Table 2.
Significantly differentially expressed mass peaks with peptide identification by LTQ-Orbitrap-MS.
| Mass, m/za | FDR-adjusted p-value | PE-positive (n = 30) | PE-negative (n = 30) | FCc | Peptide ID and sequence | ||
|---|---|---|---|---|---|---|---|
| Mean | SDb | Mean | SD | ||||
| 2026.94 | 1.02E-09 | 284.3 | 171.3 | 19.3 | 8.5 | 14.76 | ITIH4: QLGLPGPPDVPDHAAYHPF |
| 1876.85 | 1.33E-09 | 105.7 | 65.1 | 16.9 | 10.3 | 6.24 | Complement C3: YSIITPNILRLESEET |
| 3276.45 | 1.30E-09 | 152.9 | 59.9 | 34.6 | 22.6 | 4.42 | FGA: SSSYSKQFTSSTSYNRGDSTFESKSYKM (+15.99)Ad |
| 3260.46 | 1.23E-09 | 1117.7 | 419.9 | 270.3 | 164.9 | 4.14 | FGA: SSSYSKQFTSSTSYNRGDSTFESKSYKMA |
| 2192.10 | 1.56E-03 | 113.2 | 103.1 | 45.6 | 32.8 | 2.48 | Complement C3: SPMYSIITPNILRLESEET |
| 1033.40 | 1.62E-03 | 110.2 | 63.9 | 46.2 | 31.1 | 2.38 | FGA: SSSYSKQFT |
| 2051.08 | 5.75E-04 | 436.8 | 330.0 | 218.4 | 260.1 | 2.00 | ITIH4: YYLQGAKIPKPEASFSPR |
| 5900.70 | 1.56E-04 | 430.0 | 282.0 | 1065.5 | 718.6 | 0.40 | FGA: SSSYSKQFTSTSYNRGDSTFESKSYKMADEAGS-EADHEGTHSTKRGHAKSRPV |
a
Mass determined by LTQ-Orbitrap-MS;
b
standard deviation;
c
fold change;
d
(+15.99) indicating oxidation on the methylsulfinyl group of methionine residue. ITIH4, Inter-alpha-trypsin inhibitor heavy chain H4; FGA, Fibrinogen alpha chain.