Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
(a) 3D structure visualization of one synthetic long peptide, PINLVRDLPQGFSALLLSVGGWTAGAAAYY, using PyMol; (b) Ramachandran plot for the corresponding SLP. The dots representing the amino acids are mainly located in the most favorable regions (red) or the additional allowed regions (yellow). Most amino acids are located in the beta-sheet and alpha-helix regions.
