Table 10. List of SARS-CoV-2 proteins that were predicted as common and overlapping B- and T- cell epitopes.

SARS-CoV-2 protein	Name of epitope	Predicted epitope of SARS-CoV-2	Length	Antigenicity by VexiJen (T = 0.4)	Allergeicity by AllerTope v. 2.0	Agadir Score	Conservancy analysis by IEDB tool		Experimentally verified epitopes / ViPR reference
							SARS-CoV-2	SARS-CoV
Spike (S)	Linear and conformational B-cell epitopes	1253-CCKFDEDDSEPVLKGVKLHYT-1273	21	Antigen (0.9101)	Non-allergen	0.26	94.86% (166/175)	83.74% (273/326)	(IEDB-ID: 6476) [59]
	Linear B-cell epitopes and MHC I	403-RGDEVRQIAPGQTGKIADYNYKLPD-427	25	Antigen (1.0356)	Non-allergen	0.45	100.00% (175/175)	0.00% (0/326)	-
		437-NSNNLDSKVGGNYNYLYRLFRKSNL-461	25	Antigen (0.4015)	Non-allergen	4.42	100.00% (175/175)	0.00% (0/326)	(MHC I, IEDB-ID: 1074979) [59]
Nucleocapsid (N)	Linear and conformational B-cell epitopes and MHC I	366-TEPKKDKKKKADETQALPQRQKKQQTVTL-394	29	Antigen (0.5248)	Non-allergen	0.63	100.00% (185/185)	0.00% (0/301)	-
	Linear B-cell epitopes and MHC I	173-AEGSRGGSQASSRSSSRS-190	18	Antigen (0.8081)	Non-allergen	0.21	99.46% (184/185)	79.73% (240/301)	(B-cell, IEDB-ID: 22481) [59]
		227-LNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATK-266	40	Antigen (0.5387)	Non-allergen	1.9	100.00% (185/185)	0.00% (0/301)	(B-cell, IEDB-ID: 31692) [59]
Membrane (M)	Linear and conformational B-cell epitopes and MHC I	160-DIKDLPKEITVATSRTLSYYKLG-182	23	Antigen (0.7442)	Non-allergen	0.31	98.24% (167/170)	79.48% (213/268)	(B-cell, IEDB-ID: 48052) [59]
Envelope (E)	Linear and conformational B-cell epitopes	57-YVYSRVKNLNSSRVPDLL-75	19	Antigen (0.565)	Non-allergen	0.2	100.00% (177/177)	0.00% (0/245)	-