Table 1.
Physicochemical properties of synthetic croCATHs and human LL-37. Properties were calculated using the Peptides and modlAMP packages in R and Python, respectively.
| Name | Sequence | Length | MW | Charge | HI | HM |
|---|---|---|---|---|---|---|
| As-CATH7 | KRVNWRKVGRNTALGASYVLSFLG | 24 | 2693 | 4.76 | −0.15 | 0.25 |
| As-CATH8 | KRVNWAKVGRTALKLLPYIFG | 21 | 2431 | 4.76 | 0.06 | 0.29 |
| Gg-CATH5 | TRRKWWKKVLNGAIKIAPYILD | 22 | 2670 | 4.76 | −0.39 | 0.40 |
| Gg-CATH7 | KRVNWRKVGLGASYVMSWLG | 20 | 2308 | 3.76 | −0.11 | 0.23 |
| LL-37 | [LL-37, 37 aa] | 37 | 4493 | 5.76 | −0.72 | 0.56 |
As: A. sinensis, Gg: G. gangeticus. Length: number of amino acid residues; MW: theoretical molecular weight in daltons, rounded values; charge: net charge according to the Bjellqvist; HI: hydrophobicity index according to the Kyte–Doolittle scale scale; HM: mean hydrophobic moment (amphipathicity), numerical values of the vectors shown in the wheel representations in Figure 2.