Table 1.

Tested antimicrobial peptides.

Name	Sequence	Residues	Net Charge[a]	GRAVY[b]	Species	PTMs	Antibacterial[c]	Hemolytic
Delta‐lysin[ 67 , 68 ]	MAADIISTIGDLVKWIIDTVNKFK	24	0	0.58	S. epidermidis	–	+	+
PepG1[ 69 , 70 ]	MLVTLSAMLQFGIFLIAFIGLVIDLIKLSQKK	32	+2	1.65	S. aureus	–	+	+
Ascaphin‐6 [74]	MGFKDWIKGAAKKLIKTVASSIANE	25	+3	−0.10	A. truei	–	+	–
Cecropin P1 [75]	SWLSKTAKKLENSAKKRISEGIAIAIQGGPR	31	+5	−0.56	A. suum	–	+	–
Oxyopinin 2 b [76]	MSYIPCGESCVYIPCTVTALLGCSCSNKVCYKN	33	+7	−0.46	O. kitabensis	–	+	+
Meucin‐25 [77]	MVKLIQIRIWIQYVTVLQMFSMKTKQ	26	+4	0.40	M. eupeus	–	–	–
Cathelicidin‐BF [78]	KRFKKFFKKLKKSVKKRAKKFFKKPRVIGVSIPF	34	+16	−0.75	B. fasciatus	–	+	–

[a] At pH=7. [b] Grand average of hydropathicity index (GRAVY), calculated as the average Kyte and Doolitle hydropathy index of each residue over the full sequence. [c] Against Gram‐negative bacteria.