Table 1. Peptides Used in This Study, Their Sequences, Net Charge, and RP-HPLC Retention Times.
| peptide designation | sequencea | net charge | relative hydrophobicityb (% ACN) | retention time (min.) |
|---|---|---|---|---|
| LL-37 | [LL-37, 37 aa] | +7 | 78.2 | 34.1 |
| all l-K6L9 | LKLLKKLLKKLLKLL | +7 | 77.6 | 33.8 |
| d,l-K6L9 | LKLLKKLLKKLLKLL | +7 | 65.4 | 27.7 |
| d,l-K5L7 | KKLLKLLLKLLK | +6 | 57 | 23.5 |
| C8-d,l-K5L7 | CH3(CH2)6CO-KKLLKLLLKLLK | +5 | 68.2 | 29.1 |
| Temporin L | FVQWFSKFLGRIL | +3 | 74.6 | 32.3 |
| d,l-H6L9 | LHLLHHLLHHLLHLL | +1 | 68.6 | 29.3 |
All of the peptides are amidated at their C-termini. Underlined and bold font amino acids are d-enantiomers.
Relative hydrophobicity is reflected by the percent of acetonitrile at the retention time.