Table 1.
List of some HBV therapeutic vaccine clinical trials related to platform technology.
| Study Type | Type of Vaccine | Type of HBV Antigen |
Intervention | Reference |
|---|---|---|---|---|
| Non-randomized | Recombinant vaccines | S | Hepavax-Gene TF | [51] |
| Non-randomized | Recombinant vaccines | Pre-S2, S | ENGERIX-B | [52] |
| Non-randomized | Recombinant vaccines | S, C | HBsAg + HBcAg | [53] |
| Randomized | Recombinant vaccines | S, C | NASVAC (HBsAg + HBcAg) | [54] |
| Randomized | Immune complex vaccines | S | YIC (HBsAg-HBIG + allum adjuvant) | [55] |
| Randomized | Immune complex vaccines | S | YIC (HBsAg-HBIG + allum adjuvant) | [56] |
| Randomized | DNA vaccines | Pre-S2, S | CMV-S2.S with NUC | [57] |
| Randomized | DNA vaccines | Pre-S2, S | DNA pSG2.HBs and MVA vaccine (MVA.HBs) Vaccination alone or with NUC | [58] |
| Randomized | DNA vaccines | Pre-S2, S | ED-DNA.PS2.S with NUC | [59] |
| Randomized | DNA vaccines | Pre-S2, S | ED-DNA.PS2.S with NUC | [43] |
| Randomized | DNA vaccines | Pre-S2, S, C, P | HB-110 with NUC | [60] |
| Randomized | Yeast-derived vaccines | S, C, X | GS-4774 with NUC | [61] |
| Non-randomized | Yeast-derived vaccines | S, C, X | GS-4774 with NUC | [62] |
| Randomized | Yeast-derived vaccines | S, C, X | GS-4774 with NUC | [63] |
| Randomized | Adenoviral vectored vaccines | S, C, P | Human adenoviral type 5 vector (TG1050) with NUC | [42] |
C = HBV core coding region, Core (18–25) amino acid sequence = KSSQYIKANSKFIGITEAAAFLPSDFFPSV, ELISpot = enzyme-linked immunospot assay, HBcAg = HBV core antigen, HBeAg = HBV e antigen, HBsAg = HBV surface antigen, ICS = intracellular staining assay, IFN = interferon therapy, NUC = nucleotide therapy, P = HBV polymerase coding region, Pre-S1 = HBV large surface/pre-surface-1 coding region, Pre-S2 = HBV medium surface/pre-surface-2 coding region, S = HBV small surface coding region.