Table 2.
Normalized intensities of the core fucosylated glycoforms in healthy controls and in patients with cirrhosis of the liver of alcoholic (ALD), hepatitis B viral (HBV), hepatitis C viral (HCV), and non-alcoholi steatohepatitis (NASH) etiologies for glycopeptides with ratio of the glycoforms increased more than threefold in at least two categories of the cirrhotic liver disease compared to the healthy controls. FAn/An: ratio of the fucosylated glycopeptide to the nonfucosylated glycopeptide, n = number of anntenas. FDR represents the false discovery rate.
| Peptide | Accesion Number | Glycan ratio | Healthy | ALD | HBV | HCV | NASH | p-value | FDR |
|---|---|---|---|---|---|---|---|---|---|
| ELHHLQEQNVSNAFLDK | P00450 | FA2/A2 | 0.738 | 3.52 | 2.456 | 2.526 | 2.479 | 0.026 | 0.034 |
| ELHHLQEQNVSNAFLDK | P00450 | FA3/A3 | 19.325 | 95.319 | 79.132 | 52.152 | 50.825 | 0.002 | 0.010 |
| ELHHLQEQNVSNAFLDK | P00450 | FA4/A4 | 33.133 | 152.706 | 190.84 | 106.261 | 101.359 | 0.003 | 0.010 |
| LANLTQGEDQYYLR | P01042 | FA2/A2 | 5.022 | 21.101 | 14.544 | 15.818 | 14.005 | 0.006 | 0.012 |
| LANLTQGEDQYYLR | P01042 | FA4/A4 | 4.428 | 21.234 | 12.066 | 8.596 | 8.51 | 0.004 | 0.01 |
| LGNWSAMPSCK | P02751 | FA4/A4 | 26.469 | 118.536 | 259.891 | 40.991 | 37.053 | 0.022 | 0.03 |
| LDAPTNLQFVNETDSTVLVR | P02751 | FA2/A2 | 9.33 | 29 | 38.24 | 28.22 | 35.39 | 0.031 | 0.039 |
| LGNWSAMPSCK | P02751 | FA3/A3 | 13.522 | 93.666 | 19.97 | 31.225 | 33.208 | 0.007 | 0.013 |
| LPTQNITFQTESSVAEQEAEFQSPK | Q14624 | FA4/A4 | 35.121 | 155.44 | 395.277 | 107.626 | 72.535 | 0.002 | 0.01 |
| QVFPGLNYCTSGAYSNASSTDSASYYPLTGD | P04114 | FA2/A2 | 0.749 | 6.845 | 3.681 | 5.007 | 4.264 | 0.015 | 0.023 |
| VDKDLQSLEDILHQVEnK | P02671 | FA2/A2 | 21.869 | 66.857 | 44.836 | 81.947 | 67.083 | 0.007 | 0.013 |