Skip to main content
. 2022 Jun 18;23(12):6803. doi: 10.3390/ijms23126803

Figure 2.

Figure 2

Reactivity of mouse bleeds to peptides used for immunisation tested in enzyme-linked immunosorbent assay. Fourth collection of mouse bleeds were tested for antibody reactivity to peptides 1–3: (a) Four mice (1a–d) were immunised with peptide 1 (CRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA), and the collected samples were tested for reactivity to peptides 1–3. (b) Four mice (2a–d) were immunised with peptide 2 (CREACLQGWTEA), and bleeds were tested for reactivity to peptides 1–3. (c) Four mice (3a–d) were immunised with peptide 3 (CLQGWTEA), and bleeds were tested for reactivity to peptides 1–3. Absorbances were corrected for background reactivity by subtracting reactivity from non-coated wells.