Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
Identification of the carbamylated peptide on PON-1 by nanoLC-MS/MS analysis. The peptide peak of 1125.5 m/z ([M+3H]3+) was identified as peptide sequence of SLDFNTLVDNISVDPETGDLWVGCHPNGMK with modifications at C284 (carbamidomethylation), N287 (deamidation) and K290 (carbamylation) with Mascot ion score of 52.4. K represents lysine.
