Appendix 1—key resources table.
| Reagent type (species) or resource | Designation | Source or reference | Identifiers | Additional information |
|---|---|---|---|---|
| Strain and strain background (Xenopus tropicalis) | Tg(pbin7LEF-dGFP) | National Xenopus Resources at MBL |
NXR_1094 | |
| Strain and strain background (Xenopus laevis) | X. laevis | NASCO | LM00535 and LM00715 | |
| Strain and strain background (Escherichia coli) | BL21 Gold (DE3) | Agilent | 230132 | |
| Strain and strain background (E. coli) | XL-10 Gold | Agilent | 200314 | |
| Strain and strain background (E. coli) | DH5-alpha | NEB | C2987 | |
| Cell line (M. musculus) | Leading Light Wnt Reporter Cell line-TCF/ LEF luciferase 3T3 mouse fibroblast |
Enzo Life Sciences | ENZ-61001–0001 | |
| Cell line (Homo-sapiens) | Human embryonic kidney 293 (HEK293T) | ATCC | CRL-3216 | |
| Cell line (Homo-sapiens) | HeLa | ATCC | CCL-2 | |
| Cell line (Homo-sapiens) | Human colorectal cancer (HCT 116) |
ATCC | CCL-247 | |
| Cell line (Homo-sapiens) | Human colorectal cancer (DLD-1) |
ATCC | CCL-221 | |
| Transfected construct (M. musculus and human) | siRNA to TNPO1 & 2 | Thermo Fisher | ||
| Antibody | Anti-β-catenin (mouse monoclonal) | Santa Cruz | sc-7963 HRP, RRID:AB_626807 |
WB (1:1000) |
| Antibody | Anti-β-actin (mouse monoclonal) | Santa Cruz | sc-47778 HRP, RRID:AB_2714189 |
WB (1:10000) |
| Antibody | Anti-GFP (mouse monoclonal) | Santa Cruz | sc-9996 HRP, RRID:AB_627695 |
WB (1:1000) |
| Antibody | Anti-Transportin-1 (mouse monoclonal) | Abcam | ab10303, RRID:AB_2206878 |
WB (1:1000) |
| Antibody | Anti-Transportin-2 (Rabbit polyclonal) | Proteintech | 17831–1-AP, RRID:AB_10598481 |
WB (1:3000) |
| Antibody | Anti-LaminB1 (Rabbit polyclonal) | Abcam | Ab16048, RRID:AB_443298 |
IF (1:500) WB (1:1000) |
| Antibody | Anti-GAPDH (mouse monoclonal) | Santa Cruz | sc-47724 HRP; RRID:AB_627678 |
WB (1:3000) |
| Sequence-based reagent | tnpo1 CRISPR 1 | This paper | Oligonucleotides | ttctaatacgactcactataGGCATGGGGGCCACCTCTTGgttttagagctagaa |
| Sequence-based reagent | tnpo1 CRISPR 2 | This paper | Oligonucleotides | ttctaatacgactcactataGGGTTACGTTTGTCCTCAAGgttttagagctagaa |
| Sequence-based reagent | tnpo2 CRISPR 1 | This paper | Oligonucleotides | ttctaatacgactcactataGGGCGTTTAGCCGCGTTCTAgttttagagctagaa |
| Sequence-based reagent | tnpo2 CRISPR 2 | This paper | Oligonucleotides | ttctaatacgactcactataGGCGTCATGGATGAGTCCGAgttttagagctagaa |
| Sequence-based reagent | siRNA: negative control | Thermo Fisher | 4390843 | Silencer Select |
| Sequence-based reagent | siRNA: mouse TNPO1 | Thermo Fisher | s108857 | Silencer Select |
| Sequence-based reagent | siRNA: mouse TNPO2 | Thermo Fisher | s102754 | Silencer Select |
| Sequence-based reagent | siRNA: human TNPO1 | Thermo Fisher | s7934 | Silencer Select |
| Sequence-based reagent | siRNA: human TNPO2 | Thermo Fisher | s26881 | Silencer Select |
| Peptide, recombinant protein | M9M-A | LifeTein | Custom | N-GGSYNDFGNYNNQSSNAAAAKGGNFGGAFEAAANPTKR-C |
| Peptide, recombinant protein | M9M | LifeTein | Custom | N-GGSYNDFGNYNNQSSNFGPMKGGNFGGRFEPYANPTKR-C |
| Commercial assay or kit | Luciferase Assay System | Promega | E1500 | |
| Commercial assay or kit | NE-PER Nuclear Cytoplasmic Extraction Reagents | Thermo Scientific | 78833 | |
| Commercial assay or kit | jetPRIME | Polyplus transfection | 114–15 | |
| Commercial assay or kit | ProteoJuice Protein Transfection | Millipore Sigma | 71281 | |
| Commercial assay or kit | MycoAlert Detection Kit | Lonza | LT07-118 | |
| Chemical compound and drug | Rapamycin | Fisher scientific | AAJ62473MF | |
| Chemical compound and drug | Glutathione Sepharose 4B | Millipore Sigma | GE17-0756-01 | |
| Chemical compound and drug | Protease Inhibitor Cocktail mix | Millipore Sigma | P8340-5ML | |
| Chemical compound and drug | ProTEV Plus | Promega | V6101 | |
| Chemical compound and drug | NEBExpress Ni-NTA Magnetic Beads | NEB | S1423S | |
| Chemical compound and drug | Isopropyl β-d-1-thiogalacto pyranoside (IPTG) | Thermo Fisher | 15529019 | |
| Software and algorithm | Fiji | ImageJ | https://imagej.net/Fiji | |
| Software and algorithm | Prism 9 | Graphpad | https://www.graphpad.com/ |