Table 4.
Polymorphisms in B-cell epitopes of the Pvs230 gene from global isolates
| No | AA position | Sequence | S | NS | SP | π ± SD | H | Hd ± SD | dN–dS | |
|---|---|---|---|---|---|---|---|---|---|---|
| 1 | E229–V275 | EAGASDGVFDKVDEAFETTIKGDGNVLQASDPEVETFASSNTNKEYV | 3 | 2 | 1 | 0.006 ± 0.000 | 6 | 0.590 ± 0.024 | 0.007 | |
| 2 | T333–A354 | TLVNANEGSEEKKESLKEKRLA | 0 | 0 | 0 | 0.000 ± 0.000 | 1 | 0.000 ± 0.000 | 0 | |
| 3 | E419–M448 | EPYGQSVKGCNYTGKGKHFFSYDYEEGADM | 1 | 0 | 1 | 0.000 ± 0.000 | 2 | 0.015 ± 0.010 | − 0.001 | |
| 4 | N623–K649 | NKAKYANLEMIPKMLKEEKKKKKNVLK | 2 | 1 | 1 | 0.006 ± 0.000 | 3 | 0.457 ± 0.018 | − 0.032 | |
| 5 | K693–N764 | KKNSLFKNHKDSSYFDEVASPSDGFVKLLSFLDAQDTVILNEQVSDLTISTEQSTEDLFTLQLQIPPYITTN | 3 | 3 | 0 | 0.001 ± 0.000 | 3 | 0.071 ± 0.021 | 0.001 | |
| 6 | N792–E818 | NEHLVKGCNFSDGKMEHFTNNVGSTGE | 1 | 0 | 1 | 0.000 ± 0.000 | 2 | 0.022 ± 0.012 | − 0.001 | |
| 7 | K836–S851 | KTVLPPSDEAEDSATS | 1 | 1 | 0 | 0.001 ± 0.000 | 2 | 0.064 ± 0.020 | 0.002 |
S, number of polymorphic (segregating) sites; NS, number of sites with non-synonymous polymorphisms; SP, number of sites with synonymous polymorphisms; π, nucleotide diversity; H, number of haplotypes; Hd, haplotype diversity; SD, standard deviation