Skip to main content
Vaccines logoLink to Vaccines
. 2022 Feb 28;10(3):378. doi: 10.3390/vaccines10030378

Design of a Multi-Epitopes Vaccine against Hantaviruses: An Immunoinformatics and Molecular Modelling Approach

Saba Ismail 1,, Sumra Wajid Abbasi 2,, Maha Yousaf 3, Sajjad Ahmad 4, Khalid Muhammad 5,*, Yasir Waheed 1,*
Editors: Rossella Cianci, Laura Franza
PMCID: PMC8953224  PMID: 35335010

Abstract

Hantaviruses are negative-sense, enveloped, single-stranded RNA viruses of the family Hantaviridae. In recent years, rodent-borne hantaviruses have emerged as novel zoonotic viruses posing a substantial health issue and socioeconomic burden. In the current research, a reverse vaccinology approach was applied to design a multi-epitope-based vaccine against hantavirus. A set of 340 experimentally reported epitopes were retrieved from Virus Pathogen Database and Analysis Resource (ViPR) and subjected to different analyses such as antigenicity, allergenicity, solubility, IFN gamma, toxicity, and virulent checks. Finally, 10 epitopes which cleared all the filters used were linked with each other through specific GPGPG linkers to construct a multi-antigenic epitope vaccine. The designed vaccine was then joined to three different adjuvants—TLR4-agonist adjuvant, β-defensin, and 50S ribosomal protein L7/L12—using an EAAAK linker to boost up immune-stimulating responses and check the potency of vaccine with each adjuvant. The designed vaccine structures were modelled and subjected to error refinement and disulphide engineering to enhance their stability. To understand the vaccine binding affinity with immune cell receptors, molecular docking was performed between the designed vaccines and TLR4; the docked complex with a low level of global energy was then subjected to molecular dynamics simulations to validate the docking results and dynamic behaviour. The docking binding energy of vaccines with TLR4 is −29.63 kcal/mol (TLR4-agonist), −3.41 kcal/mol (β-defensin), and −11.03 kcal/mol (50S ribosomal protein L7/L12). The systems dynamics revealed all three systems to be highly stable with a root-mean-square deviation (RMSD) value within 3 Å. To test docking predictions and determine dominant interaction energies, binding free energies of vaccine(s)–TLR4 complexes were calculated. The net binding energy of the systems was as follows: TLR4-agonist vaccine with TLR4 (MM–GBSA, −1628.47 kcal/mol and MM–PBSA, −37.75 kcal/mol); 50S ribosomal protein L7/L12 vaccine with TLR4 complex (MM–GBSA, −194.62 kcal/mol and MM–PBSA, −150.67 kcal/mol); β-defensin vaccine with TLR4 complex (MM–GBSA, −9.80 kcal/mol and MM–PBSA, −42.34 kcal/mol). Finally, these findings may aid experimental vaccinologists in developing a very potent hantavirus vaccine.

Keywords: hantaviruses, ViPR database, multi-epitope database, molecular dynamics simulations, binding free energies

1. Introduction

The emergence and rise in the spread of RNA viruses in recent years have posed major threats to human life [1]. Hantaviruses are negative-sense, enveloped, single-stranded RNA viruses, hosted by small mammals such as rodents, shrews, bats, and moles [2]. They are responsible for the occurrence of a zoonotic disease named hantavirus cardiopulmonary syndrome (HCS) in America and haemorrhagic fever with renal syndrome (HFSR) in Europe. Hantaviruses infect 150,000 to 200,000 humans annually, with a case fatality rate of 0.1% to 50% based on the species with a relatively higher prevalence in Asia [3,4,5,6]. In addition to Asia, around 3000 HFRS cases are identified each year in Europe [6]. HFRS instances have also been documented in Singapore, Vietnam, Thailand, Sri Lanka, and India, as well as in Sweden, Finland, Germany, France, Switzerland, the Balkans, the Czech Republic, Poland, Greece, Lithuania, Estonia, Slovenia, Turkey, and the United Kingdom [6].

Structurally, hantaviruses are encapsulated with multiple copies of nucleoproteins and the viral RNA is composed of three segments: The largest segment is RNA polymerase, the middle size segment encodes for glycoproteins such as glycoproteins Gn, glycoproteins Gc, and the small segment produces a nucleocapsid protein [7]. Generally, hantaviruses are classified into three different classes based on their associated reservoir host. The first class is of old world viruses such as Seoul virus (SEOV), Hantaan virus (HNTV), and Dobrava–Belgrade virus (DOBV) responsible for HFRS. These are hosted by Murinae rodents predominantly found in Europe and Asia. The second class is of New World viruses such as New York-1 virus (NY-1V), Sin Nombre virus (SNV), and Andes virus (ANDV), causing hantavirus pulmonary syndrome (HPS). These viruses are transmitted via Sigmondontinae subfamily members mostly found in the US. The third class comprises both Old and New World hantaviruses such as Prospect Hill Virus (PHV), Puumala virus (PUUV), and Tula virus (TULV) harboured by Arvicolinae rodents [8]. Extensive bioinformatics and phylogenetic analysis have revealed that the progression of hantaviruses from bats, shrews, and moles to rodents is a consequence of the coevolution of viruses and host and geographic divergence [9,10,11]. Such coevolution of viruses in rodents is responsible for the emergence of virulent hantaviruses capable of infecting humans [12].

Hantavirus disease is transmitted by infected urine, faeces, and saliva, as well as by biting and aerosolised filth breathed by healthy rats [13,14]. The human kidney and lungs are considered to be the primary targets of HFRS-associated and HCPS-associated viruses, respectively [6]. Males have a threefold higher rate of infection than females [6]. Symptoms of hantavirus disease include muscle pain, high fever, gastrointestinal (GI) symptoms, and vascular leakage [15]. Hantaviruses typically infect vascular endothelial cells in humans, so they malfunction in capillaries and other vessels [16]. As a result, the core pathophysiology of hantavirus-associated illnesses is a substantial increase in vascular permeability [16]. Replication of hantavirus occurs in the vascular endothelium and macrophages specifically present in the kidney and lungs [17]. Virulent hantaviruses infect host cells by adhering to the αγβ3 integrin proteins present on the cell membrane, ultimately leading to phagocytosis [18].

The immune system plays a crucial role in the pathogenesis of hantavirus disease [6], as well as in the fight against cancers and viral infections [19]. Immunotherapy is a potent and effective technique for the prevention of infectious illnesses nowadays [20]. Multi-epitope vaccination has recently been discovered to be an incredible strategy for the prevention and treatment of cancers and viral infections [21,22,23,24,25]. An optimal multi-epitope vaccine construct should have a sequence of overlapping epitopes, with each antigenic peptide fragment eliciting either a cellular or a humoral immune response against the tumour or virus of interest [19]. Thus far, many therapeutics and vaccines against hantaviruses have been developed; these include virus-like particle (VLP)-based vaccines, recombinant proteins, virus-vectored recombinant vaccines, and nucleic acid-based molecular vaccines [3]. Hantavax is a commercialised, formalin-inactivated vaccine for HFRS, prepared against HTNV growth inside the brains of mice [3,26]. Initially, Hantavax was found to elicit a strong immune response; however, it was failed to establish a statistically significant decrease in HFRS disease intensity [27]. Similarly, CD40 ligand (CD40L) and granulocyte-macrophage colony-stimulating factor (GM-CSF) Hantaan VLPs were developed in 2019 and found to boost long-term immunity against HTNV infection substantially [28]. However, a lack of evaluation of vaccine protective efficacy meant these VLPs did not progress into clinical trials [3]. Like the above-mentioned vaccines, many Recombinant N proteins such as PUUV N, ANDV N, DOBV N [29], virus-vectored recombinant vaccines such as VACV-vectored HTNV [30], Ad-vectored ANDV [31], VSV-vectored ANDV [32], and nucleic acid-based molecular vaccines, i.e., HTNV DNA [33], PUUV DNA [33], pVAX-LAMP/Gn, and pVAX-LAMP/Gc [34] have been developed so far by experimental vaccinologists, but no vaccine or drug has yet been approved by the FDA [17].

The research performed in this study used applications of reverse vaccinology (RV), in combination with biophysical approaches, to construct a multi-epitope vaccine and decipher its binding potential with host immune system components, as well as evaluate its potential in providing immune protection against hantaviruses. To the best of our knowledge, no such previous effort is reported where experimental immune protective epitopes are used in a computational vaccine pipeline. This study is novel, as the focus was more on experimentally proved immune protective epitopes rather than using predicted epitopes from the virus proteins. The study is also helpful in overcoming the limited antigenicity and immunogenicity of the epitopes by modeling them into a multi-epitope peptide vaccine, in which only epitopes were selected that broadly cover all successful parameters of epitope-based vaccines (Figure 1).

Figure 1.

Figure 1

The schematic representation of steps followed throughout the study.

2. Materials and Methods

2.1. Target Epitopes Retrieval

The study started with the retrieval of experimentally determined epitopes of hantaviruses from the ViPR [35]. The Allergenicity of peptides was evaluated using the AllerTOP2.0 web tool (Department of Pharmacy, Medical University of Sofia, Sofia, Bulgaria) [36]. Non-allergen peptides were selected, and a web-server VaxiJen 2.0 [37] was used, with a threshold greater than 0.4, to reveal the antigenicity of the selected epitopes. The ToxinPred [38] tool was then used to check the toxicity. Similarly, Virulentpred [39] was used to check the virulence potential of the selected nonallergen and nontoxic peptides [39]. To examine the solubility of the peptides, the Innovagen webserver (http://www.innovagen.com/proteomics-tools (14 December 2020)) was adopted. Using an IFN epitope server, epitopes were then tested for their capacity to produce IFN-γ. Peptides showing positive IFN-γ inducer were selected and further screened for exposed peptides via TMHMM 2.0 [40]. Peptides located on the outer side of the cell membrane were considered for further scrutinisation [40].

2.2. Chimeric Vaccine Designing

Peptide vaccines usually are weak immunogens, which can be enhanced by fusing multiple immunodominant epitopes to create a multi-epitope peptide vaccine [41]. These multi-epitope vaccines are considered a promising preventing option for bacterial and viral infections [42,43]. A multi-epitope subunit vaccine also contains a strong immunostimulatory adjuvant for enhancing immunogenicity and activating long-lasting innate and adaptive immune responses [44]. In this study, we designed three vaccine constructs, each with different adjuvants—TLR4-agonist, β-defensin, and 50S ribosomal protein L7/L12. The linkers which were used to join the finalised epitopes were GPGPG linkers [44]. The EAAAK linker was used as a stiff spacer to bind the adjuvant’s N terminal to the epitope peptide [45].

2.3. Physicochemical and Immunological Properties

Physicochemical properties of the constructs were analysed using Protparam of the ExPASy server [46]. Immunological properties, such as antigenicity and allergenicity [36], were evaluated for all 3 vaccines using Vaxijen [37] and Allertop [36]. Modelling of the tertiary structure of the vaccines was performed via 3Dpro of SCRATCH protein predictor [47]. The PDBSum [48] structural database was used to analyse Ramachandran plots for the vaccines [48]. Loop modelling was performed via the GalaxyLoop tool of GalaxyWeb (http://galaxy.seoklab.org/ (24 December 2020)), and refinement of the structure was performed with GalaxyRefine [49].

2.4. Molecular Docking

To generate effective immune responses, it is crucial to understand the binding pattern between the designed vaccines and the TLR4 immune cell receptor [50]. TLR4 expression is reported to be upregulated and mediates the secretion of several cytokines in hantavirus infection [51]. To achieve this objective, molecular docking of vaccines and TLR4 receptor (PDB ID: 4G8A) was performed via the online webserver PatchDock (http://bioinfo3d.cs.tau.ac.il/PatchDock/ (1 December 2021)) [52]. For receptor preparation and preprocessing, all heteroatoms and cocrystallised ligands were removed from TLR4 3D structure via UCSF Chimera. Results of molecular docking were further refined via FireDock (http://bioinfo3d.cs.tau.ac.il/FireDock/ (2 January 2021)) [53,54] and visualised by Chimera 1.15 [55], PDBSum [48] and DIMPLOT [56].

2.5. Molecular Dynamics Simulations

Molecular dynamic simulations were performed using AMBER18 [57,58]. Initial libraries of the complexes were prepared with an Antechamber module [59]. The receptor–vaccine complexes were solvated in a TIP3P water box, and the boundary size was set at 12 Ǻ [60]. To parameterise the receptor and vaccine molecules, force fields, i.e., ‘ff14SB’ [61,62] were used, respectively. In total, 12 Na+ ions were added to neutralise the system. Hydrogen atoms were minimised for 500 cycles, water box for 1000 rounds, α-carbon atoms for 1000 cycles, and nonheavy atoms for 300 cycles, allowing a restraint of 200 kcal/mol Å2, 5 kcal/mol Å2, and 100 kcal/mol Å2 on the rest of system, respectively [50]. After that, the systems were heated at 300 K for 20 ps in an NVT ensemble under periodic boundary conditions, and the hydrogen bond atoms were restrained by applying the SHAKE algorithm [63]. System equilibration was performed for 100 ps. Along with this, pressure equilibration was performed in the NPT ensemble first with restraint on α-carbon atoms and the second without restraint for 50 ps. After completing the above-mentioned steps, system equilibration was accomplished. A distance of 0.8 Å was set as the default cutoff value for nonbonded interactions, and the production run was executed for 100 ns. CPPTRAJ [64] command was utilised to determine trajectories. Binding free energies of the complexes were calculated via MMPB/GBSA method implemented in AMBER18 [58]. The following equation was used to estimate the systems net binding energy:

ΔGbind = ΔGcomplex − [ΔGreceptor + ΔGligand]. (1)

In total, 500 frames were picked from MD trajectories, each after every 0.2 ns.

2.6. Computational Immune Simulation

The immunogenic potential of the vaccine was evaluated by performing computational immune simulations via the C-ImmSim [65] server, which uses a position-specific score matrix (PSSM) and various other machine learning techniques to predict and study epitope and immune interactions. The immune simulation studies of the vaccines were performed using the following parameters: dose gap of two to four weeks; time steps of the 3 injections were set at 1, 84, and 168 over 4 weeks.

2.7. Disulphide Engineering and Codon Optimisation

To enhance the structural stability of the vaccines, disulphide bonds were created in the target modelled vaccine. Disulphide engineering is a recent and novel approach and can be performed with the help of Disulphide by Design 2.12 webserver [66]. This webserver also yields those pairs of amino acids which can be considered as the final target for disulphide engineering. To obtain a higher expression of the cloned sequence in the expression system (Escherichia coli), the sequence of the vaccine construct was reverse translated and optimised for codon usage via Java Codon Adaptation Tool (JCat) [67]. Codon adaptation index (CAI) and the percentage of GC were used to evaluate the expression of the cloned sequences. Ideally, the value of CAI should be 1, and the GC content of the refined sequence should be between 30–70%, which depicts favourable transcriptional and translational efficiencies [68,69,70]. Some additional input factors were also considered to prevent rho-independent transcription termination [50]. Finally, SnapGene (https://www.snapgene.com/ (10 January 2021) was used to clone the optimised vaccine construct in the pET-28a (+) expression vector.

3. Results and Discussion

3.1. Epitopes Analysis

In this study, three multi-epitopes vaccines were designed using experimentally determined human immune system stimulating epitopes against hantaviruses. The objective was to obtain appropriate epitopes among the catalogued epitopes with suitable vaccine properties. Epitopes were screened based on several parameters such as allergenicity, antigenicity, presence of transmembrane helices, toxicity, solubility, IFN-positivity, and virulence. After all these analyses, the selected epitopes were joined with each other through GPGPG linker and joined with three different types of adjuvants: (1) TLR4-agonist, (2) β-defensin, and (3) 50S ribosomal protein L7/L12 adjuvant, with the help of EAAAK linker for boosting of immune reactions. To create a more stable vaccine design, a GPGPG linker was inserted between the epitope sequences. The linkers helped in the functional preservation of each epitope (9–15 residues) so that they could act independently after being imported into the human body. Previous research has shown that utilising EAAAK as a linker increases the bioactivity of the vaccine fusion protein; thus, it was placed in the N terminal of the fusion peptide [71]. For designing the vaccine construct, 336 experimentally determined epitopes (Table S1) were retrieved that are experimentally validated immune protectors. Out of 336 epitopes, 140 allergens, 45 nonantigenic, 40 poorly soluble, and 26 showed negative results for IFN-production, and these were discarded. In total, among 84 IFN-positive epitopes, 74 nonvirulent epitopes were discarded, and 10 epitopes were predicted as virulent. Finally, 10 epitopes were shortlisted: DMRNTIMASKTVGTA, DTKPTDPTGIEPDDHLKERSSLRYGNVLDVNAIDIEEPSGQTADW, IDQKVKEISNQEPL, NKSTLQNRRAAVS, NVLDVNAIDIEEPS, KEKSSLRYGNVLDVN, RNTIMASKTVGTAE, GKNIGQDRDPTGVEPGDHLKERSALSYGNTLDLNSLDID, VDPTGLEPDDHLK, and SIDLEEPSGQTADWK. All selected epitopes were exposed. The antigenicity of selected epitopes ranged from 0.709 to 1.067, which was higher than the default threshold of 0.4, which is typically used for viruses. Furthermore, the virulence score was found to be between 0.99 and 1.05, as tabulated in Table 1, which was also greater than the default threshold of 0.0. These 10 filtered epitopes were then considered for the design of vaccine constructs.

Table 1.

Shortlisted epitopes for design of multi-epitopes vaccine constructs.

Epitopes Host (s) Allergenicity Antigenicity Solubility IFN Toxicity Virulence
DMRNTIMASKTVGTA Human Nonallergen 0.95 Soluble Positive Nontoxic Virulent 1.04
DTKPTDPTGIEPDDHLKERSSLRYGNVLDVNAIDIEEPSGQTADW Vole Nonallergen 0.88 Soluble Positive Nontoxic Virulent 0.99
IDQKVKEISNQEPL Human, rabbit, vole Nonallergen 0.84 Soluble Positive Nontoxic Virulent 1.02
NKSTLQNRRAAVS Human Mouse Nonallergen 0.88 soluble Positive Nontoxic Virulent 1.05
NVLDVNAIDIEEPS Human, Rabbit, Vole Nonallergen 0.75 soluble Positive Nontoxic Virulent 1.05
KEKSSLRYGNVLDVN Mouse, Nonallergen 1.06 Soluble Positive Nontoxic Virulent 1.02
RNTIMASKTVGTAE Human, rabbit, vole Nonallergen 0.73 soluble Positive Nontoxic Virulent 1.03
GKNIGQDRDPTGVEPGDHLKERSALSYGNTLDLNSLDID Mouse Nonallergen 0.80 soluble Positive Nontoxic Virulent 0.99
VDPTGLEPDDHLK Human Mouse Nonallergen 0.94 soluble Positive Nontoxic Virulent 1.05
SIDLEEPSGQTADWK Human Nonallergen 0.70 soluble Positive Nontoxic Virulent 1.05

3.2. Population Coverage Analysis

The molecules of the major histocompatibility complex (MHC) are highly polymeric and extensively dispersed across the world’s population. As a result, using a multi-epitope peptide-based vaccine to develop a broad-spectrum vaccine that does not target a single ethnic group is a rational strategy. The global population coverage was provided by the IEDB analysis tool to predict MHC I and MCH II combined population coverage using the final 10 selected epitopes shown in Figure 2. These epitopes interact with a collection of reference alleles, including HLA-A*01:01; HLA-A*02:01; HLA-A*02:01; HLA-A*02:03; HLA-A*02:03; HLA-A*02:06; HLA-A*02:06; HLA-A*03:01; HLA-A*03:01; HLA-A*11:01; HLA-A*11:01; HLA-A*23:01; HLA-B*08:01; HLA-A*23:01; HLA-A*24:02; HLA-A*24:02; HLA-A*26:01; HLA-A*26:01; HLA-A*30:01; HLA-A*30:01; HLA-B*57:01; HLA-A*30:02; HLA-A*31:01; HLA-B*58:01; HLA-A*32:01; HLA-A*33:01; HLA-A*33:01; HLA-A*68:01; HLA-A*68:01; HLA-A*68:02; HLA-A*68:02; HLA-A*30:02; HLA-B*07:02; HLA-B*51:01; HLA-B*07:02; HLA-B*08:01; HLA-B*15:01; HLA-B*15:01; HLA-B*35:01; HLA-A*31:01; HLA-B*35:01; HLA-B*40:01; HLA-B*40:01; HLA-B*44:02; HLA-B*44:02; HLA-B*44:03; HLA-B*44:03; HLA-B*51:01; HLA-A*01:01; HLA-B*53:01; HLA-B*53:01; HLA-B*57:01; HLA-A*32:01; HLA-B*58:01 for MHCI and HLA-DRB4*01:01; HLA-DRB1*04:01; HLA-DRB1*04:05; HLA-DRB1*07:01; HLA-DRB1*09:01; HLA-DRB1*11:01; HLA-DRB1*03:01; HLA-DRB1*13:02; HLA-DRB1*15:01; HLA-DRB3*01:01; HLA-DRB1*12:01; HLA-DRB3*02:02; HLA-DRB1*08:02; HLA-DRB1*01:01; HLA-DRB5*01:01 for MHCIIs. The countrywide population coverage for MHCI, MHCII and their combination is tabulated in Table S2. The results showed that the world population coverage was 98.55% for combined MHC class I and II. Furthermore, the predicted values for PC90 were 15.14 and 5.5 for MCH-I and MCH-II, respectively. In brief, our assessment confirmed that selected epitopes could be potential candidates for the development of multi-epitope vaccine constructs.

Figure 2.

Figure 2

Diagrammatic representation of global population coverage of selected epitopes.

3.3. Vaccine with Different Adjuvants

Vaccines based on entire organisms and proteins have proven effective in decreasing mortality and morbidity caused by infectious agents. However, high antigenic load results in inaccurate immune responses and is associated with reactogenic reactions. Multi-epitopes vaccines provide an appealing option, as they can be easily synthesised, are cost-efficient, are easy to produce, and produce specific immune responses. However, peptide vaccines are weakly immunogenic. Adjuvant addition can improve the immunogenicity of peptide multi-epitope vaccines. To design a multi-epitope vaccine construct, all selected epitopes were linked to each other with a specific linker GPGPG. As an adjuvant, TLR4-agonist was joined to increase the immunogenicity of constructs through EAAK linker to enhance immune responses against the antigen. The total count of amino acid residues for the final construct was 253. The complete amino acid sequence of the vaccine is shown in Figure 3A, while the vaccine 3D model is presented in Figure 3B. The 3D model of the vaccine contains 82.9% amino acids in favoured regions, 13.8% in additional allowed regions, and 1.1% in the disallowed regions of the Ramachandran plot (Figure 3C). The secondary structure elements of the vaccine depicted 10 helices, 6 helix–helix interactions, 58 beta turns, and 2 gamma turns (Figure 3D). Similarly, the vaccine wild and mutant structures are shown in Figure 3E, while its cloned sequence is shown in Figure 3F.

Figure 3.

Figure 3

Structure characterisation of model vaccine with TLR4-agonist adjuvant (A) amino acid sequence, (B) 3D structure of TLR4-agonist vaccine, (C) Ramachandran plot, (D) secondary structure elements, (E) original versus mutated structure, and (F) cloned vaccine into expression vector.

The second vaccine construct has β-defensin as an adjuvant joined through the EAAAK linker. The amino acid length is 291. The complete amino acid sequence of the vaccine is presented in Figure 4A, while the vaccine 3D model is shown in Figure 4B. The 3D model of the vaccine contains 82.4% amino acids in favoured regions, 14.4% in additional allowed regions, and 0.5% in the disallowed regions of the Ramachandran plot (Figure 4C). The secondary structural elements of the vaccine depicted 14 helices, 5 helix–helix interactions, 35 beta turns, and 1 gamma turns (Figure 4D). The original versus mutated structures are presented in Figure 4E, and in silico cloning analyses are presented in Figure 4F.

Figure 4.

Figure 4

Structure characterisation of model vaccine with β-defensin adjuvant (A) amino acid sequence, (B) 3D structure of β-defensin vaccine, (C) Ramachandran plot, (D) secondary structure elements, (E) original versus mutated structure, and (F) cloned vaccine into expression vector.

The third vaccine construct has 50S ribosomal protein L7/Ll2 as an adjuvant molecule. The vaccine is 376 amino acids in length. The complete amino acid sequence of the vaccine is shown in Figure 5A, while the vaccine 3D model is presented in Figure 5B. The 3D model of the vaccine contains 88.1 residues in favourable regions, 9.2% in additional allowed regions, and 0.0% in the disallowed regions of the Ramachandran plot (Figure 5C). The secondary structural elements of the vaccine depicted 15 helices, 9 helix–helix interactions, 49 beta turns, and 2 gamma turns (Figure 5D), and the original versus mutated structures are presented in Figure 5E, and in silico cloning analyses are presented in Figure 5F.

Figure 5.

Figure 5

Structure characterisation of model vaccine with TLR4-agonist adjuvant (A) amino acid sequence, (B) 3D structure of 50S Ribosomal protein L7/L12 vaccine, (C) Ramachandran plot, (D) secondary structure elements, (E) original versus mutated structure, and (F) cloned vaccine into expression vector.

3.4. Multi-Epitope Vaccine Design

After designing the vaccines, their physicochemical characteristics were determined and are summarised in Figure 6. As can be observed, the construct is very thermally stable and easy to handle during experimental analysis due to its tiny size. The numbers of amino acids were in the range of 253–376. The TLR4-agonist vaccine and β-defensin vaccine constructs had similar GRAVY values (−0.802, −0.815), and the 50S ribosomal protein L7/L12 vaccine had a value of −0.486. The GRAVY value is an assessment of the hydrophilicity and hydrophobicity of a given sequence. The GRAVY value was negative for all predicted structures, signifying their hydrophilic nature. Their theoretical pI values were shown to be 5.43, 4.58, and 4.55 for TLR4-agonist, β-defensin, and 50S ribosomal protein L7/L12 vaccines, respectively. The instability index prediction demonstrated slight differences among these three constructs in the range of 26.38–31.36. The instability indices of TLR4-agonist, β-defensin, and 50S ribosomal protein L7/L12 vaccine constructs were 31.36, 30.74, and 26.38, respectively, which categorised the protein structures as stable (score > 40 directs instability). Similarly, an aliphatic index of 61.65 (TLR4-agonist), 63.53 (β-defensin), and 77.9 (50S ribosomal protein L7/L12 vaccine) indicated the thermostability of the vaccine constructs. Moreover, all these vaccines were confirmed to be nonallergenic, and their antigenicity values were calculated to be > 0.92. The overall content of amino acids of the construct structures was similar, and the only difference was that of selected adjuvants. As a result, no major alterations in physicochemical properties were observed. The construct’s stable and functioning three-dimensional structural unit was anticipated and subjected to loop modelling. Following that, the loop-modelled construct was refined. Both local and global searches were conducted with a greater degree of constraint. Table 2 illustrates the various refinement parameters for the top five most refined structures of constructs. Model 1 was chosen as the refined model because it had the lowest stable galaxy energy, a lower MolProbity and clash score, no bad rotamers, and the greatest number of Rama-favoured residues in comparison with the original input structure.

Figure 6.

Figure 6

Vaccine constructs with different three types of adjuvants.

Table 2.

Physical parameters for validation of final subunit vaccine constructs.

TLR4-Agonist
Model GDT-HA RMSD MolProbity Clash Score Poor Rotamers Rama Favoured
Initial 1 0 3.692 104.6 4.9 83.6
MODEL 1 0.9225 0.499 2.123 15.4 0.5 93.4
MODEL 2 0.9254 0.494 2.184 15.4 0.5 91.8
MODEL 3 0.9254 0.491 2.163 15.7 0.5 92.6
MODEL 4 0.9283 0.471 2.134 14.1 0.5 92.2
MODEL 5 0.9176 0.507 2.061 13.8 0.5 93.8
β-Defensin
Model GDT-HA RMSD MolProbity Clash Score Poor Rotamers Rama Favoured
Initial 1 0 3.707 101.6 5.1 82.7
MODEL 1 0.8978 0.55 2.164 17.9 0 93.8
MODEL 2 0.8995 0.54 2.153 16.7 0.9 93.4
MODEL 3 0.8952 0.559 2.169 18.1 0.4 93.8
MODEL 4 0.8918 0.557 2.164 17.9 0.9 93.8
MODEL 5 0.9012 0.545 2.18 17.9 0.4 93.4
50S Ribosomal Protein L7/L12
Model GDT-HA RMSD MolProbity Clash Score Poor Rotamers Rama Favoured
Initial 1 0 3.449 98.8 3.7 89.8
MODEL 1 0.9162 0.495 1.99 14.8 0.7 95.5
MODEL 2 0.9182 0.492 2.1 14.8 1.4 95.5
MODEL 3 0.9162 0.493 1.965 13.9 0.7 95.5
MODEL 4 0.9195 0.487 1.96 13.7 0.3 95.5
MODEL 5 0.9182 0.498 1.909 12 0.3 95.5

cla3.5 disulphide engineering of designed vaccine constructs.

Disulphide engineering of the vaccines was performed to optimise molecular interactions and confer considerable stability by attaining precise geometric conformation. In the process, pairs of residues which had an interaction energy nonfavourable towards vaccine stability were mutated to cysteine. The binding energy value of the mutated residues was > 1 kcal/mol. For the TLR-4-agonist vaccine adjuvant, 26 pairs of residues were mutated. Likewise, in the β-defensin vaccine construct, 23 pairs of residues were replaced with cysteine amino acids. Similarly, in the 50S ribosomal protein L7/L12 vaccine construct, 26 pairs of residues were found highly unstable hence mutated. All unstable residue pairs, along with their binding energy, are tabulated in Table S3.

3.5. Molecular Docking of Vaccine Constructs with TLR4

In computational vaccine design studies, binding interaction between vaccines and human immune cell receptors is crucial to assure the production of specific cellular and antibody immune responses [72]. Molecular docking is one of the ways to predict the best binding confirmation between vaccine constructs and receptors. To accomplish this, PatchDock [73,74,75], (a blind docking technique) was employed, in which the surface of the TLR4 immune receptor was made accessible for vaccine construct binding. Following that, top solutions were sent to the FireDock web service, which corrects protein flexibility issues that occur during protein–peptide docking and enables high-throughput complex refinement. The refined top ten solutions, ranked by world energy consumption, are shown in Table 3. In the case of the TLR4-agonist vaccine, solution 4 was selected based on the lowest global energy (−29.63 kcal/mol). The major contributions to this global energy were from attractive Van der Waals interactions (−44.67 kcal/mol) and hydrogen bond energy (−5.12 kcal/mol). In the cases of β-defensin and 50S ribosomal protein L7/L12, solution 9 was selected, with global energy of −3.41 kcal/mol (in the case of β-defensin) and −11.03 kcal/mol (in the case of 50S ribosomal protein L7/L12). The three vaccines displayed robust interactions with the receptor molecules and were observed in deep binding. The binding mode and interactions of the vaccines with TLR4 can be seen in Figure 7, Figure 8 and Figure 9.

Table 3.

Top 10 docked complexes of designed vaccines with TLR4. The values can be interpreted in kcal/mol.

TLR4−Agonist
Rank Solution Number Global Energy Attractive VdW Repulsive VdW Atomic Contact Energy Hydrogen Bond Energy
1 4 −29.63 −44.67 41.32 4.84 −5.12
2 7 6.71 −15.14 12.21 −1.23 −1.20
3 3 16.63 −23.10 24.78 8.02 −2.98
4 8 30.40 −17.64 22.04 12.26 −2.67
5 2 79.31 −8.74 81.87 2.58 −0.84
6 10 83.47 −49.20 155.60 15.30 −4.87
7 9 107.83 −42.49 146.03 17.89 −5.37
8 5 121.17 −32.38 193.07 6.66 −2.80
9 1 432.16 −30.72 570.71 4.75 −2.82
10 6 4149.68 −63.85 5310.77 8.60 −4.70
β−Defensin
Rank Solution Number Global Energy Attractive VdW Repulsive VdW Atomic Contact Energy Hydrogen Bond Energy
1 9 −3.41 −5.43 1.69 2.98 −2.97
2 7 10.42 −3.55 0.40 1.50 0.00
3 2 10.51 −58.47 80.50 20.95 −10.00
4 4 31.11 −3.73 0.00 4.15 0.00
5 6 364.44 −51.20 547.20 5.50 −10.07
6 1 615.86 −53.65 872.84 4.94 −1.23
7 10 918.64 −57.19 1206.60 8.00 −9.37
8 3 1371.21 −72.88 1860.69 4.42 −14.33
9 5 1617.02 −83.97 2179.88 17.45 −18.53
10 8 4445.60 −95.90 5699.42 15.36 −13.35
50S Ribosomal Protein L7/L12
Rank Solution Number Global Energy Attractive VdW Repulsive VdW Atomic Contact Energy Hydrogen Bond Energy
1 9 −11.03 −9.67 7.15 0.93 −1.31
2 4 −0.43 −3.27 1.17 2.48 −1.33
3 5 2.61 −4.54 6.50 2.57 −0.73
4 7 13.94 −10.63 5.23 2.94 −0.45
5 10 18.08 −1.80 0.00 3.89 −0.95
6 2 54.13 −39.14 116.61 8.41 −2.65
7 8 108.38 −40.95 195.97 11.18 −6.06
8 3 192.03 −16.85 216.91 14.88 −2.43
9 1 3011.31 −37.19 3794.70 6.44 −3.85
10 6 6854.97 −119.49 8726.07 23.31 −21.54

Figure 7.

Figure 7

Docked pose of TLR4-agonist vaccine with TLR4: (A) every single entity of the complex is self-explanatory. Each chain of the receptor TLR4 is represented in a different colour, i.e., chain A: dark red, chain B: deep sky blue, chain C: green, and chain D: yellow, and the designed vaccine construct TLR4-agonist is represented in dim grey; interacting residues between receptor and vaccine are shown in dark slate blue. (B) Residue-residue interaction between vaccine construct and TLR4 chains.

Figure 8.

Figure 8

Docked pose of β-defensin vaccine with TLR4: (A) every single entity of the complex is self-explanatory. Each chain of the receptor TLR4 is represented in a different colour, i.e., chain A: purple, chain B: green, chain C: yellow, and chain D: dark red, and the designed vaccine construct β-defensin is represented in deep pink; interacting residues between receptor and vaccine are shown in navy blue. (B) Residue-residue interaction between vaccine construct and TLR4 chains.

Figure 9.

Figure 9

Docked pose of ribosomal protein L7/L12 vaccine with TLR4: (A) each entity of the complex is self-explanatory. Each chain of the receptor TLR4 is represented with a different colour, i.e., chain A: magenta, chain B: dark slate blue, chain C: cyan, and chain D: purple, and the designed vaccine construct ribosomal protein L7/L12 vaccine is represented in dark red; interacting residues between receptor and vaccine are shown in green. (B) Residue-residue interaction between vaccine construct and TLR4 chains.

Valuable insights about designed vaccines binding interactions with TLR4 were obtained via the PDBsum server. It was discovered that hydrogen bonds and hydrophobic interactions are key in the stable binding of the docked complexes. The number of hydrogen bonds between the TLR4 antagonist adjuvant-based vaccine construct and the TLR4 receptor is three. Vaccine residues (ASP61, ASP241, and SER239) were seen in hydrogen bonding with the receptor within a range of 2 Å. The β-defensin adjuvant-based vaccine construct and the TLR4 receptor formed seven hydrogen bonds, and the following residues participated in interaction with the receptor: ARG148, GLN145, ARG148, GLN220, and ASP221. A total of 18 hydrogen bonds were found between the 50S ribosomal protein L7/L12 adjuvant-based vaccine and the TLR4 receptor. Vaccine residues involved in hydrogen bonding are ASN181 ASN231, ALA187, THR228, ASP199, ASP199, ALA198, GLY203, CYS219, GLN208, GLY203, LYS209, SER176, GLU191, SER194, and VAL182. In Figure 7, Figure 8 and Figure 9, interaction maps for bonds are presented alongside each complex to demonstrate intermolecular interactions.

3.6. Molecular Dynamics Simulations Analysis

Molecular dynamics simulation is a powerful technique to study the dynamics of docked complexes by allowing the molecules to interact with each other in a fixed time period [43]. The simulation analysis includes root-mean-square deviation (RMSD) which allows superimposition of all simulation snapshots over the initial docked frame. The deviations of the carbon alpha atoms were measured in terms of an angstrom (Å) and plotted versus time as shown in Figure 10. The three complexes were found to be highly stable, and the RMSD was found to be within 3 Å. The TLR4 vaccine complex was revealed as the most stable complex, as can be seen in a uniform plot, with very minor fluctuations. The RMSD of the TLR4–vaccine complex was within 2 Å, which is an indication of a highly stable complex. The β-defensin–vaccine complex was be observed in increasing RMSD until 37 ns; then, the system reached a consistent equilibrium till the simulation end. The 50S ribosomal–vaccine complex was detected in continuous dynamics till 25 ns, followed by stable RMSD till 87 ns, and lastly, it experienced a small RMSD surge. Upon visualisation, intermolecular conformation was very stable in all three complexes, and no major deviations were noted, as predicted by RMSD plots. Next, the residue level fluctuations of the complexes were studied via the root-mean-square fluctuations (RMSF) based on carbon alpha atoms. As reflected by RMSD, the fluctuations of the systems were very low. For each system, the vaccine construct residues were noticed in some fluctuations, which may be the reason for vaccine adjustment at the docked site. However, these fluctuations did not affect the overall binding and stability of the systems. The simulation results were further evaluated in terms of stability provided by the disulphide bonds in the vaccine 3D structure. During the dynamics of the complexes, it was observed that disulphide bonds of the vaccines played important roles in giving the vaccine 3D structure more contact and giving more structural strength, allowing the vaccine to be in a stable binding conformation and allowing interactions with the receptors at the docked side.

Figure 10.

Figure 10

Structural stability analysis of simulated vaccine–receptor complexes: (A) RMSD and (B) RMSF.

3.7. Salt Bridges between TLR4 and Vaccine Constructs

Salt bridges occur between the charged side chains of amino acids in a protein molecule when the pH is neutral. The primary residues involved in these interactions are glutamine and aspartate, which have a negative full electron charge, and arginine and lysine, which have a positive full electron charge. The presence of salt bridges between interacting molecules suggests that the interaction’s stability improved [76]. For the TLR4-agonist vaccine–TLR4 receptor complex, high numbers of salt bridges were calculated within 3.2 Å between TLR4 receptor Arg353, Lys1276, Glu445, Arg577, Glu1162, Glu307, Arg228, Arg228, Arg1281 with the Tlr4-agonist vaccine adjuvant Asp1705, Asp1724, Lys1679, Asp1734, Lys1495, Lys1716, Asp1712, Asp1713, and Asp1705, respectively (Figure 11A). In the case of the β-defensin vaccine–TLR4 complex, receptor residues Arg1185, Lys1348, Lys1367, Arg1185, Lys1367, Glu1187, Asp1193, Glu560, and Lys1458 were involved in salt bridging, with Glu1613, Asp1746, Glu1751, Glu1593, Glu1618, Asp1600, Lys1627, Arg1633, and Asp1739 of the vaccine construct, respectively (Figure 11B). In the case of 50s ribosomal protein L7/L12 vaccine–TLR4 complex, receptor residues Glu748, Arg775, Lys1348, Glu721, Arg1434, Lys709, Glu621, Lys1400, Asp773, Asp817, and Arg666 were involved in salt bridging with Arg1754, Asp1760, Glu1659, Arg1754, Asp1675, Asp1685, Arg1664, Glu1677, Lys1748, Lys1695, and Asp1670 of 50s ribosomal protein L7/L12 vaccine (Figure 11C).

Figure 11.

Figure 11

Salt bridges formed between receptor and vaccine: (A) TLR4-agonist vaccine with TLR4; (B) β-defensin vaccine with TLR4; (C) 50S ribosomal protein L7/L12 vaccine with TLR4.

3.8. Binding Free Energies Calculation

MM–GBSA and MM–PBSA binding free energies were estimated for the complexes to highlight atomic-level interactions. It was found that Van der Waals energy was the most dominant in the gas phase, with polar solvation energy and overall solvation energy. The electrostatic energy was nonsignificant in its contribution to the net gas phase energy, while nonpolar solvation energy was less favourable.

Overall, the net binding energy of all systems revealed excellent binding which was TLR4-agonist vaccine with TLR4 (MM–GBSA, −1628.47 kcal/mol and MM–PBSA, −37.75 kcal/mol); 50S ribosomal protein L7/L12 vaccine with TLR4 complex (MM–GBSA, −194.62 kcal/mol and MM–PBSA, −150.67 kcal/mol); β-defensin vaccine with TLR4 complex (MM–GBSA, −9.80 kcal/mol and MM–PBSA, −42.34 kcal/mol). The complex binding free energy analysis is given in Table 4.

Table 4.

Binding free energies estimated for complexes. The values are given in kcal/mol.

MMGBSA MMPBSA
TLR4-Agonist Vaccine with TLR4
Energy Component Average Std Dev Err. of Mean Energy Component Average Std Dev Err. of Mean
Van der Waals Energy −220.7 35.5 3.5 Van der Waals Energy −220.7 35.5 3.5
Electrostatic Energy 1798.2 82.3 8.2 Electrostatic Energy 1798.2 82.3 8.2
Gas-Phase Energy 1577.5 55.4 5.5 Gas-Phase Energy 1577.5 55.4 5.5
Solvation Energy −1628.4 56.6 5.66 Solvation Energy −1615.3 54.0 5.4
Total −1628.4 13.3 1.33 Total −37.7 15.9 1.5
β-Defensin Vaccine with TLR4
Van der Waals Energy −90.2 17.1 1.7 Van der Waals Energy −90.2 17.1 1.7
Electrostatic Energy 790.7 74.6 7.4 Electrostatic Energy 790.7 74.6 7.4
Gas-Phase Energy 700.4 59.4 5.9 Gas-Phase Energy 700.4 59.4 5.9
Solvation Energy −710.29 53.6 5. Solvation Energy −742.8 52.5 5.2
Total −9.8 8.1 0.8 Total −42.3 10.3 1.0
50S Ribosomal Protein L7/L12 Vaccine with TLR4
Van der Waals Energy −361.1 35.6 3.5 Van der Waals Energy −361.1 35.6 3.5
Electrostatic Energy 1723.3 52.5 5.2 Electrostatic Energy 1723.3 52.5 5.2
Gas-Phase Energy 1362.1 45.7 4.5 Gas-Phase Energy 1362.1 45.7 4.5
Solvation Energy −1556.8 48.6 4.8 Solvation Energy −1512.8 72.3 7.2
Total −194.6 40.9 4.0 Total −150.6 65.6 6.5

3.9. In Silico Cloning

Sequences of vaccine constructs were reversely translated into sequences of DNA via the JCat server to obtain high expression in E. coli. The E. coli expression system was selected for the synthesis of recombinant proteins. To ensure that our recombinant vaccine proteins were produced at a high level in the E. coli K12 system, we carried out codon optimisation. The GC content value for TLR4-agonist, β-defensin, and 50S ribosomal protein L7/L12 vaccines was 58.36%, 58.30% and 54.35%, respectively. The CAI value for the TLR4-agonist vaccine was 1.0, for β-defensin, it was 0.93, and for 50S ribosomal protein L7/L12 adjuvant vaccine, it was 0.96. All these values were within an acceptable range, indicating greater expression of the vaccines.

3.10. Clustering Analysis of Vaccine Constructs

It is essential to find candidates with an optimal affinity for a wide variety of MHC human leukocyte antigen (HLA) alleles while designing vaccines. MHC cluster v2.0 was employed for MHC clustering analysis (http://www.cbs.dtu.dk/services/MHCcluster (accessed on 12 February 2021)) [77]. Figure 12A,B describe the schematic representation of MHC class I and II clustering analysis of vaccine constructs, respectively.

Figure 12.

Figure 12

Figure 12

(A) Major histocompatibility complex (MHC) I clustering analysis for T cell epitopes; (B) major histocompatibility complex (MHC) II clustering analysis for T cell epitopes.

3.11. Computational Immune Simulation

To analyse the immunogenic profiles of the designed vaccines, the C-IMMSIM server was used. All primary, secondary, and tertiary immune responses were quite significant contributors to immunity to vaccine antigens. In addition to this, a combination of IgM + IgG was observed in the higher titres, followed by IgG1 + IgG2 and IgM, as shown in Figure 13. In particular, elevated B cell isotopes were formed in response to the vaccines, which resulted in the formation of memory cells. The strong responses of cytokines and interleukins were also analysed and demonstrated that the vaccine constructs induce high levels of IFN-γ and IL-2.

Figure 13.

Figure 13

C-Immune Simulation: (A) TLR4-agonist, (B) β-defensin, and (C) 50S ribosomal protein L7/L12 vaccines.

4. Concluding Remarks

No licensed vaccine is currently available against hantavirus infection, though several are under clinical investigation. Inactivated hantavirus vaccines are approved for human use in Korea and China, but no such vaccines are licensed in the US or Europe. The present clinical trials of inactivated hantavirus vaccine and those of DNA vaccines in the US are summarised by Liu et al. [78]. Antigenic, virulent, nontoxigenic, nonallergic, and good DRB*0101 binder epitopes were used to design in silico multi-epitopes based vaccines against hantaviruses in the present study. Docking studies predicted that the designed vaccine constructs would have a high binding affinity with the TLR4 immune cell receptor for stimulating cellular and humoral immune responses. Furthermore, molecular dynamics simulations revealed that the intermolecular interactions are quite stable. The docking results were validated by calculating binding free energy. Despite the fact that these in silico predictions are extremely promising, this study’s primary flaw is the lack of experimental validations, which leaves experimentalists free to assess the immune protection efficiency of the proposed vaccine design.

Acknowledgments

We are thankful to the administrative staff of Foundation University, Islamabad.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/vaccines10030378/s1, Table S1: Country-wise population coverage of each epitopes; Table S2: Selected epitopes; Table S3: Pair of residues, which were mutated to cysteine amino acid.

Author Contributions

Data curation, conceptualisation, visualisation, methodology, investigation, writing—original draft preparation, writing—reviewing and editing, S.I.; data curation, visualisation, investigation, software, methodology, S.W.A.; data curation, writing—original draft preparation, M.Y.; conceptualisation, methodology, software, writing—review and editing, S.A.; data curation, methodology, investigation, resources, writing—review and editing, K.M.; conceptualisation, data curation, methodology, supervision, resources, writing—original draft preparation, writing—reviewing and editing, Y.W. All authors have read and agreed to the published version of the manuscript.

Funding

Y.W. is supported by Foundation University Islamabad’s internal funding by ORIC FUI. K.M. is supported by UAE University start-up Grant No. G00003347 and UAEU-UPAR-Grant No. G00003458.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

Not applicable.

Conflicts of Interest

The authors declare no conflict of interest.

Footnotes

Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

References

  • 1.Liu R., Ma H., Shu J., Zhang Q., Han M., Liu Z., Jin X., Zhang F., Wu X. Vaccines and Therapeutics Against Hantaviruses. Front. Microbiol. 2020;10:2989. doi: 10.3389/fmicb.2019.02989. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2.Kim W.-K., Cho S., Lee S.-H., No J.S., Lee G.-Y., Park K., Lee D., Jeong S.T., Song J.-W. Genomic Epidemiology and Active Surveillance to Investigate Outbreaks of Hantaviruses. Front. Cell. Infect. Microbiol. 2021;10:803. doi: 10.3389/fcimb.2020.532388. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Brocato R.L., Hooper J.W. Progress on the Prevention and Treatment of Hantavirus Disease. Viruses. 2019;11:610. doi: 10.3390/v11070610. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.D’Souza M.H., Patel T.R. Biodefense Implications of New-World Hantaviruses. Front. Bioeng. Biotechnol. 2020;8:925. doi: 10.3389/fbioe.2020.00925. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Heinemann P., Tia M., Alabi A., Anon J.-C., Auste B., Essbauer S., Gnionsahe A., Kigninlman H., Klempa B., Kraef C., et al. Human Infections by Non–Rodent-Associated Hantaviruses in Africa. J. Infect. Dis. 2016;214:1507–1511. doi: 10.1093/infdis/jiw401. [DOI] [PubMed] [Google Scholar]
  • 6.Jiang H., Zheng X., Wang L., Du H., Wang P., Bai X. Hantavirus infection: A global zoonotic challenge. Virol. Sin. 2017;32:32–43. doi: 10.1007/s12250-016-3899-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7.Schmaljohn C.S., Nichol S.T. Fields’ Virology. 5th ed. Lippincott Williams Wilkins; Philadelphia, PA, USA: 2007. Bunyaviridae; pp. 1741–1789. [Google Scholar]
  • 8.Meyer B.J., Schmaljohn C.S. Persistent hantavirus infections: Characteristics and mechanisms. Trends Microbiol. 2000;8:61–67. doi: 10.1016/S0966-842X(99)01658-3. [DOI] [PubMed] [Google Scholar]
  • 9.Witkowski P.T., Drexler J.F., Kallies R., Ličková M., Bokorová S., Mananga G.D., Szemes T., Leroy E.M., Krüger D.H., Drosten C. Phylogenetic Analysis of a Newfound Bat-Borne Hantavirus Supports a Laurasiatherian Host Association for Ancestral Mammalian Hantaviruses. Infect. Genet. Evol. 2016;41:113–119. doi: 10.1016/j.meegid.2016.03.036. [DOI] [PubMed] [Google Scholar]
  • 10.Yanagihara R., Gu S.H., Arai S., Kang H.J., Song J.-W. Hantaviruses: Rediscovery and new beginnings. Virus Res. 2014;187:6–14. doi: 10.1016/j.virusres.2013.12.038. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Zhang Y.-Z. Discovery of hantaviruses in bats and insectivores and the evolution of the genus Hantavirus. Virus Res. 2014;187:15–21. doi: 10.1016/j.virusres.2013.12.035. [DOI] [PubMed] [Google Scholar]
  • 12.Forbes K.M., Sironen T., Plyusnin A. Hantavirus maintenance and transmission in reservoir host populations. Curr. Opin. Virol. 2018;28:1–6. doi: 10.1016/j.coviro.2017.09.003. [DOI] [PubMed] [Google Scholar]
  • 13.Nuzum E.O., Rossi C.A., Stephenson E.H., LeDuc J.W. Aerosol Transmission of Hantaan and Related Viruses to Laboratory Rats. Am. J. Trop. Med. Hyg. 1988;38:636–640. doi: 10.4269/ajtmh.1988.38.636. [DOI] [PubMed] [Google Scholar]
  • 14.Voutilainen L., Sironen T., Tonteri E., Bäck A.T., Razzauti M., Karlsson M., Wahlström M., Niemimaa J., Henttonen H., Lundkvist Å. Life-Long Shedding of Puumala Hantavirus in Wild Bank Voles (Myodes Glareolus) J. Gen. Virol. 2015;96:1238–1247. doi: 10.1099/vir.0.000076. [DOI] [PubMed] [Google Scholar]
  • 15.Sargianou M., Watson D.C., Chra P., Papa A., Starakis I., Gogos C., Panos G. Hantavirus Infections for the Clinician: From Case Presentation to Diagnosis and Treatment. Crit. Rev. Microbiol. 2012;38:317–329. doi: 10.3109/1040841X.2012.673553. [DOI] [PubMed] [Google Scholar]
  • 16.Jiang H., Du H., Wang L.M., Wang P.Z., Bai X.F. Hemorrhagic Fever with Renal Syndrome: Pathogenesis and Clinical Picture. Front. Cell. Infect. Microbiol. 2016;6:1. doi: 10.3389/fcimb.2016.00001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Munir N., Jahangeer M., Hussain S., Mahmood Z., Ashiq M., Ehsan F., Akram M., Shah S.M.A., Riaz M., Sana A. Hantavirus diseases pathophysiology, their diagnostic strategies and therapeutic approaches: A review. Clin. Exp. Pharmacol. Physiol. 2020;48:20–34. doi: 10.1111/1440-1681.13403. [DOI] [PubMed] [Google Scholar]
  • 18.Muranyi W., Bahr U., Zeier M., van der Woude F.J. Hantavirus Infection. J. Am. Soc. Nephrol. 2005;16:3669–3679. doi: 10.1681/ASN.2005050561. [DOI] [PubMed] [Google Scholar]
  • 19.Zhang L. Multi-epitope vaccines: A promising strategy against tumors and viral infections. Cell. Mol. Immunol. 2017;15:182–184. doi: 10.1038/cmi.2017.92. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Abdulla F., Nain Z., Hossain M.M., Sayed S.B., Khan M.S.A., Adhikari U.K. Computational Approach for Screening the Whole Proteome of Hantavirus and Designing a Multi-Epitope Subunit Vaccine. bioRxiv. 2019:832980. doi: 10.1101/832980. [DOI] [Google Scholar]
  • 21.Brennick C., George M.M., Corwin W.L., Srivastava P., Ebrahimi-Nik H. Neoepitopes as cancer immunotherapy targets: Key challenges and opportunities. Immunotherapy. 2017;9:361–371. doi: 10.2217/imt-2016-0146. [DOI] [PubMed] [Google Scholar]
  • 22.Buonaguro L., Consortium H. Developments in Cancer Vaccines for Hepatocellular Carcinoma. Cancer Immunol. Immunother. 2016;65:93–99. doi: 10.1007/s00262-015-1728-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.He R., Yang X., Liu C., Chen X., Wang L., Xiao M., Ye J., Wu Y., Ye L. Efficient Control of Chronic LCMV Infection by a CD4 T Cell Epitope-Based Heterologous Prime-Boost Vaccination in a Murine Model. Cell. Mol. Immunol. 2017;15:815–826. doi: 10.1038/cmi.2017.3. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Kuo T., Wang C., Badakhshan T., Chilukuri S., BenMohamed L. The Challenges and Opportunities for the Development of a T-Cell Epitope-Based Herpes Simplex Vaccine. Vaccine. 2014;2014;32:6733–6745. doi: 10.1016/j.vaccine.2014.10.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Lu I.-N., Farinelle S., Sausy A., Muller C.P. Identification of a CD4 T-Cell Epitope in the Hemagglutinin Stalk Domain of Pandemic H1N1 Influenza Virus and Its Antigen-Driven TCR Usage Signature in BALB/c Mice. Cell. Mol. Immunol. 2016;14:511–520. doi: 10.1038/cmi.2016.20. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26.Khan A., Shin O.S., Na J., Kim J.K., Seong R.-K., Park M.-S., Noh J.Y., Song J.Y., Cheong H.J., Park Y.H. A Systems Vaccinology Approach Reveals the Mechanisms of Immunogenic Responses to Hantavax Vaccination in Humans. Sci. Rep. 2019;9:4760. doi: 10.1038/s41598-019-41205-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 27.Yi Y., Park H., Jung J. Effectiveness of Inactivated Hantavirus Vaccine on the Disease Severity of Hemorrhagic Fever with Renal Syndrome. Kidney Res. Clin. Pract. 2018;37:366. doi: 10.23876/j.krcp.18.0044. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.Dong Y., Ma T., Zhang X., Ying Q., Han M., Zhang M., Yang R., Li Y., Wang F., Liu R. Incorporation of CD40 Ligand or Granulocyte-Macrophage Colony Stimulating Factor into Hantaan Virus (HTNV) Virus-like Particles Significantly Enhances the Long-Term Immunity Potency against HTNV Infection. J. Med. Microbiol. 2019;68:480–492. doi: 10.1099/jmm.0.000897. [DOI] [PubMed] [Google Scholar]
  • 29.Nicacio C.D.C., Della Valle M.G., Padula P., Bjorling E., Plyusnin A., Lundkvist A. Cross-Protection against Challenge with Puumala Virus after Immunization with Nucleocapsid Proteins from Different Hantaviruses. J. Virol. 2002;76:6669–6677. doi: 10.1128/JVI.76.13.6669-6677.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Schmaljohn C.S., Hasty E.S., Dalrymple J.M. Preparation of candidate vaccinia-vectored vaccines for haemorrhagic fever with renal syndrome. Vaccine. 1992;10:10–13. doi: 10.1016/0264-410X(92)90412-D. [DOI] [PubMed] [Google Scholar]
  • 31.Safronetz D., Hegde N.R., Ebihara H., Denton M., Kobinger G.P., Jeor S.S., Feldmann H., Johnson D.C. Adenovirus Vectors Expressing Hantavirus Proteins Protect Hamsters against Lethal Challenge with Andes Virus. J. Virol. 2009;83:7285–7295. doi: 10.1128/JVI.00373-09. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Brown K.S., Safronetz D., Marzi A., Ebihara H., Feldmann H. Vesicular Stomatitis Virus-Based Vaccine Protects Hamsters against Lethal Challenge with Andes Virus. J. Virol. 2011;85:12781–12791. doi: 10.1128/JVI.00794-11. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Boudreau E.F., Josleyn M., Ullman D., Fisher D., Dalrymple L., Sellers-Myers K., Loudon P., Rusnak J., Rivard R., Schmaljohn C., et al. A Phase 1 clinical trial of Hantaan virus and Puumala virus M-segment DNA vaccines for hemorrhagic fever with renal syndrome. Vaccine. 2012;30:1951–1958. doi: 10.1016/j.vaccine.2012.01.024. [DOI] [PubMed] [Google Scholar]
  • 34.Jiang D.-B., Zhang J.-P., Cheng L.-F., Zhang G.-W., Li Y., Li Z.-C., Lu Z.-H., Zhang Z.-X., Lu Y.-C., Zheng L.-H., et al. Hantavirus Gc Induces Long-Term Immune Protection via LAMP-Targeting DNA Vaccine Strategy. Antiviral Res. 2018;150:174–182. doi: 10.1016/j.antiviral.2017.12.011. [DOI] [PubMed] [Google Scholar]
  • 35.Pickett B.E., Sadat E.L., Zhang Y., Noronha J.M., Squires R.B., Hunt V., Liu M., Kumar S., Zaremba S., Gu Z., et al. ViPR: An Open Bioinformatics Database and Analysis Resource for Virology Research. Nucleic Acids Res. 2012;40:D593–D598. doi: 10.1093/nar/gkr859. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Dimitrov I., Flower D.R., Doytchinova I. AllerTOP—A server for in silico prediction of allergens. BMC Bioinform. 2013;14:S4. doi: 10.1186/1471-2105-14-S6-S4. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37.Doytchinova I.A., Flower D.R. VaxiJen: A server for prediction of protective antigens, tumour antigens and subunit vaccines. BMC Bioinform. 2007;8:4. doi: 10.1186/1471-2105-8-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Gupta S., Kapoor P., Chaudhary K., Gautam A., Kumar R., Raghava G.P. Peptide Toxicity Prediction. In: Zhou P., Huang J., editors. Computational Peptidology. Springer; Chandigarh, India: 2015. pp. 143–157. [DOI] [PubMed] [Google Scholar]
  • 39.Garg A., Gupta D. VirulentPred: A SVM Based Prediction Method for Virulent Proteins in Bacterial Pathogens. BMC Bioinform. 2008;9:62. doi: 10.1186/1471-2105-9-62. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Rost B., Sander C., Casadio R., Fariselli P. Transmembrane Helices Predicted at 95% Accuracy. Protein Sci. 1995;4:521–533. doi: 10.1002/pro.5560040318. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.Li W., Joshi M.D., Singhania S., Ramsey K.H., Murthy A.K. Peptide Vaccine: Progress and Challenges. Vaccines. 2014;2:515–536. doi: 10.3390/vaccines2030515. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42.Abbas G., Zafar I., Ahmad S., Azam S.S. Immunoinformatics Design of a Novel Multi-Epitope Peptide Vaccine to Combat Multi-Drug Resistant Infections Caused by Vibrio Vulnificus. Eur. J. Pharm. Sci. 2019;142:105160. doi: 10.1016/j.ejps.2019.105160. [DOI] [PubMed] [Google Scholar]
  • 43.Khan S., Khan A., Rehman A.U., Ahmad I., Ullah S., Khan A.A., Ali S.S., Afridi S.G., Wei D.-Q. Immunoinformatics and Structural Vaccinology Driven Prediction of Multi-Epitope Vaccine against Mayaro Virus and Validation through in-Silico Expression. Infect. Genet. Evol. 2019;73:390–400. doi: 10.1016/j.meegid.2019.06.006. [DOI] [PubMed] [Google Scholar]
  • 44.Nezafat N., Karimi Z., Eslami M., Mohkam M., Zandian S., Ghasemi Y. Designing an Efficient Multi-Epitope Peptide Vaccine against Vibrio Cholerae via Combined Immunoinformatics and Protein Interaction Based Approaches. Comput. Biol. Chem. 2016;62:82–95. doi: 10.1016/j.compbiolchem.2016.04.006. [DOI] [PubMed] [Google Scholar]
  • 45.Motamedi M.J., Amani J., Shahsavandi S., Salmanian A.H. In Silico Design of Multimeric HN-F Antigen as a Highly Immunogenic Peptide Vaccine against Newcastle Disease Virus. Int. J. Pept. Res. Ther. 2014;20:179–194. doi: 10.1007/s10989-013-9380-x. [DOI] [Google Scholar]
  • 46.Gasteiger E., Hoogland C., Gattiker A., Wilkins M.R., Appel R.D., Bairoch A. Protein Identification and Analysis Tools on the ExPASy Server. Proteom. Protoc. Handb. 2005:71–607. doi: 10.1385/1-59259-890-0:571. [DOI] [Google Scholar]
  • 47.Cheng J., Randall A.Z., Sweredoski M.J., Baldi P. SCRATCH: A Protein Structure and Structural Feature Prediction Server. Nucleic Acids Res. 2005;33:W72–W76. doi: 10.1093/nar/gki396. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48.Laskowski R.A. PDBsum: Summaries and Analyses of PDB Structures. Nucleic Acids Res. 2001;29:221–222. doi: 10.1093/nar/29.1.221. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Heo L., Park H., Seok C. GalaxyRefine: Protein Structure Refinement Driven by Side-Chain Repacking. Nucleic Acids Res. 2013;41:W384–W388. doi: 10.1093/nar/gkt458. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 50.Ismail S., Ahmad S., Azam S.S. Vaccinomics to Design a Novel Single Chimeric Subunit Vaccine for Broad-Spectrum Immunological Applications Targeting Nosocomial Enterobacteriaceae Pathogens. Eur. J. Pharm. Sci. 2020;146:105258. doi: 10.1016/j.ejps.2020.105258. [DOI] [PubMed] [Google Scholar]
  • 51.Yu H.-T., Jiang H., Zhang Y., Nan X.-P., Li Y., Wang W., Jiang W., Yang D.-Q., Su W.-J., Wang J.-P., et al. Hantaan Virus Triggers TLR4-Dependent Innate Immune Responses. Viral Immunol. 2012;25:387–393. doi: 10.1089/vim.2012.0005. [DOI] [PubMed] [Google Scholar]
  • 52.Schneidman-Duhovny D., Inbar Y., Nussinov R., Wolfson H.J. PatchDock and SymmDock: Servers for Rigid and Symmetric Docking. Nucleic Acids Res. 2005;33:W363–W367. doi: 10.1093/nar/gki481. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53.Andrusier N., Nussinov R., Wolfson H.J. FireDock: Fast interaction refinement in molecular docking. Proteins Struct. Funct. Bioinform. 2007;69:139–159. doi: 10.1002/prot.21495. [DOI] [PubMed] [Google Scholar]
  • 54.Mashiach E., Schneidman-Duhovny D., Andrusier N., Nussinov R., Wolfson H.J. FireDock: A Web Server for Fast Interaction Refinement in Molecular Docking. Nucleic Acids Res. 2008;36:W229–W232. doi: 10.1093/nar/gkn186. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55.Pettersen E.F., Goddard T.D., Huang C.C., Couch G.S., Greenblatt D.M., Meng E.C., Ferrin T.E. UCSF Chimera—A Visualization System for Exploratory Research and Analysis. J. Comput. Chem. 2004;25:1605–1612. doi: 10.1002/jcc.20084. [DOI] [PubMed] [Google Scholar]
  • 56.Wallace A.C., Laskowski R.A., Thornton J.M. LIGPLOT: A Program to Generate Schematic Diagrams of Protein-Ligand Interactions. Protein Eng. Des. Sel. 1995;8:127–134. doi: 10.1093/protein/8.2.127. [DOI] [PubMed] [Google Scholar]
  • 57.Case D., Cerutti D., Cheateham T., Darden T., Duke R., Giese T., Gohlke H., Goetz A., Greene D., Homeyer N., et al. AMBER16 Package. Univ. Calif. San. Fr. 2016 doi: 10.13140/RG.2.2.27958.70729. [DOI] [Google Scholar]
  • 58.Case D.A., Cheatham III T.E., Darden T., Gohlke H., Luo R., Merz K.M., Jr., Onufriev A., Simmerling C., Wang B., Woods R.J. The Amber Biomolecular Simulation Programs. J. Comput. Chem. 2005;26:1668–1688. doi: 10.1002/jcc.20290. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 59.AMBER 10.0 Introductory Tutorial. [(accessed on 12 February 2021)]. Available online: http://citeseerx.ist.psu.edu/viewdoc/download?doi=10.1.1.497.2524&rep=rep1&type=pdf.
  • 60.Brice A.R., Dominy B.N. Examining Electrostatic Influences on Base-Flipping: A Comparison of TIP3P and GB Solvent Models. Commun. Comput. Phys. 2013;13:223–237. doi: 10.4208/cicp.210711.121011s. [DOI] [Google Scholar]
  • 61.Case D., Babin V., Berryman J., Betz R., Cai Q., Cerutti D., Cheatham T., III, Darden T., Duke R., Gohlke H. The FF14SB Force Field. Amber. 2014;14:29–31. [Google Scholar]
  • 62.Maier J.A., Martinez C., Kasavajhala K., Wickstrom L., Hauser K.E., Simmerling C. Ff14SB: Improving the Accuracy of Protein Side Chain and Backbone Parameters from Ff99SB. J. Chem. Theory Comput. 2015;11:3696–3713. doi: 10.1021/acs.jctc.5b00255. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 63.Kräutler V., Van Gunsteren W.F., Hünenberger P.H. A Fast SHAKE Algorithm to Solve Distance Constraint Equations for Small Molecules in Molecular Dynamics Simulations. J. Comput. Chem. 2001;22:501–508. doi: 10.1002/1096-987X(20010415)22:5<501::AID-JCC1021>3.0.CO;2-V. [DOI] [Google Scholar]
  • 64.Roe D.R., Cheatham T.E., III PTRAJ and CPPTRAJ: Software for Processing and Analysis of Molecular Dynamics Trajectory Data. J. Chem. Theory Comput. 2013;9:3084–3095. doi: 10.1021/ct400341p. [DOI] [PubMed] [Google Scholar]
  • 65.Rapin N., Lund O., Castiglione F. C-Immsim 10.1 Server. [(accessed on 12 February 2021)]. Available online: http://www.cbs.dtu.dk/services/C-ImmSim-10.1/
  • 66.Creighton T.E. Disulphide Bonds and Protein Stability. BioEssays. 1988;8:57–63. doi: 10.1002/bies.950080204. [DOI] [PubMed] [Google Scholar]
  • 67.Grote A., Hiller K., Scheer M., Münch R., Nörtemann B., Hempel D.C., Jahn D. JCat: A Novel Tool to Adapt Codon Usage of a Target Gene to Its Potential Expression Host. Nucleic Acids Res. 2005;33:W526–W531. doi: 10.1093/nar/gki376. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 68.Ali M., Pandey R.K., Khatoon N., Narula A., Mishra A., Prajapati V.K. Exploring Dengue Genome to Construct a Multi-Epitope Based Subunit Vaccine by Utilizing Immunoinformatics Approach to Battle against Dengue Infection. Sci. Rep. 2017;7:9232. doi: 10.1038/s41598-017-09199-w. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 69.Pandey R.K., Bhatt T.K., Prajapati V.K. Novel Immunoinformatics Approaches to Design Multi-Epitope Subunit Vaccine for Malaria by Investigating Anopheles Salivary Protein. Sci. Rep. 2018;8:1125. doi: 10.1038/s41598-018-19456-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 70.Shey R.A., Ghogomu S.M., Esoh K.K., Nebangwa N.D., Shintouo C.M., Nongley N.F., Asa B.F., Ngale F.N., Vanhamme L., Souopgui J. In-Silico Design of a Multi-Epitope Vaccine Candidate against Onchocerciasis and Related Filarial Diseases. Sci. Rep. 2019;9:4409. doi: 10.1038/s41598-019-40833-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 71.Chen H., Wu B., Zhang T., Jia J., Lu J., Chen Z., Ni Z., Tan T. Effect of Linker Length and Flexibility on the Clostridium Thermocellum Esterase Displayed on Bacillus Subtilis Spores. Appl. Biochem. Biotechnol. 2017;182:168–180. doi: 10.1007/s12010-016-2318-y. [DOI] [PubMed] [Google Scholar]
  • 72.Mehmood A., Kaushik A.C., Wei D. Prediction and Validation of Potent Peptides against Herpes Simplex Virus Type 1 via Immunoinformatic and Systems Biology Approach. Chem. Biol. Drug Des. 2019;94:1868–1883. doi: 10.1111/cbdd.13602. [DOI] [PubMed] [Google Scholar]
  • 73.Qamar M.T.U., Saba Ismail S.A., Mirza M.U., Abbasi S.W., Ashfaq U.A., Chen L.-L. Development of a Novel Multi-Epitope Vaccine Against Crimean-Congo Hemorrhagic Fever Virus: An Integrated Reverse Vaccinology, vaccine Informatics and Biophysics Approach. Front Immunol. 2021;12:669812. doi: 10.3389/fimmu.2021.669812. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 74.Mehmood A., Khan M.T., Kaushik A.C., Khan A.S., Irfan M., Wei D.-Q. Structural Dynamics Behind Clinical Mutants of PncA-Asp12Ala, Pro54Leu, and His57Pro of Mycobacterium Tuberculosis Associated with Pyrazinamide Resistance. Front. Bioeng. Biotechnol. 2019;7:404. doi: 10.3389/fbioe.2019.00404. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 75.Mehmood A., Kaushik A.C., Wang Q., Li C.-D., Wei D.-Q. Bringing Structural Implications and Deep Learning-Based Drug Identification for KRAS Mutants. J. Chem. Inf. Model. 2021;61:571–586. doi: 10.1021/acs.jcim.0c00488. [DOI] [PubMed] [Google Scholar]
  • 76.Bosshard H.R., Marti D.N., Jelesarov I. Protein Stabilization by Salt Bridges: Concepts, Experimental Approaches and Clarification of Some Misunderstandings. J. Mol. Recognit. 2004;17:1–16. doi: 10.1002/jmr.657. [DOI] [PubMed] [Google Scholar]
  • 77.Thomsen M., Lundegaard C., Buus S., Lund O., Nielsen M. MHCcluster, a Method for Functional Clustering of MHC Molecules. Immunogenetics. 2013;65:655–665. doi: 10.1007/s00251-013-0714-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 78.Papa A., Vaheri A., LeDuc J.W., Kruger D.H., Avsic-Zupanc T., Arikawa J., Song J.-W., Markotić A., Clement J., Liang M., et al. Meeting report: Tenth international conference on hantaviruses. Antivir. Res. 2016;133:234–241. doi: 10.1016/j.antiviral.2016.08.015. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Data Availability Statement

Not applicable.


Articles from Vaccines are provided here courtesy of Multidisciplinary Digital Publishing Institute (MDPI)

RESOURCES