TABLE 1.

Minimum inhibitory concentrations (MIC) in µM. Data are for n = 3 with modal values reported; all values determined in Mueller-Hinton broth (MHb) using 5 × 10⁵CFU/ml bacteria; MRSA = methicillin-resistant Staphylococcus aureus, HC50 represents the peptide concentration needed to induce haemolysis in human red blood cells at 50%. * means that all peptides are C-terminal amidated. PA stands for P. aeruginosa, n.a. for not applicable. The therapeutic window is given for MRSA only, as an example for their potential as a drug development candidate.

Name	Description	Sequence*	MRSA	E. coli	PA	HC50	Therapeutic window HC50/MIC(MRSA)
optP1	Optimized 9mer	KIILRIRWR	1.5	1	6	205	137
optP7	Optimized 9mer	KRRVRWIIW	6	1.5	3	>195	>32.5
consP1	Consensus sequence derived from multiple alignment	VRKPPYLPRPRPRPL	>139	35	>139	>139	n.a
hyP1CoG1	Hybrid peptide with Gly linker, optP1 C-terminal	KIILRIRWRGGGVRKPPYLPRPRPRPL	2.5	1	1	>157	>62.8
hyP1CoG2	Hybrid peptide with Gly linker, optP1 C-terminal	VRKPPYLPRPRPRPLGGGKIILRIRWR	2.5	1	2.5	>157	>62.8
hyP7CoG1	Hybrid peptide with Gly linker, optP7 C-terminal	VRKPPYLPRPRPRPLGGGKRRVRWIIW	5	1	5	>154	>30.8
hyP7CoG2	Hybrid peptide with Gly linker, optP7 N-terminal	KRRVRWIIWGGGVRKPPYLPRPRPRPL	5	2.5	2.5	>154	>30.8
Bac5-v291	Optimized Bac5(1–17) variant 291	RWRRPIRRRPIRPPFWR	27	1.7	27	>278	>10.3
hyP7B5G	Hybrid peptide with Gly linker, optP7 C-terminal	RWRRPIRRRPIRPPFWRGGGKRRVRWIIW	2	2	2	102	51
hyP7B5K	Hybrid peptide with Lys linker, optP7 C-terminal	RWRRPIRRRPIRPPFWRKKKKRRVRWIIW	2	2	2	82	41
hyP7B5GK	Hybrid peptide with Gly-Lys linker, optP7 C-terminal	RWRRPIRRRPIRPPFWRKGKGKGKRRVRWIIW	1	1	2	>120	>120
hyP7B5Cys	Hybrid peptide with disulfide bridge, designed to be cleaved in the cytosol, optP7 C-terminal	RWRRPIRRRPIRPPFWRKGKC-S-S-CKGKRRVRWIIW	1	0.6	2	102	>102