Figure - PMC

Skip to main content

An official website of the United States government

Here's how you know

Here's how you know

Official websites use .gov
A .gov website belongs to an official government organization in the United States.

Secure .gov websites use HTTPS
A lock ( ) or https:// means you've safely connected to the .gov website. Share sensitive information only on official, secure websites.

View full-text article in PMC

. 2022 Jun 13;12:9723. doi: 10.1038/s41598-022-13839-1

Search in PMC
Search in PubMed
View in NLM Catalog
Add to search

© The Author(s) 2022

Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/.

PMC Copyright notice

Production of rGA733-Fc and h-Fc expressing transgenic tomato. Transgenic tomato plants producing rGA733-Fc or h-Fc protein were produced using the Agrobacterium-mediated transformation method with pBINPLUS-GA733-Fc or pBINPLUS-h-Fc plant expression vectors. (a) The schematic diagram of pBINPLUS-GA733-Fc and pBINPLUS-h-Fc vectors. p35S, cauliflower mosaic virus 35S promoter; UTR, 5′ UTR from the tobacco etch virus; SP, 30-aa plant ER signal peptide (MATQRRANPSSLHLITVFSLLAAVVSAEVD); KDEL, endoplasmic reticulum (ER) retention motif; t35S, cauliflower mosaic virus 35S terminator; NPT II, neomycin phosphotransferase II. (b) The transgenic plants were screened by PCR amplification of the expression cassettes. (c) Protein expression levels were determined by ELISA analysis with AP-conjugated goat anti-human IgG. Data represent mean + standard deviation (N = 3). (d) Western blot analysis with the GA733-2 specific antibody using leaves of the transgenic plants.