Abstract
Cell-penetrating peptides (CPPs) have been discovered to deliver chemical drugs, nucleic acids, and macromolecules to permeate cell membranes, creating a novel route for exogenous substances to enter cells. Up until now, various sequence structures and fundamental action mechanisms of CPPs have been established. Among them, arginine-rich peptides with unique cell penetration properties have attracted substantial scientific attention. Due to the positively charged essential amino acids of the arginine-rich peptides, they can interact with negatively charged drug molecules and cell membranes through non-covalent interaction, including electrostatic interactions. Significantly, the sequence design and the penetrating mechanisms are critical. In this brief synopsis, we summarize the transmembrane processes and mechanisms of arginine-rich peptides; and outline the relationship between the function of arginine-rich peptides and the number of arginine residues, arginine optical isomers, primary sequence, secondary and ternary structures, etc. Taking advantage of the penetration ability, biomedical applications of arginine-rich peptides have been refreshed, including drug/RNA delivery systems, biosensors, and blood-brain barrier (BBB) penetration. Understanding the membrane internalization mechanisms and design strategies of CPPs will expand their potential applications in clinical trials.
Keywords: CPPs, arginine-rich peptide, non-covalent interaction, mechanism of internalization, peptide design, biomedical applications
1. Introduction
Cellular uptake of biologically active molecules is a significant obstacle to developing drug design and controlled drug delivery. For instance, it is hard for the monoclonal antibodies to penetrate the cell membrane and enter the cell due to their large molecular weight. Hence, they are limited to being used to identify and target secretory protein targets on the cell surface. However, the application of monoclonal antibodies is severely constrained by the fact that many potential targets for disease therapy are located inside cells. In addition, emerging therapeutic technologies such as gene therapy also need to address the issue of cellular uptake of nucleic acids (DNA, RNA) and other biomolecules. Viral vectors [1,2,3], and methods such as electroporation, microinjection, and liposome encapsulation [4,5,6,7,8,9], have successfully delivered a wide range of therapeutic agents, including proteins, peptides, and oligonucleotides, to target cells. Still, these methods have certain shortcomings, including inefficient drug delivery, cellular toxicity, poor specificity, etc. Against this backdrop, cell-penetrating peptides (CPPs) are coming into view as promising candidates for drug delivery applications [10,11,12,13]. CPPs are a class of small molecules with strong membrane permeability, which can carry peptides, proteins, nucleic acids, and other macromolecules into cells, opening a new pathway for exogenous substances to enter cells. As a typical kind of CPP, the cationic peptide is distinguished by the presence of basic amino acids such as arginine (Arg) and lysine (Lys) [14]. The essential amino acids are positively charged in physiological pH; thus, they can interact with negatively charged drug molecules and cell membranes through non-covalent interaction, including electrostatic interactions [15].
Of all the cell-penetrating peptides, arginine-rich peptides have attracted the most scientific attention as cationic peptides [16,17,18,19]. Examples include the first discovered membrane penetrating peptide, Tat, a typical arginine-rich membrane penetrating peptide. Human immunodeficiency virus type 1 (HIV-1) Tat protein, secreted from infected cells, can deliver several proteins, including ovalbumin, β-galactosidase, and horseradish peroxidase into cells [20,21,22]. The primary domain in Tat protein responsible for crossing the plasma membrane, the protein transduction domain (PTD), is rich in arginine and lysine residues. Jin et al. [23], Know et al. [24], and Nagahara et al. [25] verified that the protein could serve as a carrier to direct the uptake of heterologous proteins into cells by generating genetic in-frame PTD fusion proteins. Moreover, Park et al., showed that the smallest structural domain of the Tat protein that acted as a membrane penetrator was the amino acid sequence at positions 49–57 (residues 49–57: RKKRRQRRR), which was a 9-amino acid sequence containing 6 arginines [26].
Numerous investigations have been conducted to investigate how CPPs transport substances into cells. The two primary recognized cellular uptake mechanisms are endocytosis and the pore formation model. [13,27,28,29,30,31,32,33,34,35] (Figure 1A). The ratio between endocytosis and direct cell entry is critical in the cellular uptake of cell-penetrating peptides, and the modification of the CPPs will affect the ratio between endocytosis and direct translocation. While the mechanisms of how the modification affects the ratio and the effect of the following details have not been fully understood, Zhang et al. [36] speculated that the positively charged arginine on the periphery of the NP1 peptides could greatly facilitate their direct translocation through the negatively charged plasma membrane via electrostatic interaction instead of via endocytosis, which provides a more efficient uptake pathway. On the other hand, the arginine and lysine residues also significantly impact the transmembrane function of cationic CPPs [14]. However, there are several hypotheses about the involvement of arginine and lysine in membrane penetration. In this review, we highlight the role of arginine residues in the arginine-rich CPPs and the effects of arginine-rich peptide structural alterations on their functions. Moreover, we provide an update on the progress of arginine-rich peptides in biological applications. By elucidating the function of arginine in CPPs or the structure of transmembrane efficiency, this arginine-rich delivery platform could be made even more specialized by applying logical design to meet the desired biological applications.
2. Cell-Surface Interactions on Arginine-Rich CPPs Allow for Internalization
2.1. Binding to Anionic Groups to Promote Uptake
2.1.1. Binding to Phosphate Anionic Groups
Numerous studies have highlighted that guanidinium-rich arginine is essential for cellular uptake. Since arginine-rich peptides preferentially bind to negatively charged molecules, the cell membrane penetration is assumed to initiate by binding to various anionic groups via non-covalent interaction, such as phosphates, carboxylates, and sulfates (shown in Figure 1B), on cell surfaces [37]. In the early work of Wender et al., the function of multiple guanidine groups in arginine-rich CPPs in membrane penetration was summarized: the guanidine group of arginine formed a bidentate bond with negative phosphates, sulfates, and carboxylates on the cell surface, and the charge-neutralized species were driven into the cell by the membrane potential [17,38] (Figure 1C). The transmembrane mechanism of arginine-rich CPPs was further investigated in the following decades.
For an exploration of the phosphates-related membrane penetration mechanism of arginine-rich CPPs, HIV Tat (48–60), a solid-state NMR technique, was applied. The results suggested that Tat was inserted into the glycerol backbone region of the membrane-water interface in anionic lipid bilayers and generated transient membrane defects, which relied on transient interactions between the arginine side chains and lipid phosphates [39] (as shown in Figure 1D). In another study, Chen et al. [43] found that steady-state water holes occurred when the guanidinium groups in the arginine-rich Tat associated with the phosphate moieties on the lipid headgroups, and Arg residues pulled down water molecules in the membrane to stabilize the insertion. Meanwhile, bidentate hydrogen bonding involving Arg residues with the lipid phosphate groups was observed in the study of Jobin et al. [44]; the non-covalent interaction could induce invagination phenomena and contribute to tubulation and internal vesicle formation.
2.1.2. Binding to Carboxylate Anionic Groups
Binding to carboxylates is also a common way of promoting the membrane penetration of the arginine-rich CPPs. In the study of Herce et al., an efficient energy-independent translocation mechanism for arginine-rich molecules was revealed [40]. A transient membrane channel was formed when the cell exterior guanidine groups were attracted and bound to the deprotonated fatty acids on the membrane. In the crossing process of the peptide−fatty acid complex, the protons from the cytosolic side competed for the binding of the guanidinium groups to fatty acids, and the high density of protons in the cytosol protonated the fatty acids, which resulted in the release of the peptide into the cytosol (shown in Figure 1E).
2.1.3. Binding to Sulfate Anionic Groups
As described above, sulfate is also one kind of critical anionic group binding to the arginine-rich peptides. Sulfated glycosaminoglycans (GAGs), such as heparan sulfate and chondroitin sulfate localized on cell membranes, are covalently linked to core proteins at the cell surface [18,27,41,45,46,47]. Real-time in-cell NMR spectroscopy was applied to investigate the direct membrane translocation of 19F-labeled octaarginine (R8) into living cells in the work of Takechi-Haraya et al., and they found that arginine-rich 19F-R8 entered hydrophobic cell membrane after binding to GAGs [41] (Figure 1F). In the authors’ opinion, the process of the membrane penetration of 19F-R8 was non-endocytic and energy-independent. One possibility was that the charge neutralization of polyarginine with GAGs induced insoluble and energetically unstable peptide-GAG complexes, which led to the dissociation of 19F-R8 from GAGs to water or rapidly transferred to the cell membrane. In another study, Takechi-Haraya et al., investigated several arginine-rich peptides of Tat, R8, and Rev, with heparin as a GAG model; they found that the beneficial electrostatic interaction between arginine residues of peptide and anionic sulfate/carboxyl groups of heparin contributed to the favorable enthalpy gain, which served as an energy source to facilitate their cell penetration [48]. On the other hand, several studies have proven that GAG cross-linking has been associated with the activation of signaling pathways that result in endocytosis [49,50,51]. Zuconelli et al., investigated the role of calcium in direct cytosolic uptake of two arginine-rich peptides, nona-L- and D-arginine. They indicated that the calcium channel Orai1 played a decisive role in triggering rapid uptake of the peptides [52].
Binding to negatively charged heparan sulfates (HS) at the cell surface is considered the first step in the internalization of CPPs. Wallbrecher et al., investigated a collection of the lactoferrin-derived CPPs with respect to HS binding and uptake; the study demonstrated that the guanidine groups in arginine could form bidentate hydrogen bonds with negatively charged heparan sulfates, and the cross-linking of HS was the driving force for the uptake of arginine-rich CPPs [42] (Figure 1G). Interestingly, peptides with a low stoichiometry had a higher capacity to cross-link HS, which did not hold for other classes of CPPs [53]. Ikuhiko [54] found that the arginine-rich peptides led to the activation of small G-protein Rac1 and reorganization of actin (lamellipodia and membrane ruffling), which improved the cellular uptake of the peptides and their cytosolic translocation. In another study by Kawaguchi et al., syndecan-4, one of the heparan sulfate proteoglycans, was demonstrated to be a primary cell-surface receptor involved in the endocytosis of the octa-arginine (R8) peptide [51].
2.2. Participate in Membrane Penetration by Partitioning the Lipid Glycerol Regions
Besides binding to the anionic groups on cell surfaces, the guanidine group participates in membrane penetration by partitioning the lipid glycerol regions. According to widespread consensus, arginine-rich CPPs are extremely cationic and hydrophilic; their guanidine groups create ion and hydrogen interactions with lipid head groups to assist membrane binding. During the membrane translocation of the CPPs, the peptide backbone must pass through the lipid core region. Hydrophobic interactions between the lipid core and fewer hydrophilic peptide backbones could lead to translocation due to poorly hydrophilic methylene groups in the side chains of arginine and the peptide backbone. Umbrella sampling simulations were used in the study of Sun et al. [55]; the arginine-rich peptide octa-arginine (R8) was found to expand the surface area of the lipid bilayer due to the deep partitioning of guanidinium ions into the lipid glycerol regions. Meanwhile, R8 was also found to extend the lifetime of the transient membrane pore due to inserting an arginine side chain into the existing pore. The study demonstrated that the arginine-rich peptide was essential in membrane pore formation and lifetimes. In addition, the study of Pourmousa et al. [56] demonstrated that H-bonds and charge-pair interactions between the bilayer and arginines and lysines were the critical interactions in the binding mode of penetrating and helped charged residues to localize in the hydrophobic region of the bilayer.
3. Peptide Design of the Arginine-Rich CPPs
3.1. Primary Sequence Design of the Arginine-Rich CPPs
3.1.1. Number of Arginine Residues in the Peptide Sequences
As mentioned above, arginine plays an essential role in the functional performance of delivery peptides, and the number of arginine residues in the peptide sequences affects the intracellular delivery efficiency of the arginine-rich CPPs. Previous studies revealed that peptides with 7−15 arginine residues had the most efficient cellular uptake [57,58,59], and the following works of Nakase et al. [60] and Kosuge et al. [58] proved that point. In their study, oligoarginine peptides with different numbers of arginine residues (Rn: n = 4, 8, 12, 16) were used to modify the extracellular vesicles (Figure 2A). The results indicated that the cellular uptake and cytosolic release efficiency were strongly affected by the number of arginine residues and that the conjugation of R8-EVs or R12-EVs resulted in the highest cellular uptake of all the oligoarginine-peptide conjugations. The efficiency decreased when the number of arginines came to 16, which means that the number of arginines was not the more, the better. Dafeng et al. [61] and Dong-Wook et al. [62] demonstrated that longer oligoarginines had a more remarkable ability to aggregate siRNA than shorter oligoarginines. In another study, Naggar et al., revealed that dfR6, dfR7, and dfR8 displayed more robust cytosolic penetration and nucleolar staining compared with dfR4 and dfR5, which once again illustrated that the number of arginine residues was important to the performance of CPPs [63].
3.1.2. Arginine Optical Isomers in the Peptide Sequence
Isomer is another factor affecting the function of CPPs [10,64,65,66,67,68]; a different number of arginine optical isomers in the peptide sequence are proved to affect the uptake efficiency of the delivery peptides. Verdurmen et al. [69] firstly reported the differences in the uptake of L-CPPs (R9) and their D-counterparts (r9); the results demonstrated that cationic L-CPPs (R9) were taken up more efficiently than their D-counterparts (r9) in MC57 fibrosarcoma and HeLa cells but not in Jurkat T leukemia cells (the sequences of the peptides were shown in Table 1). For further and comprehensive research of the D- and L-arginine residues in CPPs, Ma et al. [70] developed a series of novel chimeras consisting of various numbers of D- and L-arginine residues. The results demonstrated that the number of D-Arg residues in the CPPs significantly affected their cellular uptake behaviors (Hela, HEK293, RAW264.7, and EL4 cells were used in the study). When there were fewer than 3 D-Arg residues in the peptide backbone, increasing the number of D-Arg residues resulted in a diffuse cytosolic peptide distribution at low concentrations and higher uptake efficiency [R8, rR7, (rR)2R4, and (rR)3R2]. The further replacement of L-Arg residues with D-Arg residues did not significantly affect the intracellular distributions when there were more than 3 D-Arg residues [(rR)3R2, (rR)4, r2(rR)3, and r8]. Moreover, the uptake efficiencies of the octa-arginines containing 3 or more D-Arg residues [(rR)3R2, (rR)4 and r2(rR)3] were comparable to that of r8 and much better than that of R8. Interestingly, Behzadi et al. [71] explored the selectivity and cellular uptake of HHC36, a Trp/Arg-rich nonapeptide, and its D-enantiomer ((all D)HHC36). The results unraveled that the D-handedness-selective toxicity of the Trp/Arg-rich sequence was associated with the cell type.
Table 1.
Name | Sequences | Reference |
---|---|---|
Tat protein (residues 49–57) |
RKKRRQRRR | [26] |
R9 | RRRRRRRRR | [69] |
r9 | rrrrrrrrr | [69] |
R8 | RRRRRRRR | [70] |
rR7 | rRRRRRRR | [70] |
(rR)2R4 | rRrRRRRR | [70] |
(rR)3R2 | rRrRrRRR | [70] |
(rR)4 | rRrRrRrR | [70] |
r2(rR)3 | rrrRrRrR | [70] |
r8 | rrrrrrrr | [70] |
W1 | LLWRLWRLLWRLRLL | [71] |
W5 | LLRLLRWWWRLLRLL | [71] |
W1-4R | RLLWRLWLWRLLR | [71] |
W5-4R | RLLRLLWWWLLRLLR | [71] |
CLr | RLLrLLR, | [72] |
CL | RLLRLLR | [72] |
A2-17 | LRKLRKRLLRLWKLRKR | [73] |
NP1 | stearyl-HHHHHHHHHHHHHHHH-RRRRRRRR-NH2 | [36,74] |
599 peptides | GLFEAIEGFIENGWEGMIDGWYGGGGRRRRRRRRRK | [75] |
RR-22 | Ac-RGDGPLGLAGI3GR8-NH2 | [76] |
SynB1 | RGGRLSYSRRRFSTSTGR | [77] |
R23F | RKKRRQRRRGGSarGVVVHI-Asi-GGKF-NH2 | [78] |
R23DI | RKKRRQRRRGGSarGLTQFGAFIDI-NH2 | [78] |
R23EI | RKKRRQRRRGGSarGVQGLVHISEI-NH2 | [78] |
Note: R = L-arginine; r = D-arginine.
3.1.3. Position of the Arginine Residues in the Primary Sequence
The amino acid sequence on the primary structure and the aggregated three-dimensional conformation on the secondary structure both significantly impact the arginine function. As aforementioned, the number of arginine residues in the peptide sequences affect the intracellular delivery efficiency of the arginine-rich peptide. When the amount of arginine remains the same, but only the position of the arginine amino acids in the sequence is changed, will the function of the arginine-rich CPP change? The work of Konate et al. [79] revealed the answers for us. To maintain the same charge number as the parental peptides, they created peptides with two more arginine residues at both ends but two fewer arginine residues in the middle of the sequence (Arg = 4 for W1, W5, W1-4R, and W5-4R). The peptides showed significant differences in stability, the ability to form peptide-based nanoparticles and luciferase silencing activity. The peptides with the 5-residue consensus motif, LRLLR at positions 5–9, were created and compared in work by Fuselier et al. [80]. The results suggested that multiple primary sequences of leucine and arginine could support spontaneous membrane translocation, and sequence context was necessary for the function of the peptides.
3.2. Secondary Structure of the Arginine-Rich CPPs
A stable helical structure of the arginine-rich peptide is necessary for their cell-penetrating abilities [81,82], causing the formation of the α-helical structure to decrease the polarity and the free energy cost of transfer to the hydrophobic membranes for peptide bonds in the peptide molecule [83]. To gain insight into the significance of α-helix formation for transcellular cargo delivery, Komin et al. [72] designed a peptide (RLLrLLR, CLr) with the same sequence as the CL peptide (RLLRLLR). Still, it could not form an alpha helix, and the results showed that the peptide with α-helix formation had a higher transcellular transport capacity even though they had the same sequence. To study the effect of arginine residues on the cell-penetrating ability caused by secondary structure changing, Ohgita et al. [73] designed a novel CPP, A2-17 (LRKLRKRLLRLWKLRKR). A2-17 had a lower amount of arginine but a higher cell penetration effectiveness than a typical arginine-rich CPP, Rev (TRQARRNRRRRWRERQR), which could be attributed to the creation of an amphipathic α-helix and an increase in amphipathicity of A2. The circumferential distribution of arginine residues in Rev. interfered with the development of the -helix after binding to lipid membranes. In amphipathic A2-17, however, such charge repulsion from arginine residues could be offset by the free energy reduction following lipid binding [84], facilitating the transfer of peptides from GAGs to lipid membranes and boosting membrane penetration efficiency. The work of Yamashita et al., also confirmed the importance of the α-helical structure to the efficiency of cell penetration using a cationic cyclic α, α-disubstituted a-amino acids: ApiC2Gu (which possessed an arginine mimic side chain). They found that the peptide containing ApiC2Gu formed a stable α-helical structure and was more effective at penetrating cells than the nonhelical Arg nonapeptide (R9) [85]. Moreover, Chen et al. [86] found that contributing to the helical structure formed by the positive charge of arginine residues in one face of the structure and the anionic component in siRNA, the peptide-siRNA complex had a better interaction with cell membranes, and the cellular internalization was enhanced. As mentioned above, GAGs played a crucial role in the cellular uptake of cationic CPPs; Neree et al. [87] found that an α-helix was a crucial step for GAGs-mediated endocytosis of pituitary adenylate cyclase-activating polypeptide (PACAP, its sequence and structure were shown in Figure 2B), which indicated that the uptake efficiency of a given cationic CPP was not only correlated to its ability to bind to or cluster GAGs but also affected by the peptide conformation.
3.3. Ternary Structure of the Arginine-Rich Peptides
It was previously demonstrated that the cytotoxicity of high concentrations of CPPs, as well as the breakdown of CPPs by proteases during cargo transport, hampered the development of effective CPPs. While reducing the length of CPPs appeared to be a viable way to lessen peptide toxicity, restricting the number of charges (below eight) reduced the transmembrane efficiency of CPPs [88]. Based on this background, a method combining very short CPP sequences and collagen-like folding domains was designed [89]. The CPP domains (RRRRRR or RRGRRG) and multiple proline-hydroxyproline-glycine (POG [proline-hydroxyproline-glycine])n were combined to form a collagen-like triple-helical conformation (shown in Figure 2C). The folded peptides with CPP domains had low cytotoxicity and higher stability to enzymatic degradation while retaining high membrane penetration efficiency. From the above study, we could see that it was conducive to increasing the peptide chain length and improving the resistance of the peptides to enzymatic degradation by constructing CPPs with folding domains. The study of Oba et al., further supported this conclusion [90]. They prepared alpha-Aminoisobutyric acid (Aib) CPP foldamers (Arg-Arg-Aib)(n) (n = 1–6) for pDNA transfection, and the results showed that longer peptides (n ≥ 4) exhibited better transfection abilities than an Arg nonapeptide. Furthermore, Aib CPP foldamers demonstrated better transfection abilities attributable to the high resistance of the peptides to enzymatic degradation. Besides folding domains, other designs of the CPPs were proved to have excellent delivery efficiency. Yoo et al., designed a branched poly-CPP structure (Figure 2D) of nona-arginine (mR9) and synthesized a branched-mR9 (B-mR9) using disulfide bonds to deliver nucleic acid molecules [91]. The branched structures improved the transfection capability owing to the strong electrostatic attraction between DNA and siRNA molecules. In addition, the branched-mR9 exhibited less cytotoxicity compared to conventional CPPs.
3.4. Modification of the Arginine-Rich CPPs
3.4.1. Improve the Transmembrane Capacities of Arginine-Rich CPPs via Hydrophobic Elements
Commonly, the cationic arginine-rich CPPs are non-amphipathic; when they are covalently or non-covalently associated with hydrophobic hydrocarbon moieties, the physicochemical properties of the cationic CPPs will be dramatically changed by these hydrophobic entities. The addition of a hydrophobic counterpart makes the CPPs become primary amphipathic molecules (their primary structures contain well-defined cationic and hydrophobic domains), which increases their affinity for neutral or weakly anionic membrane bilayers because they can interact both with the phosphate groups of the phospholipids (PLs) and with the hydrophobic core of the membrane bilayer [92,93,94], and then penetrate the bilayer inducing phase separation, permeabilization, and disruption of the membrane [95] (Figure 2E). Interestingly, the addition of a single hydrophobic residue to an Arg-rich peptide could drastically modify the translocation mechanism [96]. It might be relevant to the participation of these hydrophobic counterparts in the formation of inverted micelles. In other studies [97,98], amphiphilic counteranions (pyrenebutyrate counteranion, PyB) were found to have the ability to promote the internalization of arginine-rich CPPs. The presence of PyB induced the disruption of liquid-ordered domains, which enhanced the overall fluidity of the membrane [99] and improved the translocation ability of oligoarginines. Noteworthy, the hydrophobic component could be introduced by using unnatural amino acids; the arginine-rich CPPs with the structure of (Arg-X-Arg)n were designed. The insertion of 6-aminohexanoic acid (Ahx) improved the delivery efficiency of nucleic acids and the metabolic stability of a designed CPP, stearylated (Arg-Ahx-Arg)4 [100]. Futaki et al. [101] found that the attachment of a series of penetration accelerating sequences (Pas), especially phenylalanine (Phe) residues, could enhance the cellular uptake of arginine-rich CPPs, R8. As we mentioned above, the addition of Phe residues increased the hydrophobicity of the CPPs and thus its affinity for membranes. Moreover, the addition of Phe residues might affect the actin rearrangement and membrane ruffling, inducing a higher ability of micropinocytosis. Meanwhile, the attachment of Phe residues might further increase peptide−proteoglycan interactions, resulting in increased stimulation of micropinocytosis and the partition of peptides into membranes.
Acylation was proved an efficient way to improve the cell-penetrating properties of the arginine-rich peptides. The study of Oh et al. [102] demonstrated that a combination of acylation by long chain fatty acids and cyclization on short arginine-containing peptides could improve their cell-penetrating property, possibly through efficient interaction of rigid positively charged R and hydrophobic dodecanoyl moiety with the corresponding residues in the cell membrane phospholipids. On the other hand, the study of Swiecicki et al., also proved that the unsaturated acyl chain promoted the short oligo-arginine lipopeptide membrane translocation and endocytosis [103].
In recent research, 4-(dimethylaminoazo) benzene-4-carboxylic acid (DABCYL) was used as a new kind of modification because of its structural simplicity, availability along with hydrophobicity, which could assist cell permeability. It has been demonstrated that utilizing the DABCYL group to modify arginine-rich CPPs effectively increases cellular uptake efficacy [104,105,106].
3.4.2. Modification of the Arginine-Rich Peptides via Other Amino Acids
In the arginine-rich CPPs, arginine residues play a critical role in the structure and function of the peptides. In addition, other amino acid residues can also affect the delivery efficiency of the CPPs. In the study of Zhang et al. [36,74], histidine with an imidazole side chain served as a hydrogen donor or acceptor. This property of pH-dependent hydrogen bonding (or positively charged) was used to design a self-assembly/disassembly pH-triggered peptide (NP1, stearyl-HHHHHHHHHHHHHHHH-RRRRRRRR-NH2). The NP1 (at pH 8.0) could encapsulate and deliver the cancer drug ellipticine to A549 and CHO-K1 cells (Figure 2F). Walrant et al., demonstrated that Trp residues played the role of natural aromatic activators of Arg-rich CPPs. The presence of Trp in oligoarginines increased the uptake in cells expressing GAGs at their surface [107]. In another study, nona-arginine (R9) and a small peptide containing 6 arginine and 3 tryptophan residues (RW9) were used to explore the penetration of the two peptides into large unilamellar vesicles. Compared with R9, the amphipathic peptide RW9 crossed the membrane vesicles, thus demonstrating an important role in the increasing membrane fluidity and peptide membrane translocation of the Trp residues induced amphipathy [108]. To explore the influence of the tryptophan content and backbone spacing on the CPP uptake efficiency, peptides with different tryptophan contents and compositions were explored in the study of Rydberg et al. [109]. They found that the peptides with additional tryptophan content and backbone spacing had further intracellular distribution. The peptides with four tryptophans in the middle or evenly distributed along the peptide sequence had higher uptake efficiency than those with four tryptophans at the N-terminus, even though the peptides had the same amino acid content. In the study of Fuselier et al. [80] we mentioned above, the leucine residues played an important role in the spontaneous membrane translocation of the peptides containing the LRLLR sequence.
4. Applications of Arginine-Rich Peptides in Biomedicine
4.1. Application of Arginine-Rich Peptides in Drug Delivery
4.1.1. siRNA Delivery
In the past decades since the Nobel prize-winning discovery of RNA interference (RNAi), RNA interference has become a valuable research tool for studying gene function, regulation, and therapy. Since the poor stability and inability of naked siRNA to translocate through cell membranes, an appropriate siRNA delivery material is highly desired to transport short interfering RNA (siRNA) to the target sites to achieve the clinical potential of RNAi for specific gene silencing. Many methods for delivering siRNA have been explored in the past few years. However, the lack of a cell type-specific, safe, and efficient delivery material is still the primary bottleneck for the clinical application of siRNA. Among the emerging candidate nanocarriers for siRNA delivery, peptides have drawn attention due to their structural and functional versatility, potential biocompatibility, and ability to target cells. The cationic arginine-rich peptides could deliver siRNAs into targeting cells and induce silencing of the therapeutic target contributing to its membrane penetration capacity. The 599 peptides (GLFEAIEGFIENGWEGMIDGWYGGGGRRRRRRRRRK) designed by Cantini et al. [75] proved that the cationic CPP residues could enhance the intracellular delivery and bioavailability of siRNAs. On the other hand, the hybrid nanovector (based on PEGylated superparamagnetic iron oxide nanoparticles functionalized with gH625 peptide, chitosan, and poly-L-arginine) designed by Sanaa et al. [110] demonstrated that the cationic polymers (poly-L-arginine) could provide siRNA protection and favor siRNA endosomal escape and delivery to the cytosol.
4.1.2. Anti-Cancer Drugs Delivery
Typically, chemical cancer drugs transport cell membranes via a passive diffusion route, which is significantly affected by drug concentrations and chemical-physical properties of cell membranes [111,112]. Thus, the peptide-based drug delivery systems provide a promising perspective for effectively delivering chemical drugs to fight cancer. Arginine-rich CPPs and ligands specific to target over-expressed receptors on cancer-cell surfaces are popular among many approaches for active cancer therapy. Deshpande et al. [113] proved that the attachment of an arginine-rich CPP octaarginine (R8) and transferrin (Tf) to the surface of DOX-loaded liposomes improved the targeting of A2780 ovarian carcinoma cells and controlling tumor growth in an A2780 ovarian xenograft model. Besides ovarian carcinoma [114], the arginine-rich CPPs also showed their application potential in the therapy of other cancers, such as colorectal cancer [115,116,117], lung cancer [36,118,119,120,121,122,123], oral cancer [75,124,125], breast cancer [122,126,127,128,129], prostate cancer [130,131,132,133], pancreatic cancer [134,135], renal carcinoma [121,136], etc.
Besides the application in the peptide-based drug-delivery systems, the arginine-rich peptides are also used in other related fields of cancer therapy. For example, anti-angiogenic therapy is a potential chemotherapeutic strategy for treating drug-resistant cancers but lacks suitable methods for delivering such drugs to tumor endothelial cells. Takara et al. [136] designed liposomes modified by NGR (CYGGRGNG) motif peptide and tetra-arginine (R4) peptide, which enhanced the amount of delivered liposomes, induced the disruption of tumor vessels and suppressed tumor growth.
Regulatory T cells (Treg) have been proved to hinder protective immunosurveillance of neoplasia and hamper effective antitumor immune responses in tumor-bearing hosts, thus promoting tumor development and progression [137,138,139,140,141,142]. The arginine-rich peptides used in the Treg related tumor immunity therapy were explored by Morse et al. [143]. The arginine-rich CPP (RXR)4 was conjugated with morpholino oligomer. The conjugate could modulate Treg levels and enhance the induction of effector T-cell responses, potentially optimizing immunotherapy strategies in cancer and viral immunotherapy.
4.1.3. Targeted Delivery Properties
The arginine-rich CPPs are found with excellent prospects in the field of drug delivery; however, the nontargeting features of CPPs greatly limited their application in systemic administration. Here, one solution for building the targeted delivery of CPPs is modifications of the arginine-rich peptides via targeting compounds, where the strategy is similar to other targeting delivery systems [144]. Hence, conjugating specific motifs to the arginine-rich peptides to form tandem peptides has been proved an effective method [33,145]. Chen et al. [146] designed two self-assembled BolA-like arginine-rich peptides as viral-mimetic gene vectors. In the structure of the peptide, the R8 sequence was designed as the cell-penetrating moiety and the arginine-glycine-aspartic acid (RGD) sequence as tumor-targeting moiety (Figure 3A). In the study of Liu et al. [147], a formed tandem peptide R6-dGR had been designed and proved to have tumor targeting and penetrating properties both in vitro and in vivo. Besides conjugating specific motifs, the arginine-rich peptides could also be modified by other functional groups to form multifunctional nanomaterials, which opened new frontiers for the applications of arginine-rich peptides in targeted delivery. For example, Ji et al. [148] developed a dual-mode nanomaterial with the ability of cancer-associated fibroblasts (CAFs) to target and efficient cell penetration to achieve tumor-targeted drug delivery (Figure 3B). The core-shell structured peptide nanoparticles (PNP) had a hydrophobic cholesterol core and a hydrophilic cationic R9 peptide shell. Afterwards, hydrophobic antitumor drug doxorubicin (DOX) was encapsulated by PNP, and then mouse monoclonal antibody (mAb) molecules targeted human fibroblast activation protein-α (FAP-α) were modified onto the surface to construct PNP-D-mAb nanoparticle. In another study, a nanoparticle with a similar self-assembled core-shell structure was designed with a multi-functional fusion peptide sequence (GFLGR8GDS) and a hydrophobic polycaprolactone (PCL) tail [149]. The peptide sequence was located on the shell and encapsulated the DOX in the core. The RGD and membrane-penetrating peptide (R8) sequences in the nanoparticles could be used to target tumor cells and penetrate cell membranes (Figure 3C). As seen from the above studies, the RGD sequence was an influential tumor-targeting segment. An amphiphilic peptide (RR-22) with a sequence of Ac-RGDGPLGLAGI3GR8-NH2 was designed for the aim of selective cancer-killing (Figure 3D) [76]. Its high cancer-killing selectivity was ascribed to the specific recognition and binding of RGD segment to cancer membranes and the cleavage of PLGLA segment by the cancer-overexpressed matrix metalloproteinase-7 (MMP7).
Besides the popular RGD peptide, other targeting identifications of tumor could be recognized as targeting sites and development of the CPPs [150,151,152]. New peptide sequences with targeting properties are emerging to be discovered and applied for practical purposes, which shall facilitate the development of next-generation therapeutic molecules with both selectivity and targeting ability.
4.2. Application of Arginine-Rich Peptides in Biosensors
The arginine-rich CPPs have the potential for widespread use in the field of biosensors due to their exceptional cellular uptake capacities. Researchers have used arginine-rich peptide Tat as a delivery tool for biosensors for over 10 years. A ratiometric fluorescent zinc biosensor was created [153] to better comprehend zinc levels in conventional cells. Tat was fused to human carbonic anhydrase and employed as a sensor transducer. This allowed the construct to be internalized effectively without the need for cell membrane manipulation. In order to map the pH of the whole cell and assess changes in the pH of the cytoplasm and lysosomes simultaneously, Xia et al., developed a novel ratiometric fluorescent probe based on arginine-rich peptides [154]. The arginine-rich CPP, R12K, worked as a linker, carrier, and part of the fluorophore. In another work of their team, R12 was used to modify the optical properties of 5-carboxylfluorescein (FAM), a conventional pH-responsive fluorophore widely used in fluorescence labeling and imaging, presenting a potential method for producing fluorescent pH probes with adjustable pKa values for measuring the pH in organelles [155]. The water solubility, membrane permeability, and organelle-specific localization of FAM were all enhanced by the arginine-rich CPPs in addition to tunable pKa. In some earlier studies, arginine-rich peptides were used in the application of optical calcium sensors [156] and high-throughput screening of inhibitors of protein kinases [157]. Moreover, the arginine-rich peptides were also used in the field of oncotherapy-related biosensors. In prostate cancer cell lines, an arginine-rich cell-permeable peptide (NH2GR11) was discovered with an unanticipated preferential uptake. The peptide was employed as a positron emission tomography (PET) imaging probe for the targeted detection of distant prostate cancer metastases [158].
Applications of arginine-rich peptides in biosensors have received more and more attention due to their high effectiveness at membrane penetration. Focusing on the applications of biosensors from different fields could assist researchers in broadening their perspectives and laying the groundwork for efforts to identify new and better therapeutic options.
4.3. Application of Arginine-Rich Peptides in Antimicrobial
Due to the quick and broad-spectrum antibacterial activity and apparent decreased risk of microbial resistance development, antimicrobial peptides (AMPs) have drawn as much attention as novel families of antibiotics. Interestingly, recent findings suggest that CPP conjugation to AMPs may be useful for increasing antimicrobial activity and selectivity against bacteria. The study of Lee et al. [159] was the first study to investigate the effects of CPP−AMP conjugates on antimicrobial activity, as well as their mode of action. They found that CPP (R9) conjugation to AMPs facilitated translocation across the membrane and entry into bacterial cells, and the conjugates showed stronger anti-inflammatory activity than the AMPs alone (Figure 3E). In the study of Kravchenko et al. [78], hybrid peptides R23F, R23DI, and R23EI (sequences in Table 1) based on the ribosomal S1 protein sequence from S. aureus and with an arginine-rich CPP fragment (RKKRRQRRR) in the N-terminus of the peptides were synthesized and showed antibacterial activity. In addition, Grishin et al. [160] and Kurpe [161] also designed and synthesized hybrid peptides containing arginine-rich CPP fragments in the N-terminus of the peptides, which opened up new possibilities for the manifestation of the antimicrobial effects of hybrid peptides.
4.4. Application of Arginine-Rich Peptides in Blood-Brain-Barrier Transport
The intrinsic neuroprotective mechanism of the human brain makes it difficult to transport biotherapeutics across the blood-brain barrier (BBB). Recent research suggests tailored nanoparticles might be created using cationic cell-penetrating peptides for targeted biotherapeutics’ delivery to the brain. The capacity of arginine-rich CPPs through the blood-brain barrier was simulated and verified by researchers. In the study of Rousselle et al., the potential of the anti-cancer drug doxorubicin (Dox) to cross the BBB was investigated using a rat brain model after it was linked to the peptides SynB1 (RGGRLSYSRRRFSTSTGR) [77]. The outcomes showed that Dox uptake increased by a factor of 6 when combined with SynB1 vectors, suggesting that SynB1 enhances Dox delivery across the BBB. Sharma et al. [162] reported a bifunctional liposome combining transferrin (Tf)-mediated receptor targeting and poly-L-arginine-facilitated cell penetration, which showed high efficiency and low toxicity in the in vitro blood-brain barrier model (Figure 3F). In another study, 11 poly-arginine (11R) was proved capable of in vivo delivery to the brain by passing through the BBB, allowing for the administration of therapeutic compounds in cerebral ischemia [163]. Moreover, Tian et al. [164] designed a multifunctional polymeric micelle showing satisfactory properties of BBB penetration and tumor targeting in both xenograft and orthotropic glioma mouse models, in which arginine-glycine repeats (RG)5 were incorporated into the micelles to improve cellular uptake and across the BBB. In a word, the capacity of arginine-rich CPPs through the BBB could be a promising strategy for safe and effective drug delivery to the brain.
Due to the unique side chain of arginine with a positive charge, the CPPs provide not only cell penetration ability but also adjust the charge of the whole peptide sequences, which significantly expands its application in various fields besides biomedical applications, such as food science [165,166], materials science, engineering [167], etc. Along with the development of the design strategies of CPPs and the deep understanding of the peptide-membrane interactions, it will bring enormous opportunities for the wide applications of CPPs in the future.
5. Conclusions
In this brief synopsis, we have concluded that the transmembrane mechanisms of arginine-rich CPPs are concentrated on the application of arginine-rich peptides in biomedicine. In general, the main mechanisms include: (1) guanidine groups of arginine form a bidentate bond with negative phosphates, sulfates, and carboxylates on the cell surface; (2) the charge-neutralized species are driven into the cell by the membrane potential; (3) the guanidine group participates in membrane penetration by partitioning the lipid glycerol regions and attaching to anionic groups on cell surfaces. Significantly, the relationship between the function of arginine-rich peptides and the number of arginine residues, arginine optical isomers, primary sequence, and secondary structure are discussed. Interestingly, arginine-rich CPPs with unique structural features or those linked to hydrophobic hydrocarbon moieties have better membrane penetration rates, which are influenced by modification with different amino acids. A logical design of CPPs will build an effective delivery system, biosensors, and BBB penetration, which exhibits potential to be at clinical level.
Acknowledgments
We thank Innovation Pilot Project of Integration of Science, Education.
Author Contributions
Conceptualization, M.H. and L.Z.; writing—original draft preparation, M.H.; writing—review and editing, L.Z. and P.C.; supervision, L.Z. and P.C.; funding acquisition, P.C. All authors have read and agreed to the published version of the manuscript.
Institutional Review Board Statement
Not applicable.
Informed Consent Statement
Not applicable.
Data Availability Statement
All relevant data are within the manuscript.
Conflicts of Interest
The authors declare no conflict of interest.
Funding Statement
This research was funded by Industry of Shandong Province (2020KJC-CG04), and Mitacs Fellowship (Canada, IT18262).
Footnotes
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.
References
- 1.Misra S. Human gene therapy: A brief overview of the genetic revolution. J. Assoc. Physicians India. 2013;61:127–133. [PubMed] [Google Scholar]
- 2.Giacca M., Zacchigna S. Virus-mediated gene delivery for human gene therapy. J. Control. Release. 2012;161:377–388. doi: 10.1016/j.jconrel.2012.04.008. [DOI] [PubMed] [Google Scholar]
- 3.Haddad A.F., Young J.S., Aghi M.K. Using viral vectors to deliver local immunotherapy to glioblastoma. Neurosurg. Focus. 2021;50:E4. doi: 10.3171/2020.11.FOCUS20859. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Luo D., Saltzman W.M. Synthetic DNA delivery systems. Nat. Biotechnol. 2000;18:33–37. doi: 10.1038/71889. [DOI] [PubMed] [Google Scholar]
- 5.Ibraheem D., Elaissari A., Fessi H. Gene therapy and DNA delivery systems. Int. J. Pharm. 2014;459:70–83. doi: 10.1016/j.ijpharm.2013.11.041. [DOI] [PubMed] [Google Scholar]
- 6.Shi B., Zheng M., Tao W., Chung R., Jin D., Ghaffari D., Farokhzad O.C. Challenges in DNA delivery and recent advances in multifunctional polymeric DNA delivery systems. Biomacromolecules. 2017;18:2231–2246. doi: 10.1021/acs.biomac.7b00803. [DOI] [PubMed] [Google Scholar]
- 7.Cao Y., Ma E., Cestellos-Blanco S., Zhang B., Qiu R., Su Y., Doudna J.A., Yang P. Nontoxic nanopore electroporation for effective intracellular delivery of biological macromolecules. Proc. Natl. Acad. Sci. USA. 2019;116:7899–7904. doi: 10.1073/pnas.1818553116. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Pinheiro D.H., Taylor C.E., Wu K., Siegfried B.D. Delivery of gene-specific dsRNA by microinjection and feeding induces RNAi response in Sri Lanka weevil, Myllocerus undecimpustulatus undatus Marshall. Pest Manag. Sci. 2020;76:936–943. doi: 10.1002/ps.5601. [DOI] [PubMed] [Google Scholar]
- 9.Kube S., Hersch N., Naumovska E., Gensch T., Hendriks J., Franzen A., Landvogt L., Siebrasse J.-P., Kubitscheck U., Hoffmann B. Fusogenic liposomes as nanocarriers for the delivery of intracellular proteins. Langmuir. 2017;33:1051–1059. doi: 10.1021/acs.langmuir.6b04304. [DOI] [PubMed] [Google Scholar]
- 10.Copolovici D.M., Langel K., Eriste E., Langel U. Cell-penetrating peptides: Design, synthesis, and applications. ACS Nano. 2014;8:1972–1994. doi: 10.1021/nn4057269. [DOI] [PubMed] [Google Scholar]
- 11.Koren E., Torchilin V.P. Cell-penetrating peptides: Breaking through to the other side. Trends Mol. Med. 2012;18:385–393. doi: 10.1016/j.molmed.2012.04.012. [DOI] [PubMed] [Google Scholar]
- 12.Yamada T., Das Gupta T.K., Beattie C.W. p28, an anionic cell-penetrating peptide, increases the activity of wild type and mutated p53 without altering its conformation. Mol. Pharm. 2013;10:3375–3383. doi: 10.1021/mp400221r. [DOI] [PubMed] [Google Scholar]
- 13.Guidotti G., Brambilla L., Rossi D. Cell-penetrating peptides: From basic research to clinics. Trends Pharmacol. Sci. 2017;38:406–424. doi: 10.1016/j.tips.2017.01.003. [DOI] [PubMed] [Google Scholar]
- 14.Kim S.W., Kim N.Y., Choi Y.B., Park S.H., Yang J.M., Shin S. RNA interference in vitro and in vivo using an arginine peptide/siRNA complex system. J. Control. Release. 2010;143:335–343. doi: 10.1016/j.jconrel.2010.01.009. [DOI] [PubMed] [Google Scholar]
- 15.Jafari M., Chen P. Peptide mediated siRNA delivery. Curr. Top. Med. Chem. 2009;9:1088–1097. doi: 10.2174/156802609789630839. [DOI] [PubMed] [Google Scholar]
- 16.El-Sayed A., Futaki S., Harashima H. Delivery of macromolecules using arginine-rich cell-penetrating peptides: Ways to overcome endosomal entrapment. AAPS J. 2009;11:13–22. doi: 10.1208/s12248-008-9071-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Wender P.A., Galliher W.C., Goun E.A., Jones L.R., Pillow T.H. The design of guanidinium-rich transporters and their internalization mechanisms. Adv. Drug Deliv. Rev. 2008;60:452–472. doi: 10.1016/j.addr.2007.10.016. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Futaki S., Nakase I. Cell-surface interactions on arginine-rich cell-penetrating peptides allow for multiplex modes of internalization. Acc. Chem. Res. 2017;50:2449–2456. doi: 10.1021/acs.accounts.7b00221. [DOI] [PubMed] [Google Scholar]
- 19.Kanazawa T., Kaneko M., Niide T., Akiyama F., Kakizaki S., Ibaraki H., Shiraishi S., Takashima Y., Suzuki T., Seta Y. Enhancement of nose-to-brain delivery of hydrophilic macromolecules with stearate-or polyethylene glycol-modified arginine-rich peptide. Int. J. Pharm. 2017;530:195–200. doi: 10.1016/j.ijpharm.2017.07.077. [DOI] [PubMed] [Google Scholar]
- 20.Fawell S., Seery J., Daikh Y., Moore C., Chen L.L., Pepinsky B., Barsoum J. Tat-mediated delivery of heterologous proteins into cells. Proc. Natl. Acad. Sci. USA. 1994;91:664–668. doi: 10.1073/pnas.91.2.664. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Watson K., Edwards R.J. HIV-1 trans-activating (Tat) protein: Both a target and a tool in therapeutic approaches. Biochem. Pharmacol. 1999;58:1521–1528. doi: 10.1016/S0006-2952(99)00209-9. [DOI] [PubMed] [Google Scholar]
- 22.Kadkhodayan S., Bolhassani A., Mehdi Sadat S., Irani S., Fotouhi F. The efficiency of Tat cell penetrating peptide for intracellular uptake of HIV-1 Nef expressed in E. coli and mammalian cell. Curr. Drug Deliv. 2017;14:536–542. doi: 10.2174/1567201813666161006114448. [DOI] [PubMed] [Google Scholar]
- 23.Jin L.H., Bahn J.H., Eum W.S., Kwon H.Y., Jang S.H., Han K.H., Kang T.-C., Won M.H., Kang J.H., Cho S.-W. Transduction of human catalase mediated by an HIV-1 TAT protein basic domain and arginine-rich peptides into mammalian cells. Free Radic. Biol. Med. 2001;31:1509–1519. doi: 10.1016/S0891-5849(01)00734-1. [DOI] [PubMed] [Google Scholar]
- 24.Kwon H.Y., Eum W.S., Jang H.W., Kang J.H., Ryu J., Ryong Lee B., Jin L.H., Park J., Choi S.Y. Transduction of Cu, Zn-superoxide dismutase mediated by an HIV-1 Tat protein basic domain into mammalian cells. FEBS Lett. 2000;485:163–167. doi: 10.1016/S0014-5793(00)02215-8. [DOI] [PubMed] [Google Scholar]
- 25.Nagahara H., Vocero-Akbani A.M., Snyder E.L., Ho A., Latham D.G., Lissy N.A., Becker-Hapak M., Ezhevsky S.A., Dowdy S.F. Transduction of full-length TAT fusion proteins into mammalian cells: TAT-p27Kip1 induces cell migration. Nat. Med. 1998;4:1449–1452. doi: 10.1038/4042. [DOI] [PubMed] [Google Scholar]
- 26.Park J., Ryu J., Kim K.-A., Lee H.J., Bahn J.H., Han K., Choi E.Y., Lee K.S., Kwon H.Y., Choi S.Y. Mutational analysis of a human immunodeficiency virus type 1 Tat protein transduction domain which is required for delivery of an exogenous protein into mammalian cells. J. Gen. Virol. 2002;83:1173–1181. doi: 10.1099/0022-1317-83-5-1173. [DOI] [PubMed] [Google Scholar]
- 27.Tashima T. Intelligent substance delivery into cells using cell-penetrating peptides. Bioorganic Med. Chem. Lett. 2017;27:121–130. doi: 10.1016/j.bmcl.2016.11.083. [DOI] [PubMed] [Google Scholar]
- 28.Reissmann S. Cell penetration: Scope and limitations by the application of cell-penetrating peptides. J. Pept. Sci. 2014;20:760–784. doi: 10.1002/psc.2672. [DOI] [PubMed] [Google Scholar]
- 29.Pärnaste L., Arukuusk P., Zagato E., Braeckmans K., Langel Ü. Methods to follow intracellular trafficking of cell-penetrating peptides. J. Drug Target. 2016;24:508–519. doi: 10.3109/1061186X.2015.1095194. [DOI] [PubMed] [Google Scholar]
- 30.Hu G., Zheng W., Li A., Mu Y., Shi M., Li T., Zou H., Shao H., Qin A., Ye J. A novel CAV derived cell-penetrating peptide efficiently delivers exogenous molecules through caveolae-mediated endocytosis. Vet. Res. 2018;49:1–9. doi: 10.1186/s13567-018-0513-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.Wei Y., Ma L., Zhang L., Xu X. Noncovalent interaction-assisted drug delivery system with highly efficient uptake and release of paclitaxel for anticancer therapy. Int. J. Nanomed. 2017;12:7039. doi: 10.2147/IJN.S144322. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.Walrant A., Cardon S., Burlina F., Sagan S. Membrane Crossing and Membranotropic Activity of Cell-Penetrating Peptides: Dangerous Liaisons? Acc. Chem. Res. 2017;50:2968. doi: 10.1021/acs.accounts.7b00455. [DOI] [PubMed] [Google Scholar]
- 33.Liu B.R., Chiou S.-H., Huang Y.-W., Lee H.-J. Bio-Membrane Internalization Mechanisms of Arginine-Rich Cell-Penetrating Peptides in Various Species. Membranes. 2022;12:88. doi: 10.3390/membranes12010088. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 34.Böhmová E., Machová D., Pechar M., Pola R., Venclíková K., Janoušková O., Etrych T. Cell-penetrating peptides: A useful tool for the delivery of various cargoes into cells. Physiol. Res. 2018;67:S267–S279. doi: 10.33549/physiolres.933975. [DOI] [PubMed] [Google Scholar]
- 35.Kardani K., Milani A., Shabani S.H., Bolhassani A. Cell penetrating peptides: The potent multi-cargo intracellular carriers. Expert Opin. Drug Deliv. 2019;16:1227–1258. doi: 10.1080/17425247.2019.1676720. [DOI] [PubMed] [Google Scholar]
- 36.Zhang L., Xu J., Wang F., Ding Y., Wang T., Jin G., Martz M., Gui Z., Ouyang P., Chen P. Histidine-rich cell-penetrating peptide for cancer drug delivery and its uptake mechanism. Langmuir. 2019;35:3513–3523. doi: 10.1021/acs.langmuir.8b03175. [DOI] [PubMed] [Google Scholar]
- 37.Ikuhiko N., Yoshimasa K., Motoyoshi N., Shiroh F. Cellular Uptake of Arginine-Rich Cell-Penetrating Peptides and the Contribution of Membrane-Associated Proteoglycans. Tigg. 2015;27:81–88. [Google Scholar]
- 38.Stanzl E.G., Trantow B.M., Vargas J.R., Wender P.A. Fifteen years of cell-penetrating, guanidinium-rich molecular transporters: Basic science, research tools, and clinical applications. Acc. Chem. Res. 2013;46:2944–2954. doi: 10.1021/ar4000554. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.Su Y., Waring A.J., Ruchala P., Hong M. Membrane-bound dynamic structure of an arginine-rich cell-penetrating peptide, the protein transduction domain of HIV TAT, from solid-state NMR. Biochemistry. 2010;49:6009–6020. doi: 10.1021/bi100642n. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40.Herce H.D., Garcia A.E., Cardoso M.C. Fundamental Molecular Mechanism for the Cellular Uptake of Guanidinium-Rich Molecules. J. Am. Chem. Soc. 2014;136:17459–17467. doi: 10.1021/ja507790z. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Takechi-Haraya Y., Aki K., Tohyama Y., Harano Y., Kawakami T., Saito H., Okamura E. Glycosaminoglycan Binding and Non-Endocytic Membrane Translocation of Cell-Permeable Octaarginine Monitored by Real-Time In-Cell NMR Spectroscopy. Pharmaceuticals. 2017;10:42. doi: 10.3390/ph10020042. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 42.Wallbrecher R., Verdurmen W.P., Schmidt S., Bovee-Geurts P.H., Broecker F., Reinhardt A., van Kuppevelt T.H., Seeberger P.H., Brock R. The stoichiometry of peptide-heparan sulfate binding as a determinant of uptake efficiency of cell-penetrating peptides. Cell. Mol. Life Sci. 2014;71:2717–2729. doi: 10.1007/s00018-013-1517-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Chen X., Liu S., Deme B., Cristiglio V., Marquardt D., Weller R., Rao P., Wang Y., Bradshaw J. Efficient internalization of TAT peptide in zwitterionic DOPC phospholipid membrane revealed by neutron diffraction. Biochim. Biophys. Acta (BBA)-Biomembr. 2017;1859:910–916. doi: 10.1016/j.bbamem.2017.01.036. [DOI] [PubMed] [Google Scholar]
- 44.Jobin M.-L., Vamparys L., Deniau R., Grélard A., Mackereth C.D., Fuchs P.F., Alves I.D. Biophysical insight on the membrane insertion of an arginine-rich cell-penetrating peptide. Int. J. Mol. Sci. 2019;20:4441. doi: 10.3390/ijms20184441. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Takechi-Haraya Y., Saito H. Current Understanding of Physicochemical Mechanisms for Cell Membrane Penetration of Arginine-rich Cell Penetrating Peptides: Role of Glycosaminoglycan Interactions. Curr. Protein Pept. Sci. 2018;19:623–630. doi: 10.2174/1389203719666180112100747. [DOI] [PubMed] [Google Scholar]
- 46.Zhu P., Jin L. Cell Penetrating Peptides: A Promising Tool for the Cellular Uptake of Macromolecular Drugs. Curr. Protein Pept. Sci. 2018;19:211–220. doi: 10.2174/1389203718666170710115240. [DOI] [PubMed] [Google Scholar]
- 47.Rádis-Baptista G., Campelo I.S., Morlighem J.-É.R., Melo L.M., Freitas V.J. Cell-penetrating peptides (CPPs): From delivery of nucleic acids and antigens to transduction of engineered nucleases for application in transgenesis. J. Biotechnol. 2017;252:15–26. doi: 10.1016/j.jbiotec.2017.05.002. [DOI] [PubMed] [Google Scholar]
- 48.Takechi-Haraya Y., Nadai R., Kimura H., Nishitsuji K., Uchimura K., Sakai-Kato K., Kawakami K., Shigenaga A., Kawakami T., Otaka A. Enthalpy-driven interactions with sulfated glycosaminoglycans promote cell membrane penetration of arginine peptides. Biochim Biophys Acta. 2016;1858:1339–1349. doi: 10.1016/j.bbamem.2016.03.021. [DOI] [PubMed] [Google Scholar]
- 49.Letoha T., Keller-Pintér A., Kusz E., Kolozsi C., Bozsó Z., Oacute Z., Tóth G., Vizler C., Oláh Z. Cell-penetrating peptide exploited syndecans. BBA-Biomembr. 2010;1798:2258–2265. doi: 10.1016/j.bbamem.2010.01.022. [DOI] [PubMed] [Google Scholar]
- 50.Gerbal-Chaloin S., Gondeau C., Aldrian-Herrada G., Heitz F., Gauthier-Rouvière C., Divita G. First step of the cell-penetrating peptide mechanism involves Rac1 GTPase-dependent actin-network remodelling. Biol. Cell. 2007;99:223–238. doi: 10.1042/BC20060123. [DOI] [PubMed] [Google Scholar]
- 51.Kawaguchi Y., Takeuchi T., Kuwata K., Chiba J., Hatanaka Y., Nakase I., Futaki S. Syndecan-4 is a receptor for clathrin-mediated endocytosis of arginine-rich cell-penetrating peptides. Bioconjugate Chem. 2016;27:1119–1130. doi: 10.1021/acs.bioconjchem.6b00082. [DOI] [PubMed] [Google Scholar]
- 52.Zuconelli C.R., Schmidt S., Wallbrecher R., Oostrum J.V., Adjobo-Hermans M. Modulation of Orai1 by cationic peptides triggers their direct cytosolic uptake. Biochim. Biophys. Acta (BBA)-Biomembr. 1862;3:183155. doi: 10.1016/j.bbamem.2019.183155. [DOI] [PubMed] [Google Scholar]
- 53.Verdurmen W.P., Wallbrecher R., Schmidt S., Eilander J., Bovee-Geurts P., Fanghänel S., Bürck J., Wadhwani P., Ulrich A.S., Brock R. Cell surface clustering of heparan sulfate proteoglycans by amphipathic cell-penetrating peptides does not contribute to uptake. J. Control. Release. 2013;170:83–91. doi: 10.1016/j.jconrel.2013.05.001. [DOI] [PubMed] [Google Scholar]
- 54.Nakase I. Biofunctional peptide-modified extracellular vesicles enable effective intracellular delivery via the induction of macropinocytosis. Processes. 2021;9:224. doi: 10.3390/pr9020224. [DOI] [Google Scholar]
- 55.Sun D., Forsman J., Lund M., Woodward C.E. Effect of arginine-rich cell penetrating peptides on membrane pore formation and life-times: A molecular simulation study. Phys. Chem. Chem. Phys. 2014;16:20785–20795. doi: 10.1039/C4CP02211D. [DOI] [PubMed] [Google Scholar]
- 56.Pourmousa M., Karttunen M. Early stages of interactions of cell-penetrating peptide penetratin with a DPPC bilayer. Chem. Phys. Lipids. 2013;169:85–94. doi: 10.1016/j.chemphyslip.2013.02.011. [DOI] [PubMed] [Google Scholar]
- 57.Goun E.A., Pillow T.H., Jones L.R., Rothbard J.B., Wender P.A. Molecular transporters: Synthesis of oligoguanidinium transporters and their application to drug delivery and real-time imaging. ChemBioChem. 2006;7:1497–1515. doi: 10.1002/cbic.200600171. [DOI] [PubMed] [Google Scholar]
- 58.Kosuge M., Takeuchi T., Nakase I., Jones A.T., Futaki S. Cellular internalization and distribution of arginine-rich peptides as a function of extracellular peptide concentration, serum, and plasma membrane associated proteoglycans. Bioconjug. Chem. 2008;19:656–664. doi: 10.1021/bc700289w. [DOI] [PubMed] [Google Scholar]
- 59.Mitchell D.J., Steinman L., Kim D., Fathman C., Rothbard J. Polyarginine enters cells more efficiently than other polycationic homopolymers. J. Pept. Res. 2000;56:318–325. doi: 10.1034/j.1399-3011.2000.00723.x. [DOI] [PubMed] [Google Scholar]
- 60.Nakase I., Noguchi K., Aoki A., Takatani-Nakase T., Fujii I., Futaki S. Arginine-rich cell-penetrating peptide-modified extracellular vesicles for active macropinocytosis induction and efficient intracellular delivery. Sci. Rep. 2017;7:1991. doi: 10.1038/s41598-017-02014-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 61.Chu D., Xu W., Pan R., Ding Y., Sui W., Chen P. Rational modification of oligoarginine for highly efficient siRNA delivery: Structure-Activity relationship and mechanism of intracellular trafficking of siRNA. Nanomed. Nanotechnol. Biol. Med. 2015;11:435–446. doi: 10.1016/j.nano.2014.08.007. [DOI] [PubMed] [Google Scholar]
- 62.Ryu D.W., Kim H.A., Ryu J.H., Lee D.Y., Lee M. Amphiphilic peptides with arginine and valine residues as siRNA carriers. J. Cell. Biochem. 2012;113:619–628. doi: 10.1002/jcb.23389. [DOI] [PubMed] [Google Scholar]
- 63.Najjar K., Erazo-Oliveras A., Mosior J.W., Whitlock M.J., Rostane I., Cinclair J.M., Pellois J.-P. Unlocking endosomal entrapment with supercharged arginine-rich peptides. Bioconjug. Chem. 2017;28:2932–2941. doi: 10.1021/acs.bioconjchem.7b00560. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 64.Vaithiyanathan M., Hymel H.C., Safa N., Sanchez O.M., Pettigrew J.H., Kirkpatrick C.S., Gauthier T.J., Melvin A.T. Kinetic analysis of cellular internalization and expulsion of unstructured D-chirality cell penetrating peptides. AIChE J. 2021;67:e17087. doi: 10.1002/aic.17087. [DOI] [Google Scholar]
- 65.Yamada T., Signorelli S., Cannistraro S., Beattie C.W., Bizzarri A.R. Chirality switching within an anionic cell-penetrating peptide inhibits translocation without affecting preferential entry. Mol. Pharm. 2015;12:140–149. doi: 10.1021/mp500495u. [DOI] [PubMed] [Google Scholar]
- 66.Ueda Y., Wei F.-Y., Hide T.-i., Michiue H., Takayama K., Kaitsuka T., Nakamura H., Makino K., Kuratsu J.-i., Futaki S. Induction of autophagic cell death of glioma-initiating cells by cell-penetrating D-isomer peptides consisting of Pas and the p53 C-terminus. Biomaterials. 2012;33:9061–9069. doi: 10.1016/j.biomaterials.2012.09.003. [DOI] [PubMed] [Google Scholar]
- 67.Yamashita H., Kato T., Oba M., Misawa T., Hattori T., Ohoka N., Tanaka M., Naito M., Kurihara M., Demizu Y. Development of a cell-penetrating peptide that exhibits responsive changes in its secondary structure in the cellular environment. Sci. Rep. 2016;6:33003. doi: 10.1038/srep33003. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 68.Tai W., Gao X. Functional peptides for siRNA delivery. Adv. Drug Deliv. Rev. 2017;110:157–168. doi: 10.1016/j.addr.2016.08.004. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 69.Verdurmen W.P., Bovee-Geurts P.H., Wadhwani P., Ulrich A.S., Hällbrink M., van Kuppevelt T.H., Brock R. Preferential uptake of L-versus D-amino acid cell-penetrating peptides in a cell type-dependent manner. Chem. Biol. 2011;18:1000–1010. doi: 10.1016/j.chembiol.2011.06.006. [DOI] [PubMed] [Google Scholar]
- 70.Ma Y., Gong C., Ma Y., Fan F., Luo M., Yang F., Zhang Y.-H. Direct cytosolic delivery of cargoes in vivo by a chimera consisting of D-and L-arginine residues. J. Control. Release. 2012;162:286–294. doi: 10.1016/j.jconrel.2012.07.022. [DOI] [PubMed] [Google Scholar]
- 71.Behzadi M., Eghtedardoost M., Bagheri M. Endocytosis Involved d-Oligopeptide of Tryptophan and Arginine Displays Ordered Nanostructures and Cancer Cell Stereoselective Toxicity by Autophagy. ACS Appl. Mater. Interfaces. 2022;14:14928–14943. doi: 10.1021/acsami.1c23846. [DOI] [PubMed] [Google Scholar]
- 72.Komin A., Bogorad M.I., Lin R., Cui H., Searson P.C., Hristova K. A peptide for transcellular cargo delivery: Structure-function relationship and mechanism of action. J. Control. Release. 2020;324:633–643. doi: 10.1016/j.jconrel.2020.05.030. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 73.Ohgita T., Takechi-Haraya Y., Nadai R., Kotani M., Tamura Y., Nishikiori K., Nishitsuji K., Uchimura K., Hasegawa K., Sakai-Kato K. A novel amphipathic cell-penetrating peptide based on the N-terminal glycosaminoglycan binding region of human apolipoprotein E. Biochim. Biophys. Acta (BBA)-Biomembranes. 2019;1861:541–549. doi: 10.1016/j.bbamem.2018.12.010. [DOI] [PubMed] [Google Scholar]
- 74.Zhang L., Sheng Y., Yazdi A.Z., Sarikhani K., Wang F., Jiang Y., Liu J., Zheng T., Wang W., Ouyang P. Surface-assisted assembly of a histidine-rich lipidated peptide for simultaneous exfoliation of graphite and functionalization of graphene nanosheets. Nanoscale. 2019;11:2999–3012. doi: 10.1039/C8NR08397E. [DOI] [PubMed] [Google Scholar]
- 75.Cantini L., Attaway C.C., Butler B., Andino L.M., Sokolosky M.L., Jakymiw A. Fusogenic-oligoarginine peptide-mediated delivery of siRNAs targeting the CIP2A oncogene into oral cancer cells. PLoS ONE. 2013;8:e73348. doi: 10.1371/journal.pone.0073348. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 76.Wang Y., Xuan J., Zhao W., Ding Z., Zhang L., Du R., Zhang A., Wang Y., Li D., Cao M. Smart and selective cancer-killing peptides with cell penetrating sequence and dual-targeting mechanism. Colloids Surf. A Physicochem. Eng. Asp. 2020;586:124185. doi: 10.1016/j.colsurfa.2019.124185. [DOI] [Google Scholar]
- 77.Rousselle C., Clair P., Lefauconnier J.-M., Kaczorek M., Scherrmann J.-M., Temsamani J. New advances in the transport of doxorubicin through the blood-brain barrier by a peptide vector-mediated strategy. Mol. Pharmacol. 2000;57:679–686. doi: 10.1124/mol.57.4.679. [DOI] [PubMed] [Google Scholar]
- 78.Kravchenko S.V., Domnin P.A., Grishin S.Y., Panfilov A.V., Azev V.N., Mustaeva L.G., Gorbunova E.Y., Kobyakova M.I., Surin A.K., Glyakina A.V. Multiple Antimicrobial Effects of Hybrid Peptides Synthesized Based on the Sequence of Ribosomal S1 Protein from Staphylococcus aureus. Int. J. Mol. Sci. 2022;23:524. doi: 10.3390/ijms23010524. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 79.Konate K., Josse E., Tasic M., Redjatti K., Aldrian G., Deshayes S., Boisguérin P., Vivès E. WRAP-based nanoparticles for siRNA delivery: A SAR study and a comparison with lipid-based transfection reagents. J. Nanobiotechnol. 2021;19:1–18. doi: 10.1186/s12951-021-00972-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 80.Fuselier T., Wimley W.C. Spontaneous membrane translocating peptides: The role of leucine-arginine consensus motifs. Biophys. J. 2017;113:835–846. doi: 10.1016/j.bpj.2017.06.070. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 81.Oba M., Nagano Y., Kato T., Tanaka M. Secondary structures and cell-penetrating abilities of arginine-rich peptide foldamers. Sci. Rep. 2019;9:1349. doi: 10.1038/s41598-018-38063-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 82.Kato T., Kita Y., Iwanari K., Asano A., Oba M., Tanaka M., Doi M. Synthesis of six-membered carbocyclic ring α, α-disubstituted amino acids and arginine-rich peptides to investigate the effect of ring size on the properties of the peptide. Bioorganic Med. Chem. 2021;38:116111. doi: 10.1016/j.bmc.2021.116111. [DOI] [PubMed] [Google Scholar]
- 83.Almeida P.F., Ladokhin A.S., White S.H. Hydrogen-bond energetics drive helix formation in membrane interfaces. Biochim. Biophys. Acta (BBA)-Biomembr. 2012;1818:178–182. doi: 10.1016/j.bbamem.2011.07.019. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 84.Ladokhin A.S., White S.H. Folding of amphipathic α-helices on membranes: Energetics of helix formation by melittin. J. Mol. Biol. 1999;285:1363–1369. doi: 10.1006/jmbi.1998.2346. [DOI] [PubMed] [Google Scholar]
- 85.Yamashita H., Oba M., Misawa T., Tanaka M., Hattori T., Naito M., Kurihara M., Demizu Y. A helix-stabilized cell-penetrating peptide as an intracellular delivery tool. ChemBioChem. 2016;17:137–140. doi: 10.1002/cbic.201500468. [DOI] [PubMed] [Google Scholar]
- 86.Chen B., Xu W., Pan R., Chen P. Design and characterization of a new peptide vector for short interfering RNA delivery. J. Nanobiotechnology. 2015;13:1–10. doi: 10.1186/s12951-015-0098-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 87.Neree A.T., Nguyen P.T., Chatenet D., Fournier A., Bourgault S. Secondary conformational conversion is involved in glycosaminoglycans-mediated cellular uptake of the cationic cell-penetrating peptide PACAP. FEBS Lett. 2014;588:4590–4596. doi: 10.1016/j.febslet.2014.10.029. [DOI] [PubMed] [Google Scholar]
- 88.Fillon Y.A., Anderson J.P., Chmielewski J. Cell penetrating agents based on a polyproline helix scaffold. J. Am. Chem. Soc. 2005;127:11798–11803. doi: 10.1021/ja052377g. [DOI] [PubMed] [Google Scholar]
- 89.Shinde A., Feher K.M., Hu C., Slowinska K. Peptide internalization enabled by folding: Triple helical cell-penetrating peptides. J. Pept. Sci. 2015;21:77–84. doi: 10.1002/psc.2725. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 90.Oba M., Ito Y., Umeno T., Kato T., Tanaka M. Plasmid DNA delivery using cell-penetrating peptide foldamers composed of Arg-Arg-Aib repeating sequences. ACS Biomater. Sci. Eng. 2019;5:5660–5668. doi: 10.1021/acsbiomaterials.8b01451. [DOI] [PubMed] [Google Scholar]
- 91.Yoo J., Lee D., Gujrati V., Rejinold N.S., Lekshmi K.M., Uthaman S., Jeong C., Park I.-K., Jon S., Kim Y.-C. Bioreducible branched poly (modified nona-arginine) cell-penetrating peptide as a novel gene delivery platform. J. Control. Release. 2017;246:142–154. doi: 10.1016/j.jconrel.2016.04.040. [DOI] [PubMed] [Google Scholar]
- 92.Pisa M.D., Chassaing G., Swiecicki J.M. When cationic cell-penetrating peptides meet hydrocarbons to enhance in-cell cargo delivery. J. Pept. Sci. 2015;21:356–369. doi: 10.1002/psc.2755. [DOI] [PubMed] [Google Scholar]
- 93.Di Pisa M., Chassaing G., Swiecicki J.-M. Translocation mechanism (s) of cell-penetrating peptides: Biophysical studies using artificial membrane bilayers. Biochemistry. 2015;54:194–207. doi: 10.1021/bi501392n. [DOI] [PubMed] [Google Scholar]
- 94.Ziegler A. Thermodynamic studies and binding mechanisms of cell-penetrating peptides with lipids and glycosaminoglycans. Adv. Drug Deliv. Rev. 2008;60:580–597. doi: 10.1016/j.addr.2007.10.005. [DOI] [PubMed] [Google Scholar]
- 95.Gupta A., Mandal D., Ahmadibeni Y., Parang K., Bothun G. Hydrophobicity drives the cellular uptake of short cationic peptide ligands. Eur. Biophys. J. 2011;40:727–736. doi: 10.1007/s00249-011-0685-4. [DOI] [PubMed] [Google Scholar]
- 96.Mishra A., Lai G.H., Schmidt N.W., Sun V.Z., Rodriguez A.R., Tong R., Tang L., Cheng J., Deming T.J., Kamei D.T. Translocation of HIV TAT peptide and analogues induced by multiplexed membrane and cytoskeletal interactions. Proc. Natl. Acad. Sci. USA. 2011;108:16883–16888. doi: 10.1073/pnas.1108795108. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 97.Takeuchi T., Kosuge M., Tadokoro A., Sugiura Y., Nishi M., Kawata M., Sakai N., Matile S., Futaki S. Direct and rapid cytosolic delivery using cell-penetrating peptides mediated by pyrenebutyrate. ACS Chem. Biol. 2006;1:299–303. doi: 10.1021/cb600127m. [DOI] [PubMed] [Google Scholar]
- 98.Perret F., Nishihara M., Takeuchi T., Futaki S., Lazar A.N., Coleman A.W., Sakai N., Matile S. Anionic fullerenes, calixarenes, coronenes, and pyrenes as activators of oligo/polyarginines in model membranes and live cells. J. Am. Chem. Soc. 2005;127:1114–1115. doi: 10.1021/ja043633c. [DOI] [PubMed] [Google Scholar]
- 99.Katayama S., Nakase I., Yano Y., Murayama T., Nakata Y., Matsuzaki K., Futaki S. Effects of pyrenebutyrate on the translocation of arginine-rich cell-penetrating peptides through artificial membranes: Recruiting peptides to the membranes, dissipating liquid-ordered phases, and inducing curvature. Biochim. Biophys. Acta (BBA)-Biomembr. 2013;1828:2134–2142. doi: 10.1016/j.bbamem.2013.05.016. [DOI] [PubMed] [Google Scholar]
- 100.Lehto T., Abes R., Oskolkov N., Suhorutšenko J., Copolovici D.-M., Mäger I., Viola J.R., Simonson O.E., Ezzat K., Guterstam P. Delivery of nucleic acids with a stearylated (RxR) 4 peptide using a non-covalent co-incubation strategy. J. Control. Release. 2010;141:42–51. doi: 10.1016/j.jconrel.2009.08.028. [DOI] [PubMed] [Google Scholar]
- 101.Takayama K., Hirose H., Tanaka G., Pujals S., Katayama S., Nakase I., Futaki S. Effect of the attachment of a penetration accelerating sequence and the influence of hydrophobicity on octaarginine-mediated intracellular delivery. Mol. Pharm. 2012;9:1222–1230. doi: 10.1021/mp200518n. [DOI] [PubMed] [Google Scholar]
- 102.Oh D., Nasrolahi Shirazi A., Northup K., Sullivan B., Tiwari R.K., Bisoffi M., Parang K. Enhanced cellular uptake of short polyarginine peptides through fatty acylation and cyclization. Mol. Pharm. 2014;11:2845–2854. doi: 10.1021/mp500203e. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 103.Swiecicki J.-M., Di Pisa M., Lippi F., Chwetzoff S., Mansuy C., Trugnan G., Chassaing G., Lavielle S., Burlina F. Unsaturated acyl chains dramatically enhanced cellular uptake by direct translocation of a minimalist oligo-arginine lipopeptide. Chem. Commun. 2015;51:14656–14659. doi: 10.1039/C5CC06116D. [DOI] [PubMed] [Google Scholar]
- 104.Mandal S., Mann G., Satish G., Brik A. Enhanced Live-Cell Delivery of Synthetic Proteins Assisted by Cell-Penetrating Peptides Fused to DABCYL. Angew. Chem. Int. Ed. 2021;60:7333–7343. doi: 10.1002/anie.202016208. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 105.Szabó I., Illien F., Dókus L.E., Yousef M.a., Baranyai Z., Bősze S., Ise S., Kawano K., Sagan S., Futaki S. Influence of the Dabcyl group on the cellular uptake of cationic peptides: Short oligoarginines as efficient cell-penetrating peptides. Amino Acids. 2021;53:1033–1049. doi: 10.1007/s00726-021-03003-w. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 106.Yousef M.a., Szabó I., Biri-Kovács B., Szeder B., Illien F., Sagan S., Bánóczi Z. Modification of Short Non-Permeable Peptides to Increase Cellular Uptake and Cytostatic Activity of Their Conjugates. Chem. Sel. 2021;6:10111–10120. doi: 10.1002/slct.202103150. [DOI] [Google Scholar]
- 107.Walrant A., Bauzá A., Girardet C., Alves I.D., Lecomte S., Illien F., Cardon S., Chaianantakul N., Pallerla M., Burlina F. Ionpair-π interactions favor cell penetration of arginine/tryptophan-rich cell-penetrating peptides. Biochim. Biophys. Acta (BBA)-Biomembr. 2020;1862:183098. doi: 10.1016/j.bbamem.2019.183098. [DOI] [PubMed] [Google Scholar]
- 108.Almeida C., Maniti O., Di Pisa M., Swiecicki J.-M., Ayala-Sanmartin J. Cholesterol re-organisation and lipid de-packing by arginine-rich cell penetrating peptides: Role in membrane translocation. PLoS ONE. 2019;14:e0210985. doi: 10.1371/journal.pone.0210985. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 109.Rydberg H.A., Matson M., Åmand H.L., Esbjorner E.K., Nordén B. Effects of tryptophan content and backbone spacing on the uptake efficiency of cell-penetrating peptides. Biochemistry. 2012;51:5531–5539. doi: 10.1021/bi300454k. [DOI] [PubMed] [Google Scholar]
- 110.Djemaa S.B., David S., Hervé-Aubert K., Falanga A., Galdiero S., Allard-Vannier E., Chourpa I., Munnier E. Formulation and in vitro evaluation of a siRNA delivery nanosystem decorated with gH625 peptide for triple negative breast cancer theranosis. Eur. J. Pharm. Biopharm. 2018;131:99–108. doi: 10.1016/j.ejpb.2018.07.024. [DOI] [PubMed] [Google Scholar]
- 111.Zhang L., Bennett W.D., Zheng T., Ouyang P.-K., Ouyang X., Qiu X., Luo A., Karttunen M., Chen P. Effect of cholesterol on cellular uptake of cancer drugs pirarubicin and ellipticine. J. Phys. Chem. B. 2016;120:3148–3156. doi: 10.1021/acs.jpcb.5b12337. [DOI] [PubMed] [Google Scholar]
- 112.Zhang L., Zhao L., Ouyang P.-K., Chen P. Insight into the role of cholesterol in modulation of morphology and mechanical properties of CHO-K1 cells: An in situ AFM study. Front. Chem. Sci. Eng. 2019;13:98–107. doi: 10.1007/s11705-018-1775-y. [DOI] [Google Scholar]
- 113.Deshpande P., Jhaveri A., Pattni B., Biswas S., Torchilin V. Transferrin and octaarginine modified dual-functional liposomes with improved cancer cell targeting and enhanced intracellular delivery for the treatment of ovarian cancer. Drug Deliv. 2018;25:517–532. doi: 10.1080/10717544.2018.1435747. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 114.Zhang X., Xu X., Li Y., Hu C., Zhang Z., Gu Z. Virion-like membrane-breaking nanoparticles with tumor-activated cell-and-tissue dual-penetration conquer impermeable cancer. Adv. Mater. 2018;30:1707240. doi: 10.1002/adma.201707240. [DOI] [PubMed] [Google Scholar]
- 115.Peng Y.-Y., Hu H., Diaz-Dussan D., Zhao J., Hao X., Narain R. Glycopolymer—Cell-Penetrating Peptide (CPP) Conjugates for Efficient Epidermal Growth Factor Receptor (EGFR) Silencing. ACS Macro Lett. 2022;11:580–587. doi: 10.1021/acsmacrolett.2c00046. [DOI] [PubMed] [Google Scholar]
- 116.Ser J., Lee J.Y., Kim Y.H., Cho H. Enhanced Efficacy of Photodynamic Therapy by Coupling a Cell-Penetrating Peptide with Methylene Blue. Int. J. Nanomed. 2020;15:5803. doi: 10.2147/IJN.S254881. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 117.Lollo G., Gonzalez-Paredes A., Garcia-Fuentes M., Calvo P., Torres D., Alonso M.J. Polyarginine nanocapsules as a potential oral peptide delivery carrier. J. Pharm. Sci. 2017;106:611–618. doi: 10.1016/j.xphs.2016.09.029. [DOI] [PubMed] [Google Scholar]
- 118.Niazi M., Zakeri-Milani P., Soleymani-Goloujeh M., Mohammadi A., Sarfraz M., Löbenberg R., Najafi-Hajivar S., Shahbazi-Mojarrad J., Farshbaf M., Valizadeh H. Effects of self-assembled cell-penetrating peptides and their nano-complexes on ABCB1 expression and activity. Iran. J. Basic Med. Sci. 2021;24:383. doi: 10.22038/ijbms.2021.51675.11727. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 119.Biswas S., Deshpande P.P., Perche F., Dodwadkar N.S., Sane S.D., Torchilin V.P. Octa-arginine-modified pegylated liposomal doxorubicin: An effective treatment strategy for non-small cell lung cancer. Cancer Lett. 2013;335:191–200. doi: 10.1016/j.canlet.2013.02.020. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 120.Wu M., Huang T., Wang J., Chen P., Mi W., Ying Y., Wang H., Zhao D., Huang S. Antilung cancer effect of ergosterol and cisplatin-loaded liposomes modified with cyclic arginine-glycine-aspartic acid and octa-arginine peptides. Medicine. 2018;97:e11916. doi: 10.1097/MD.0000000000011916. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 121.Alhakamy N.A., Dhar P., Berkland C.J. Charge type, charge spacing, and hydrophobicity of arginine-rich cell-penetrating peptides dictate gene transfection. Mol. Pharm. 2016;13:1047–1057. doi: 10.1021/acs.molpharmaceut.5b00871. [DOI] [PubMed] [Google Scholar]
- 122.Li M., Liu P., Gao G., Deng J., Pan Z., Wu X., Xie G., Yue C., Cho C.H., Ma Y. Smac therapeutic peptide nanoparticles inducing apoptosis of cancer cells for combination chemotherapy with doxorubicin. ACS Appl. Mater. Interfaces. 2015;7:8005–8012. doi: 10.1021/acsami.5b00329. [DOI] [PubMed] [Google Scholar]
- 123.Li J.-F., Huang Y., Chen R.-L., Lee H.-J. Induction of apoptosis by gene transfer of human TRAIL mediated by arginine-rich intracellular delivery peptides. Anticancer Res. 2010;30:2193–2202. [PubMed] [Google Scholar]
- 124.Takenobu T., Tomizawa K., Matsushita M., Li S.-T., Moriwaki A., Lu Y.-F., Matsui H. Development of p53 protein transduction therapy using membrane-permeable peptides and the application to oral cancer cells. Mol. Cancer Ther. 2002;1:1043–1049. [PubMed] [Google Scholar]
- 125.Takata H., Tomizawa K., Matsushita M., Matsui H. 2-methoxyestradiol enhances p53 protein transduction therapy-associated inhibition of the proliferation of oral cancer cells through the suppression of NFkappaB activity. Acta Med. Okayama. 2004;58:181–187. doi: 10.18926/AMO/32086. [DOI] [PubMed] [Google Scholar]
- 126.Yue G., Wang C., Liu B., Wu M., Huang Y., Guo Y., Ma Q. Liposomes co-delivery system of doxorubicin and astragaloside IV co-modified by folate ligand and octa-arginine polypeptide for anti-breast cancer. RSC Adv. 2020;10:11573–11581. doi: 10.1039/C9RA09040A. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 127.Bjorge J.D., Pang A., Fujita D.J. Delivery of gene targeting siRNAs to breast cancer cells using a multifunctional peptide complex that promotes both targeted delivery and endosomal release. PLoS ONE. 2017;12:e0180578. doi: 10.1371/journal.pone.0180578. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 128.Chen J., Li S., Shen Q. Folic acid and cell-penetrating peptide conjugated PLGA-PEG bifunctional nanoparticles for vincristine sulfate delivery. Eur. J. Pharm. Sci. 2012;47:430–443. doi: 10.1016/j.ejps.2012.07.002. [DOI] [PubMed] [Google Scholar]
- 129.Zhang P., Lock L.L., Cheetham A.G., Cui H. Enhanced cellular entry and efficacy of tat conjugates by rational design of the auxiliary segment. Mol. Pharm. 2014;11:964–973. doi: 10.1021/mp400619v. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 130.Cheung C.H.A., Sun X., Kanwar J.R., Bai J.-Z., Cheng L., Krissansen G.W. A cell-permeable dominant-negative survivin protein induces apoptosis and sensitizes prostate cancer cells to TNF-α therapy. Cancer Cell Int. 2010;10:1–11. doi: 10.1186/1475-2867-10-36. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 131.Goun E.A., Shinde R., Dehnert K.W., Adams-Bond A., Wender P.A., Contag C.H., Franc B.L. Intracellular cargo delivery by an octaarginine transporter adapted to target prostate cancer cells through cell surface protease activation. Bioconjug. Chem. 2006;17:787–796. doi: 10.1021/bc0503216. [DOI] [PubMed] [Google Scholar]
- 132.Liu C., Liu X., Rocchi P., Qu F., Iovanna J.L., Peng L. Arginine-terminated generation 4 PAMAM dendrimer as an effective nanovector for functional siRNA delivery in vitro and in vivo. Bioconjug. Chem. 2014;25:521–532. doi: 10.1021/bc4005156. [DOI] [PubMed] [Google Scholar]
- 133.Zhou J., Liu W., Pong R.-C., Hao G., Sun X., Hsieh J.-T. Analysis of oligo-arginine cell-permeable peptides uptake by prostate cells. Amino Acids. 2012;42:1253–1260. doi: 10.1007/s00726-010-0817-7. [DOI] [PubMed] [Google Scholar]
- 134.Okada H. Nanomaterials in Pharmacology. Springer; Berlin/Heidelberg, Germany: 2016. Depot Microcapsules Containing Biologic Nanoparticles and Cytoplasm-Responsive Nanocarriers for Nucleotides; pp. 311–332. [Google Scholar]
- 135.Zhong G., Xu Z., Yang R., Zhang S., Li L., Wu M., Liu H., Zhen Y. An arginine-rich cell penetrating peptide contained anti-gelatinase scFv-LDM fusion protein shows potent antitumor efficacy in pancreatic cancer. J. Cancer. 2018;9:674. doi: 10.7150/jca.22277. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 136.Takara K., Hatakeyama H., Kibria G., Ohga N., Hida K., Harashima H. Size-controlled, dual-ligand modified liposomes that target the tumor vasculature show promise for use in drug-resistant cancer therapy. J. Control. Release. 2012;162:225–232. doi: 10.1016/j.jconrel.2012.06.019. [DOI] [PubMed] [Google Scholar]
- 137.Togashi Y., Shitara K., Nishikawa H. Regulatory T cells in cancer immunosuppression—Implications for anticancer therapy. Nat. Rev. Clin. Oncol. 2019;16:356–371. doi: 10.1038/s41571-019-0175-7. [DOI] [PubMed] [Google Scholar]
- 138.Dominguez-Villar M., Hafler D.A. Regulatory T cells in autoimmune disease. Nat. Immunol. 2018;19:665–673. doi: 10.1038/s41590-018-0120-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 139.Grant C.R., Liberal R., Mieli-Vergani G., Vergani D., Longhi M.S. Regulatory T-cells in autoimmune diseases: Challenges, controversies and—yet—unanswered questions. Autoimmun. Rev. 2015;14:105–116. doi: 10.1016/j.autrev.2014.10.012. [DOI] [PubMed] [Google Scholar]
- 140.Bluestone J.A., Trotta E., Xu D. The therapeutic potential of regulatory T cells for the treatment of autoimmune disease. Expert Opin. Ther. Targets. 2015;19:1091–1103. doi: 10.1517/14728222.2015.1037282. [DOI] [PubMed] [Google Scholar]
- 141.Romano M., Fanelli G., Albany C.J., Giganti G., Lombardi G. Past, present, and future of regulatory T cell therapy in transplantation and autoimmunity. Front. Immunol. 2019;10:43. doi: 10.3389/fimmu.2019.00043. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 142.Ohue Y., Nishikawa H. Regulatory T (Treg) cells in cancer: Can Treg cells be a new therapeutic target? Cancer Sci. 2019;110:2080–2089. doi: 10.1111/cas.14069. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 143.Morse M.A., Hobeika A., Serra D., Aird K., McKinney M., Aldrich A., Clay T., Mourich D., Lyerly H.K., Iversen P.L. Depleting regulatory T cells with arginine-rich, cell-penetrating, peptide-conjugated morpholino oligomer targeting FOXP3 inhibits regulatory T-cell function. Cancer Gene Ther. 2012;19:30–37. doi: 10.1038/cgt.2011.63. [DOI] [PubMed] [Google Scholar]
- 144.Xiao D., Huang Y., Huang S., Zhuang J., Chen P., Wang Y., Zhang L. Targeted delivery of cancer drug paclitaxel to chordomas tumor cells via an RNA nanoparticle harboring an EGFR aptamer. Colloids Surf. B Biointerfaces. 2022;212:112366. doi: 10.1016/j.colsurfb.2022.112366. [DOI] [PubMed] [Google Scholar]
- 145.Okuda A., Futaki S. Cell Penetrating Peptides. Springer; Berlin/Heidelberg, Germany: 2022. Protein delivery to cytosol by cell-penetrating peptide bearing tandem repeat penetration-accelerating sequence; pp. 265–273. [DOI] [PubMed] [Google Scholar]
- 146.Chen J.X., Xu X.D., Yang S., Yang J., Zhuo R.X., Zhang X.Z. Self-Assembled BolA-like Amphiphilic Peptides as Viral-Mimetic Gene Vectors for Cancer Cell Targeted Gene Delivery. Macromol. Biosci. 2013;13:84–92. doi: 10.1002/mabi.201200283. [DOI] [PubMed] [Google Scholar]
- 147.Liu Y., Lu Z., Mei L., Yu Q., Tai X., Wang Y., Shi K., Zhang Z., He Q. Tandem peptide based on structural modification of poly-arginine for enhancing tumor targeting efficiency and therapeutic effect. ACS Appl. Mater. Interfaces. 2017;9:2083–2092. doi: 10.1021/acsami.6b12611. [DOI] [PubMed] [Google Scholar]
- 148.Ji T., Ding Y., Zhao Y., Wang J., Qin H., Liu X., Lang J., Zhao R., Zhang Y., Shi J. Peptide assembly integration of fibroblast-targeting and cell-penetration features for enhanced antitumor drug delivery. Adv. Mater. 2015;27:1865–1873. doi: 10.1002/adma.201404715. [DOI] [PubMed] [Google Scholar]
- 149.Cheng Y.-J., Cheng H., Zhao X., Xu X.-D., Zhuo R.-X., He F. Self-assembled micelles of a multi-functional amphiphilic fusion (MFAF) peptide for targeted cancer therapy. Polym. Chem. 2015;6:3512–3520. doi: 10.1039/C5PY00125K. [DOI] [Google Scholar]
- 150.Yang C., Ng C.-T., Li D., Zhang L. Targeting indoleamine 2, 3-dioxygenase 1: Fighting cancers via dormancy regulation. Front. Immunol. 2021;12:725204. doi: 10.3389/fimmu.2021.725204. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 151.Zhang L., Jiang C., Zeng F., Zhou H., Li D., He X., Shen S., Yang X., Wang J. A polymeric nanocarrier with a tumor acidity-activatable arginine-rich (R 9) peptide for enhanced drug delivery. Biomater. Sci. 2020;8:2255–2263. doi: 10.1039/D0BM00069H. [DOI] [PubMed] [Google Scholar]
- 152.Wang S., Li F., Qiao R., Hu X., Liao H., Chen L., Wu J., Wu H., Zhao M., Liu J. Arginine-rich manganese silicate nanobubbles as a ferroptosis-inducing agent for tumor-targeted theranostics. Acs Nano. 2018;12:12380–12392. doi: 10.1021/acsnano.8b06399. [DOI] [PubMed] [Google Scholar]
- 153.Bozym R.A., Thompson R.B., Stoddard A.K., Fierke C.A. Measuring picomolar intracellular exchangeable zinc in PC-12 cells using a ratiometric fluorescence biosensor. ACS Chem. Biol. 2006;1:103–111. doi: 10.1021/cb500043a. [DOI] [PubMed] [Google Scholar]
- 154.Xia M.-C., Cai L., Zhang S., Zhang X. A cell-penetrating ratiometric probe for simultaneous measurement of lysosomal and cytosolic pH change. Talanta. 2018;178:355–361. doi: 10.1016/j.talanta.2017.09.044. [DOI] [PubMed] [Google Scholar]
- 155.Xia M.-C., Cai L., Yang Y., Zhang S., Zhang X. Tuning the p K a of Carboxyfluorescein with Arginine-Rich Cell-Penetrating Peptides for Intracellular pH Imaging. Anal. Chem. 2019;91:9168–9173. doi: 10.1021/acs.analchem.9b01864. [DOI] [PubMed] [Google Scholar]
- 156.Webster A., Compton S.J., Aylott J.W. Optical calcium sensors: Development of a generic method for their introduction to the cell using conjugated cell penetrating peptides. Analyst. 2005;130:163–170. doi: 10.1039/b413725f. [DOI] [PubMed] [Google Scholar]
- 157.Uri A., Lust M., Vaasa A., Lavogina D., Viht K., Enkvist E. Bisubstrate fluorescent probes and biosensors in binding assays for HTS of protein kinase inhibitors. Biochim. Biophys. Acta (BBA)-Proteins Proteom. 2010;1804:541–546. doi: 10.1016/j.bbapap.2009.10.019. [DOI] [PubMed] [Google Scholar]
- 158.Hao G., Zhou J., Guo Y., Long M.A., Anthony T., Stanfield J., Hsieh J.-T., Sun X. A cell permeable peptide analog as a potential-specific PET imaging probe for prostate cancer detection. Amino Acids. 2011;41:1093–1101. doi: 10.1007/s00726-010-0515-5. [DOI] [PubMed] [Google Scholar]
- 159.Lee H., Lim S.I., Shin S.-H., Lim Y., Koh J.W., Yang S. Conjugation of cell-penetrating peptides to antimicrobial peptides enhances antibacterial activity. ACS Omega. 2019;4:15694–15701. doi: 10.1021/acsomega.9b02278. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 160.Grishin S.Y., Domnin P.A., Kravchenko S.V., Azev V.N., Mustaeva L.G., Gorbunova E.Y., Kobyakova M.I., Surin A.K., Makarova M.A., Kurpe S.R. Is It Possible to Create Antimicrobial Peptides Based on the Amyloidogenic Sequence of Ribosomal S1 Protein of P. aeruginosa? Int. J. Mol. Sci. 2021;22:9776. doi: 10.3390/ijms22189776. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 161.Kurpe S.R., Grishin S.Y., Surin A.K., Selivanova O.M., Fadeev R.S., Dzhus U.F., Gorbunova E.Y., Mustaeva L.G., Azev V.N., Galzitskaya O.V. Antimicrobial and amyloidogenic activity of peptides synthesized on the basis of the ribosomal S1 protein from Thermus thermophilus. Int. J. Mol. Sci. 2020;21:6382. doi: 10.3390/ijms21176382. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 162.Sharma G., Modgil A., Sun C., Singh J. Grafting of cell-penetrating peptide to receptor-targeted liposomes improves their transfection efficiency and transport across blood-brain barrier model. J. Pharm. Sci. 2012;101:2468–2478. doi: 10.1002/jps.23152. [DOI] [PubMed] [Google Scholar]
- 163.Gotanda Y., Wei F.-Y., Harada H., Ohta K., Nakamura K.-i., Tomizawa K., Ushijima K. Efficient transduction of 11 poly-arginine peptide in an ischemic lesion of mouse brain. J. Stroke Cerebrovasc. Dis. Off. J. Natl. Stroke Assoc. 2014;23:2023–2030. doi: 10.1016/j.jstrokecerebrovasdis.2014.02.027. [DOI] [PubMed] [Google Scholar]
- 164.Tian Y., Mi G., Chen Q., Chaurasiya B., Li Y., Shi D., Zhang Y., Webster T.J., Sun C., Shen Y. Acid-Induced Activated Cell-Penetrating Peptide-Modified Cholesterol-Conjugated Polyoxyethylene Sorbitol Oleate Mixed Micelles for pH-Triggered Drug Release and Efficient Brain Tumor Targeting Based on a Charge Reversal Mechanism. ACS Appl. Mater. Interfaces. 2018;10:43411–43428. doi: 10.1021/acsami.8b15147. [DOI] [PubMed] [Google Scholar]
- 165.Yao L., Xu J., Zhang L., Liu L., Zhang L. Nanoencapsulation of anthocyanin by an amphiphilic peptide for stability enhancement. Food Hydrocoll. 2021;118:106741. doi: 10.1016/j.foodhyd.2021.106741. [DOI] [Google Scholar]
- 166.Yao L., Xu J., Zhang L., Zheng T., Liu L., Zhang L. Physicochemical stability-increasing effects of anthocyanin via a co-assembly approach with an amphiphilic peptide. Food Chem. 2021;362:130101. doi: 10.1016/j.foodchem.2021.130101. [DOI] [PubMed] [Google Scholar]
- 167.Kim S., Kang J.Y., Balance W.C., Sutton B.P., Shin D.H., Jang K.H., Shin M., Kong H., Kim J.W. Fabrication of cell penetrating peptide-conjugated bacterial cellulose nanofibrils with remarkable skin adhesion and water retention performance. Int. J. Pharm. 2021;600:120476. doi: 10.1016/j.ijpharm.2021.120476. [DOI] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Data Availability Statement
All relevant data are within the manuscript.