TABLE 2.

Minimum inhibitory concentrations (MIC) in µM. Data are for n = 3 with modal values reported; all values determined in Mueller-Hinton broth (MHb) using 1 × 10⁸CFU/ml bacteria; * All peptides are C-terminal amidated.

Name	Description	Sequence*	E. coli
optP7	Optimized 9mer	KRRVRWIIW	14
Bac5-v291	Optimized Bac5(1–17) variant 291	RWRRPIRRRPIRPPFWR	1.1
hyP7B5GK	Hybrid peptide with Gly-Lys linker, optP7 C-terminal	RWRRPIRRRPIRPPFWRKGKGKGKRRVRWIIW	4
hyP7B5Cys	Hybrid peptide with disulfide bridge, designed to be cleaved in the cytosol, optP7 C-terminal	RWRRPIRRRPIRPPFWRKGKC-S-S-CKGKRRVRWIIW	4