Skip to main content
. Author manuscript; available in PMC: 2023 Jan 1.
Published in final edited form as: Methods Mol Biol. 2022;2405:1–37. doi: 10.1007/978-1-0716-1855-4_1

Table 11:

Hemolytic prediction of activity for LL-37 human cathelicidin peptide

Test sequence: LL-37: [LL-37, 37 aa]
Prediction results
Program used Predicted result Notes
HemoPred Hemolytic
HemoPI PROB score 0.34 (SVM (HemoPI-1) based
0.72 (SVM (HemoPI-2) based) (Hemolytic)
0.88 SVM (HemoPI-3) based) (Hemolytic)		 Note from website: PROB score is the normalized SVM score and ranges between 0 and 1, i.e. 1 very likely to be hemolytic, 0 very unlikely to be hemolytic.
HAPPENN PROB score 0.089 (Not Hemolytic) Note from website: PROB score is the normalized sigmoid score and ranges between 0 and 1. 0 is predicted to be most likely non-hemolytic, 1 is predicted to be most likely hemolytic.