Table 9:
Hemolytic prediction of activity for LL-37 human cathelicidin peptide.
| Peptide Sequence | SVM score | Prediction | Hydro-phobicity | Hydropathicity | Amphi-pathicity | Hydro-philicity | Net charge | pI | Mol wt |
|---|---|---|---|---|---|---|---|---|---|
| [LL-37, 37 aa] | −1.58 | Non-toxin | −0.34 | −0.72 | 1.06 | 0.62 | +6.0 | 10.61 | 4493.32 |
| Peptide | Cell Line | Assay | Result | Ref |
|---|---|---|---|---|
| LL-37 | A549 | MTT | Not cytotoxic up to 50 μg/mL | [130] |
| Scrambled LL-37 | A549 | MTT | Not cytotoxic up to 50 μg/mL | [130] |
| LL-37 | A431 squamous cell carcinoma cells | MTT | Cytotoxic at 20 μg/mL. Not toxic at 5 μg/mL. | [131] |
| LL-37 | pMSC | MTT | No toxicity up to 10 μg/mL. | [132] |
| LL-37 | MA-104 | MTT, Neutral red | Statistically significant cytotoxicity (>10%) observed 20–50 μg/mL. | [133] |
| LL-37 | Thermally wounded human skin equivalents (HSE) | MTT | No cytotoxicity at up to 200 μg/model | [134] |