Skip to main content
. Author manuscript; available in PMC: 2023 Jan 1.
Published in final edited form as: Methods Mol Biol. 2022;2405:1–37. doi: 10.1007/978-1-0716-1855-4_1

Table 9:

Hemolytic prediction of activity for LL-37 human cathelicidin peptide.

Table 9(A): Predicted Toxicity of LL-37 on ToxinPred (validated via ExPASy ProParam tool).
Peptide Sequence SVM score Prediction Hydro-phobicity Hydropathicity Amphi-pathicity Hydro-philicity Net charge pI Mol wt
[LL-37, 37 aa] −1.58 Non-toxin −0.34 −0.72 1.06 0.62 +6.0 10.61 4493.32
Table 9(B): Experimental cytotoxicity activity of human cathelicidin LL-37
Peptide Cell Line Assay Result Ref
LL-37 A549 MTT Not cytotoxic up to 50 μg/mL [130]
Scrambled LL-37 A549 MTT Not cytotoxic up to 50 μg/mL [130]
LL-37 A431 squamous cell carcinoma cells MTT Cytotoxic at 20 μg/mL. Not toxic at 5 μg/mL. [131]
LL-37 pMSC MTT No toxicity up to 10 μg/mL. [132]
LL-37 MA-104 MTT, Neutral red Statistically significant cytotoxicity (>10%) observed 20–50 μg/mL. [133]
LL-37 Thermally wounded human skin equivalents (HSE) MTT No cytotoxicity at up to 200 μg/model [134]