Table 4.
List of Nt-peptides matched to an NTR entry
| Accession | Start end | Sequence | Enzyme | Mod. | Conf. | Isoforms | Transcript info | Protein length | Prec. amino acid | # |
|---|---|---|---|---|---|---|---|---|---|---|
| ENST00000543961_12_25803373_ntr_100db1 | 1–36 | MAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGR | Chymo | Heavy acetyl | High | ENST00000544060_12_103976970_ntr_100db1 (1–36) | Thymine–DNA glycosylase pseudogene 1, processed pseudogene | 82 | 1 | |
| ENST00000439303_10_10174230_ntr_100db1 | 1–33 | MDGEEKTCGGCEGPDAMYVKLISSDGHEFIVKR | Trypsin | Heavy acetyl | High | Elongin C pseudogene 3, processed pseudogene | 115 | 2 | ||
| ENST00000486575_22_20127011_ntr_100db1 | 1–13 | MKEETKEDAEEKQ | Chymo Trypsin |
Heavy acetyl | High | RAN-binding protein 1, retained intron | 13 | 2 | ||
| ENST00000458332_17_19446852_ntr_111db1 | 2–29 | ADDAGAAGGPGGPGGPEMGNRGGFRGGF | GluC | Cotransl. acetyl | High | Ribosomal protein S2 pseudogene 46, processed pseudogene | 88 | M | 1 | |
| ENST00000454707_6_5972475_ntr_100db1 | 2–9 | ADTFLEHM | Trypsin | Cotransl. acetyl | High | ENST00000564276_15_72219034_ntr_001db3 (2–9) | Pyruvate kinase M1/2 pseudogene 5, processed pseudogene | 157 | M | 2 |
| ENST00000216019_22_38506168_ntr_100db1 | 2–37 | ASATGDSASERESAAPAAAPTAEAPPPSVVTRPEPQ | Chymo | Cotransl. acetyl | High | DEAD-box helicase 17, retained intron | 463 | M | 3 | |
| ENST00000556323_14_92026617_ntr_100db1 | 2–19 | EKKEVVEEAENGRDAPAD | Chymo, Trypsin |
Heavy acetyl | High | Prothymosin alpha pseudogene, processed pseudogene | 56 | M | 13 | |
| ENST00000498385_22_23894847_ntr_001db3 | 2–16 | HSIGKIGGAQNRSYS | GluC | Heavy acetyl | High | Macrophage migration inhibitory factor, retained intron | 54 | M | 2 | |
| ENST00000415278_1_96448241_ntr_001db3 | 2–13 | KAVDKKAAGAGK | GluC | Heavy acetyl | High | Eukaryotic translation elongation factor 1 alpha 1 pseudogene 11, processed pseudogene | 25 | M | 1 | |
| ENST00000586518_17_75779096_ntr_010db2 | 2–14 | KSAPSTGGVKKPH | Chymo | Heavy acetyl | High | H3.3 histone B, retained intron | 17 | M | 2 | |
| ENST00000478033_1_159918889_ntr_100db1 | 2–23 | NVIGLQMGTNRGASQAGMTGYG | GluC | Cotransl. acetyl | High | Transgelin 2, processed transcript | 29 | M | 1 | |
| ENST00000569492_16_35803171_ntr_100db1 | 2–21 | RKAEGDAKGDKAKVKDEPQR | Chymo | Heavy acetyl | High | High mobility group nucleosomal binding domain 2 pseudogene 41, processed pseudogene | 81 | M | 1 | |
| ENST00000555320_14_80822530_ntr_010db2 | 2–17 | RKAEGDAKGDKAKVKD | Chymo | Heavy acetyl | High | ENST00000569492_16_35803171_ntr_100db1 (2–17) | High mobility group nucleosomal binding domain 2 pseudogene, processed pseudogene | 88 | M | 1 |
| ENST00000556323_14_92026566_ntr_100db1 | 2–36 | SDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPAD | Chymo Trypsin |
Cotransl. acetyl | High | Prothymosin alpha pseudogene, processed pseudogene | 73 | M | 43 | |
| ENST00000582213_17_7572835_ntr_100db1 | 9–31 | FPSNWNEIVDSFDDMNLSESLLR | Trypsin | Cotransl. acetyl | Low | Eukaryotic translation initiation factor 4A1, retained intron | 148 | G | 1 | |
| ENST00000403258_6_88276364_ntr_101db1 | 12–22 | MASAASSSSLE | GluC | Cotransl. acetyl | High | ACTB pseudogene 8, processed pseudogene | 146 | E | 1 | |
| ENST00000402643_6_166064725_ntr_111db1 | 64–83 | ASTGTAKAVGKVIPELNGKL | Chymo | Cotransl. acetyl | Low | ENST00000402643_6_166064722_ntr_001db3 (65–84) ENST00000402643_6_166064704_ntr_100db1 (71–90) ENST00000402643_6_166064650_ntr_110db1 (89–108) ENST00000402643_6_166064509_ntr_010db2 (136–155) |
Glyceraldehyde-3-phosphate dehydrogenase pseudogene 72, Transcribed processed pseudogene | 125 | P | 3 |
| ENST00000530835_11_90283408_ntr_011db2 | 70–88 | GDVVPKDANAAIATIKTKR | Trypsin | Cotransl. acetyl | Low | ENST00000530835_11_90283141_ntr_001db3 (159–177) ENST00000530835_11_90283060_ntr_001db3 (186–204) ENST00000530835_11_90283018_ntr_001db3 (200–218) ENST00000530835_11_90283009_ntr_101db1 (203–221) ENST00000530835_11_90283006_ntr_010db2 (204–222) ENST00000530835_11_90282775_ntr_001db3 (281–299) ENST00000530835_11_90282763_ntr_010db2 (285–303) ENST00000530835_11_90282676_ntr_100db1 (314–332) |
Tubulin alpha pseudogene 2, processed pseudogene | 124 | H | 7 |
| ENST00000530835_11_90283408_ntr_011db2 | 74 88 |
PKDANAAIATIKTKR | Trypsin | Cotransl. acetyl | Low | ENST00000530835_11_90283141_ntr_001db3 (163–177) ENST00000530835_11_90283060_ntr_001db3 (190–204) ENST00000530835_11_90283018_ntr_001db3 (204–218) ENST00000530835_11_90283009_ntr_101db1 (207–221) ENST00000530835_11_90283006_ntr_010db2 (208–222) ENST00000530835_11_90282775_ntr_001db3 (285–299) ENST00000530835_11_90282763_ntr_010db2 (289–303) ENST00000530835_11_90282676_ntr_100db1 (318–332) |
Tubulin alpha pseudogene 2, processed pseudogene | 124 | F | 7 |
This table lists all Nt-peptides that were identified and matched to an NTR protein. For each peptide, the accession (a detailed explanation of the information contained in the accessions from Ensembl can be found in the Experimental procedures section), the start and end positions, the sequence, the enzyme (this indicates by which protease the peptide was detected), modification (“Mod.,” which indicates the modification found on the protein’s N terminus), the confidence level assigned to the peptides (“Conf.,” which is either high or low [see main text]), isoform column, transcript information, protein length, “Prec. AA,” which indicates the preceding AA, and the spectral counts (#) are listed.