa | ATCC | CCL-2 |
| HEK293A | Qbiogene | AES2044 |
| Experimental models: Organisms/strains | ||
| DBA/2J mice | (The Jackson Laboratory) | 000671 |
| Recombinant DNA | ||
| pBluescript II SK+ vector | Bio Basic Canada Inc. | N/A |
| pENTRTM/SD/D-TOPO vector | Life Technologies | K242020 |
| pAd/CMV/V5-DEST vector | Life Technologies | V493-20 |
| Software and algorithms | ||
| Geneious Prime | Geneious. | Geneious Prime |
| GraphPad Prism 8 | GraphPad Software Inc. | GraphPad Prism 8 |
| BD FACSDIVA 6.2 | BD Biosciences | BD FACSDIVA 6.2 |
| MILLIPLEX Analyst version 5.1 | Merck Millipore | MILLIPLEX Analyst version 5.1 |
| Original Code for Bioinformatics Analysis | Zenodo | https://doi.org/10.5281/zenodo.5573271 (https://zenodo.org/record/5573271) |