Abstract
Finding an effective drug to prevent or treat COVID-19 is of utmost importance in tcurrent pandemic. Since developing a new treatment takes a significant amount of time, drug repurposing can be an effective option for achieving a rapid response. This study used a combined in silico virtual screening protocol for candidate SARS-CoV-2 PLpro inhibitors. The Drugbank database was searched first, using the Informational Spectrum Method for Small Molecules, followed by molecular docking. Gramicidin D was selected as a peptide drug, showing the best in silico interaction profile with PLpro. After the expression and purification of PLpro, gramicidin D was screened for protease inhibition in vitro and was found to be active against PLpro. The current study’s findings are significant because it is critical to identify COVID-19 therapies that are efficient, affordable, and have a favorable safety profile.
Keywords: anti SARS-CoV-2, PLpro, COVID-19, gramicidin D, PLpro candidate inhibitor
1. Introduction
Finding an effective drug to prevent or treat COVID-19 is of utmost importance in the current pandemic. Developing a new treatment takes a significant amount of time; hence, repurposing drugs may be an efficient option for achieving a rapid response.
The inhibition of the virus papain-like protease (PLpro), which is essential in the life cycle of coronaviruses, has been considered a possible way to treat COVID-19 patients infected with SARS-CoV-2 [1]. The PLpro is required for viral polyprotein processing to generate a functional replicase complex and enable viral spread [2]. PLpro is a monomer with a canonical catalytic triad of Cys111/His272/Asp286 at its active site [2,3]. PLpro cleaves ubiquitin and ISG15 to avoid host antiviral immune responses [3]. SARS-CoV-2 has a positive-sense, single-strand RNA genome with at least ten open reading frames (ORFs). The biggest, ORF1ab, which encodes two large overlapping polyproteins, pp1a and pp1ab, is required for viral replication and transcription and is cleaved by proteases to produce 16 non-structural proteins (NSP). The 3–6 NSP3 encodes PLpro, which detects the LXGG tetra-peptide motif between viral proteins nsp1 and nsp2, and nsp2 and nsp3. It processes the replicase polyprotein 1a (pp1a) and replicase polyprotein 1ab (pp1ab) on the N-termini into nsp1, nsp2, and nsp3, essential for viral replication [4]. Small peptides, as substrate-based inhibitors of the SARS-CoV-2 PLpro enzyme, may be capable of unraveling COVID-19 disease [5]. Several rationally designed short peptides have been developed as as substrate-based inhibitors of PLpro of SARS family viruses, demonstrating high selectivity for PLpro binding and impeding viral multiplication [6]. Recently, two tetra-peptides were identified as CoV-2 PLpro inhibitors that suppress viral replication in vitro and in cell lines [7]. The small peptides, known as antimicrobial peptides (AMPs), widely exist in nature and are an essential part of the innate immune systems of different organisms [8]. AMPs are the host’s first line of defense against pathogens, with a wide range of antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi, and viruses [9]. They have a reputation as promising candidates for repurposing as antiviral agents, some of which have been documented to inhibit SARS-CoV-2 [10]. Because AMPs are less likely to develop resistance, they are considered promising in the fight against infectious diseases [9,11]. However, only a few AMPs (out of over three thousand discovered) have been approved by the FDA, with gramicidins, polymyxins, and nisins being the best-studied [9,12]. Gramicidins were previously shown to display antiviral activity against HIV and herpes simplex virus types 1 and 2 [13,14]. Gramicidin S, an antibacterial peptide with potent antibacterial and fungicidal activity [15], has recently been shown to have anti-SARS-CoV-2 activity in vitro [16]. According to the results of another molecular docking study, gramicidin S may have direct antiviral activity against the SARS-CoV-2 virus by binding to the SARS-CoV-2 spike glycoprotein and SARS-CoV-2 PLpro [17].
In this study, as an extension of our previous drug repurposing research, we identified gramicidin D using the same in silico approach as in our previous study searching for SARS-CoV-2 PLpro inhibitors [18]. Gramicidin D was selected as the peptide drug with the best in silico interaction profile with PLpro. In further experimental testing, it was found to be active against PLpro in vitro.
2. Results
To identify potential PLpro inhibitor candidates, we employed a virtual screening protocol with combined sequential filters based on long-range and short-range interactions, using the same approach as in our previous study [18]. Small molecule–protein interactions were examined using the informational spectrum method (ISM) for small molecules (ISM-SM). To discover potential PLpro inhibitors among approved peptide drug candidates, we further searched Drugbank [19] using the ISM SM method [19] for approved drug candidates, using the frequencies characteristic of PLpro F(0.383) and F(0.279) that we proposed in our previous study. As a result of this analysis, gramicidin D was selected as the best PLpro peptide drug candidate inhibitor.
2.1. Molecular Docking
Since the activity of gramicidin S against SARS-CoV-2 was reported in addition to its in silico activity against PLpro we compared the binding affinity of these two peptides by molecular docking. We carried out the molecular docking of gramicidin D and gramicidin S into the site of reported co-crystallized PLpro inhibitors, using the PLpro–GRL 0617 complex structure (PDB ID 7CJM) [20]. The calculated binding energy from the docking poses for both molecules is −6.9 kcal/mol (Ki = 8.65 μM). Gramicidin D shows the presence of anion–π interaction with Asp 164, which is an important residue in terms of catalytic efficiency. Compared with the inhibitor GRL 0617, it interacts with Pro 247 and Pro 248 (Figure 6, Table 2 in Ref [18]). Additionally, interaction with Glu 167 was reported in the cases of Epicriptine and Ergometrine [18]. The docked conformation of gramicidin D is presented in Figure 1.
Figure 1.
Gramicidin D docked into the catalytic site of PLpro. Green lines: hydrogen bonds; orange: electrostatic (including Pi-anion); yellow: Pi-sulfur; magenta: Pi-alkyl.
Gramicidin S shows interactions with Arg 166, Glu 167, Ser 170, and Leu 199 (Figure 2). Despite forming fewer intermolecular interactions with the PLpro catalytic site compared with gramicidin D, the binding energies have the same value. Additionally, the contribution of hydrophobic interactions is greater in the case of gramicidin S than in the case of gramicidin D (Table 1). One would expect a stronger binding of gramicidin D to the catalytic site, but this is not the case. This is probably due to the cyclic constitution of gramicidin S and therefore less change in entropy during the binding process:
| ΔG = ΔH − TΔS |
Figure 2.
Gramicidin S docked into the catalytic site of PLpro. Green lines: hydrogen bonds; orange: electrostatic (including Pi-anion); yellow: Pi-sulfur; magenta: Pi-alkyl.
Table 1.
Intermolecular interactions between SARS-CoV-2 PLpro and gramicidin D/gramicidin S.
| Amino Acid Residue | Interaction Type | Gramicidin D | Gramicidin S |
|---|---|---|---|
| ASP164 | Pi-anion | Yes | No |
| ARG166 | Conventional hydrogen bond | Yes | Yes |
| GLU167 | Pi-anion | Yes | Yes |
| SER170 | Conventional hydrogen bond | Yes | No |
| TYR171 | Pi-alkyl | Yes | No |
| LEU199 | Pi-alkyl | No | Yes |
| MET206 | Conventional hydrogen bond, Pi-sulfur | Yes | No |
| TYR207 | Pi-alkyl | No | Yes |
| PRO247 | Pi-alkyl | Yes | No |
| PRO248 | Conventional hydrogen bond, Pi-alkyl | Yes | No |
| THR301 | Hydrogen bond | Yes | No |
As Gibbs free energy should have a negative value, in the binding process, by lowering the degrees of freedom of a ligand (causing a negative ΔS), a more drastic change is found in the case of a linearly flexible molecule than in the case of a cyclically flexible one. Therefore, the TΔS term would be more negative in the case of gramicidin D, producing a more positive contribution (−TΔS) to the binding energy.
The summary of protein–ligand intermolecular interactions for both gramicidin D and gramicidin S is presented in Table 1.
As presented in Figure 3, there is a greater negative electrostatic potential present on the surface of gramicidin D than gramicidin S. However, the gramicidin S is a double-positively charged molecule. From the constitution of the surface amino acid residues of PLpro, it seems to be more hydrophobic than hydrophilic and more partially negatively charged. Therefore, one would expect gramicidin S to be a better binding ligand than gramicidin D. However, due to the complicated variation in electrostatic potential on the protein surface and the presence of negative and positive residues (Asp and Arg), the overall contact surface of gramicidin D is larger. Therefore, along with entropy effects, the difference in binding energy between two molecules is also due to the desolvation process, which should be higher for the charged species. Altogether, these effects manifest as protein–ligand contact surface interactions, solvation, and entropy effects.
Figure 3.
The ESP surfaces of gramicidin D (a) and gramicidin S (b). ESP potential is presented from a value of −20 (red) to −10 (blue).
2.2. Purification of PLpro
PLpro was expressed in Escherichia coli BL21 STAR cells and purified to homogeneity by Ni-NTA affinity chromatography. The process of purification was analyzed by SDS electrophoresis on a 10% gel. The estimated molecular mass of the purified proteins is approximately 60 kDa, which is in accordance with the literature data for the weight of one GST-tagged PLpro subunit, around 62 kDa.
2.3. PLpro Inhibition with Gramicidin D
The results of the present study show that gramicidin D has inhibitory activity against PLpro. With the addition of gramicidin D at 0.0025 mM, inhibition was around 50%, while increasing the concentration to 0.06 mM inhibited 93% of the original proteolytic activity of the PLpro protease of the SARS-CoV-2 virus (Table 2, Figure 4).
Table 2.
Kinetic data for the inhibition of PLPro by gramicidin D.
| dRFU | Stdev | Stdev% | %Rezid. | %Inhibition | |
|---|---|---|---|---|---|
| 0 | 4274.67 | 660.27 | 15.45 | 100 | 0 |
| 0.0025 | 2087 | 25.46 | 1.22 | 48.82 | 51.18 |
| 0.01 | 1837 | 1.41 | 0.077 | 42.97 | 57.03 |
| 0.04 | 397.5 | 17.68 | 4.45 | 9.30 | 90.7 |
| 0.06 | 292.5 | 21.92 | 7.49 | 6.84 | 93.16 |
Figure 4.
Inhibition (%) and activity (%) of PLpro with different concentrations of gramicidin D.
Drug resistance is an important issue in health care, affecting therapeutic outcomes and necessitating novel drug design approaches. In silico drug repurposing is a quick and secure method for combating COVID-19. The SARS-CoV-2 PLpro is a desirable therapeutic target because it promotes viral replication and modifies the host immune system, inhibiting the host’s antiviral innate immunological response and promoting antiviral immunity [2].
In the current study, an in silico strategy for repurposing approved drugs is employed to fight COVID-19. This study is extended to in silico drug repurposing analysis, from which we have identified the peptide drug gramicidin D as a candidate SARS-CoV-2 PLpro inhibitor using the same in silico approach as in our previous study [18]. We used a virtual screening protocol with combined sequential filters based on long-range and short-range interactions to select candidates for PLpro inhibitors. We examined small molecule–protein interactions using ISM-SM. This virtual technique may swiftly scan vast molecular libraries with minimal data preparation, using only the protein sequence and drug candidate’s SMILES molecular annotation. First, the Drugbank database was searched in silico using ISM-SM, followed by molecular docking. We found that gramicidin S and D have similar binding affinity, which is similar to the average docking scores of the compounds that bind the PLpro inhibitor binding site obtained from our previous in silico study, identified as the best PLpro candidate inhibitors [18]. In further experimental testing, gramicidin D was found to be active against PLpro in vitro. That was not surprising, given that the presence of amino acid building blocks is especially seen in drugs and drug candidates, whose molecular targets naturally bind to amino acids or peptide structures. This is particularly accurate for protease inhibitors in antiviral therapy [21]. Gramicidin belongs to class the of AMPs, the host’s first line of defense against infections, with broad antimicrobial activity [9] and promise in the fight against infectious diseases because they are less susceptible to resistance [11]. Gramicidin D is among the few AMPs approved by the FDA, out of over three thousand discovered [9,12]. Gramicidin D is a well-tolerated antibiotic, but its application is limited to topical application due to its hemolytic side effect [22]. It is applied locally to treat infected wounds as well as eye, nose, and throat infections [23].
During the early stage of COVID-19, nasal multiciliated epithelial cells in the upper airway were discovered to be the primary target for SARS-CoV-2 infection and replication, implying that targeting these cells could be an excellent strategy for preventing SARS-CoV-2 transmission [24]. As a possible therapeutic treatment option, targeted intracellular drug delivery via nasal spray was proposed [24,25,26]. The nasal route is a desirable route for peptide drug delivery due to its simplicity of administration, adequate blood supply, and absorptive epithelium [27]. Moreover, various nasal sprays to combat SARS-CoV-2 have been proposed [28]. For that reason, the application of gramicidin D as a topical nasal treatment may potentially inhibit replication in the nasal epithelium, reducing the spread of the virus.
3. Materials and Methods
3.1. Data Preparation
The FASTA SARS-CoV-2 PLpro sequence was downloaded from UNIPROT, and the corresponding IS was calculated. A set of 1490 approved drugs from Drugbank [19] with corresponding SMILES was subjected to IS and CS calculation with PLpro. All calculations were carried out using our in-house software. The PDB structure of PLpro in complex with the inhibitor encoded by 7CJM [20] (GRL0167) was downloaded from the RCSB Protein Bank Database.
3.2. ISM
As a virtual spectroscopic method, the ISM has been successfully utilized to investigate the structure and function of diverse protein and DNA sequences. A thorough explanation of the ISM-based sequence analysis can be found elsewhere [29]. This method converts a sequence (protein or DNA) into a signal by giving each component (amino acid or nucleotide) a numerical value. These values represent the electron–ion interaction potential (EIIP) [30], which determines the electronic properties of amino acid/nucleotides and is essential for their intermolecular interactions. The following formulas can be used to calculate the EIIP descriptors:
| Z* = ∑mi = 1niZi/N, | (1) |
| EIIP = 0.25Z*sin(1.04πZ*)/2π, | (2) |
where i is the type of chemical element, Z is the valence of the i-th chemical element, n is the number of i-th chemical element atoms in the compound, m is the number of types of chemical elements in the compound, and N is the total number of atoms.
The EIIP signal is then transformed using the fast Fourier transform (FFT) into an information spectrum (IS) as a representation of a sequence in the form of a series of frequencies and amplitudes:
| X(n) = ∑Nm = 1x(m)e − iπnmN, n = 1, 2, …, N/2, | (3) |
The summation index is denoted by “m”, where x(m) is the m-th member of a given numerical “signal” series (from a transformed, encoded primary protein sequence in our case), N is the total number of points in this series, n is the value of the discrete frequency (ranging from 1 on up to N/2) in the DFT, X(n) represents the discrete Fourier transformation amplitude coefficients corresponding to each discrete frequency n, and 2π × (n/N) is the phase angle at each given m in the amino acid series of the protein in question.
The virtual spectroscopic method enables the functional analysis of protein sequences without prior experimental data. ISM-SM, its extension for small molecules, was recently developed and published [31]. A small molecule is imported in SMILES notation and decoded by atomic groups into an array of corresponding EIIP values. Using FFT, the corresponding IS of a small molecule is computed. This spectrum is further multiplied by the IS of the protein receptor to obtain a cross-spectrum (CS). The cross-spectral function determines the common frequency characteristics of two signals. For discrete series, it is defined as follows:
| S(n) = X(n) × Y(n)*, n = 1, 2, …, N/2, | (4) |
where X(n) and the DFT coefficients of the series x(m) and Y(n)* are complex conjugated DFT coefficients of the series Y(m).
It is possible to identify whether a protein interacts with small molecules and the corresponding binding site in the protein using common frequencies in CS.
3.3. Molecular Docking
The molecular docking of selected candidates into the crystal structure of PLpro was carried out. The PDB structure of PLpro complexed with the GRL0167 inhibitor (ID: 7CJM) [20] was downloaded from the RCSB Protein Bank database.
All ligands, waters, and ions were removed from the PDB file. Two grid boxes with dimensions of 24 × 24 × 24 Å were set to span all amino acid residues interacting with the co-crystallized inhibitor GRL 0617. The (x, y, z) center of the grid boxes was (26.0, 70.0, −1.0). Selected drugs from the previous step were converted from SMILES to 3D SDF and then to PDB files and protonated at physiological pH. Geometry optimization was carried in MOPAC 2016 [32] at the PM7 [33] level of theory. Default software settings for hydrophobic and hydrophilic terms in the docking search function were used. Exhaustiveness was set to 50. Molecular docking was carried out in Autodock Vina 1.1.2 [34]. Figures were made in BIOVIA Discovery Studio 2017, Schrodinger Maestro 11.1 and Origin 9.0 software.
3.4. Electrostatic Potential (ESP) Surface Calculations
ESP surfaces were calculated using the PM6 semiempirical method in Gaussian 09.D.01 [35].
3.5. Equipment
The thermostat “Environmental Shaker-Incubator ES-20” and the shaker “Thermo shaker TS-100 Biosan” were used to meet the needs of the growing microorganisms. The “Consort E122” system was used for protein electrophoresis. The HPLC AKTA system was used for enzyme purification. The TEKAN Infinite 200 Pro M Nano+ device was used to measure the enzyme activity by fluorescence.
3.6. Chemicals
Kanamycin, an antibiotic, was ordered from Invitrogen, California. Agar, peptone, and tryptone, components for medium preparation, were ordered from Torlak, Serbia. Other substances were ordered from Centrohem, Serbia.
3.7. Gene for PLpro
The gene for PLpro ordered from Addgene was previously cloned into the pETM33 vector with N-terminal GST and His-tag, using NcoI and EcoRI restriction enzymes. Himera: His-GST-HRV_3C-PLP has 1677 bp with a MW of 63.9 kDa. The recommended expression conditions when using E. coli BL21 DE3 gold cells are growth at 37 °C, induction with IPTG at a final concentration of 1 mM, and expression for 16 h at 18 °C. The E. coli STAR strain was used for intracellular expression. Zinc acetate was added to the expression medium at a final concentration of 0.5 mM. The DH5α strain was used for the storage and propagation of plasmids.
3.8. Amino Acid Sequence of PLpro
DGEVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTT
3.9. Gramicidin D and S IUPAC Entry
The IUPAC entry for Gramicidin D and S was extracted from the Pubchem database.
Gramicidin D
For-Val-Gly-D-Leu-Ala-D-Val-Val-D-Val-Trp-D-Leu-Trp-D-Leu-Trp-D-Leu-Trp-Gly-ol
Available from: https://pubchem.ncbi.nlm.nih.gov/compound/Gramicidin-D, accessed on 12 January 2023 [36].
Gramicidin S
cyclo[Leu-D-Phe-Pro-Val-Orn-Leu-D-Phe-Pro-Val-Orn]
Available from: https://pubchem.ncbi.nlm.nih.gov/compound/Gramicidin-S [37].
3.10. Isolation and Purification
3.10.1. Cell Lysis
After the protein expression, the collected cells were resuspended in lysis buffer (50 mM Na-phosphate buffer with 300 mM NaCl and 10 mM imidazole, pH 7.5). The sample was sonicated on ice with an ultrasound probe 10 times for 10 s, with a 20-s pause in between. After lysis, the cells were centrifuged for 20 min at 13,000 rpm. The supernatant was passed through a sterile 0.22 µL filter.
3.10.2. Purification
PLpro was purified by an HPLC system on a 5 mL Ni-NTA FF Sepharose column. For column equilibration, a 50 mM Na-phosphate buffer with 300 mM NaCl and 10 mM imidazole, pH 7.5, was used, while the same buffer with a gradient from 10 mM to 350 mM imidazole was used for protein elution. The change at 280 nm was monitored. Fractions of the purified protein were checked by SDS-PAGE electrophoresis (Supplementary Figure S1). Fractions containing the pure PLpro (fractions 22–28) were pulled and dialyzed against a 50 mM Tris-HCl buffer, pH 7.5, with 150 mM NaCl and 1 mM DTT (Supplementary Figure S2). The isolated enzyme was stored in 10% glycerol at −20 °C.
3.10.3. PLpro Assay
The change in fluorescence was monitored for 35 min every 5 min, with excitation at 485 nm and emission at 535 nm. The total volume of the reaction mixture was 200 µL. The buffer in which the reaction took place was 20 mM Tris with 150 mM NaCl and 1 mM DTT at pH 7.5. The enzyme (10 µL) and 0.3 µL of the fluorescent substrate (Recombinant Human Ubiquitin Rhodamine 110 Protein) dissolved in DMSO were added to the reaction mixture, so that the final substrate concentration was 0.375 µM. Gramicidin D (2.5 μM, 10 μM, 40 μM, and 60 μM), dissolved in DMSO, was used as a possible inhibitor. Buffer was used as a blank, and buffer with the substrate was used as a control.
4. Conclusions
Drug resistance is a critical issue that has an impact on therapeutic outcomes and necessitates novel drug design approaches. In this paper, the potential antiviral effect of gramicidin D in vitro is shown. The findings of this study are significant because the development of COVID-19 treatments that are effective, affordable, and have a positive safety profile is crucial to lowering the burden of infectious diseases on the healthcare system.
Supplementary Materials
The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/ijms24031955/s1.
Author Contributions
Conceptualization, R.P., S.P. (Slobodan Paessler) and S.G.; performed the experiments, R.P., N.K., S.P. (Sara Protić), O.P., V.P. and J.M.; validation, N.K.,V.P. and R.P.; analyzed the data N.K., S.P. (Sara Protić), O.P., M.S., V.P. and R.P.; investigation, S.P. (Sara Protić), N.K., V.P. and M.S.; resources, R.P.; writing—original draft preparation, R.P., S.G., M.S., S.P. (Slobodan Paessler), J.M. and V.P.; writing—review and editing, S.G, M.S., S.P. (Slobodan Paessler) and R.P.; visualization, N.K., R.P. and S.P. (Sara Protić); supervision, R.P.; project administration, R.P., S.G., J.M. and M.S. All authors contributed to the editorial changes in the manuscript. All authors have read and approved the final manuscript.
Institutional Review Board Statement
Not applicable.
Informed Consent Statement
Not applicable.
Data Availability Statement
Not applicable.
Conflicts of Interest
The authors declare no conflict of interest.
Funding Statement
This research was funded by the Science Fund of the Republic of Serbia, grant number 7551100—COVIDTARGET—Repurposing of drugs for prevention and treatment of COVID-19, funded under a special research program on COVID-19.
Footnotes
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
References
- 1.Ghanbari R., Teimoori A., Sadeghi A., Mohamadkhani A., Rezasoltani S., Asadi E., Jouyban A., Sumner S.C. Existing antiviral options against SARS-CoV-2 replication in COVID-19 patients. Future Microbiol. 2020;15:1747–1758. doi: 10.2217/fmb-2020-0120. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2.Shin D., Mukherjee R., Grewe D., Bojkova D., Baek K., Bhattacharya A., Schulz L., Widera M., Mehdipour A.R., Tascher G., et al. Papain-like protease regulates SARS-CoV-2 viral spread and innate immunity. Nature. 2020;587:657–662. doi: 10.1038/s41586-020-2601-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Devaraj S.G., Wang N., Chen Z., Chen Z., Tseng M., Barretto N., Lin R., Peters C.J., Tseng C.T., Baker S.C., et al. Regulation of IRF-3-dependent innate immunity by the papain-like protease domain of the severe acute respiratory syndrome coronavirus. J. Biol. Chem. 2007;282:32208–32221. doi: 10.1074/jbc.M704870200. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.McClain C.B., Vabret N. SARS-CoV-2: The many pros of targeting PLpro. Signal Transduct. Target. Ther. 2020;5:223. doi: 10.1038/s41392-020-00335-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Maiti B.K. Can papain-like protease inhibitors halt SARS-CoV-2 replication? ACS Pharmacol. Transl. Sci. 2020;3:1017–1019. doi: 10.1021/acsptsci.0c00093. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Poreba M., Salvesen G.S., Drag M. Synthesis of a HyCoSuL peptide substrate library to dissect protease substrate specificity. Nat. Protoc. 2017;12:2189–2214. doi: 10.1038/nprot.2017.091. [DOI] [PubMed] [Google Scholar]
- 7.Rut W., Lv Z., Zmudzinski M., Patchett S., Nayak D., Snipas S.J., Oualid F.E., Huang T.T., Bekes M., Drag M., et al. Activity profiling and structures of inhibitor-bound SARS-CoV-2-PLpro protease provides a framework for anti-COVID-19 drug design. bioRxiv. 2020 doi: 10.1101/2020.04.29.068890. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Huan Y., Kong Q., Mou H., Yi H. Antimicrobial Peptides: Classification, Design, Application and Research Progress in Multiple Fields. Front. Microbiol. 2020;11:582779. doi: 10.3389/fmicb.2020.582779. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Talapko J., Meštrović T., Juzbašić M., Tomas M., Erić S., Horvat A.L., Bekić S., Schwarz D., Matić S., Neuberg M., et al. Antimicrobial Peptides-Mechanisms of Action, Antimicrobial Effects and Clinical Applications. Antibiotics. 2022;11:1417. doi: 10.3390/antibiotics11101417. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Mousavi Maleki M.S., Rostamian M., Madanchi H. Antimicrobial peptides and other peptide-like therapeutics as promising candidates to combat SARS-CoV-2. Expert Rev. Anti-Infect. Ther. 2021;19:1205–1217. doi: 10.1080/14787210.2021.1912593. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Pérez de la Lastra J.M., Anand U., González-Acosta S., López M.R., Dey A., Bontempi E., Morales de la Nuez A. Antimicrobial Resistance in the COVID-19 Landscape: Is There an Opportunity for Anti-Infective Antibodies and Antimicrobial Peptides? Front. Immunol. 2022;13:921483. doi: 10.3389/fimmu.2022.921483. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Thakur A., Sharma A., Alajangi H.K., Jaiswal P.K., Lim Y.-B., Singh G., Barnwal R.P. In pursuit of next-generation therapeutics: Antimicrobial peptides against superbugs, their sources, mechanism of action, nanotechnology-based delivery, and clinical applications. Int. J. Biol. Macromol. 2022;218:135–156. doi: 10.1016/j.ijbiomac.2022.07.103. [DOI] [PubMed] [Google Scholar]
- 13.Bourinbaiar A.S., Krasinski K., Borkowsky W. Anti-HIV effect of gramicidin in vitro: Potential for spermicide use. Life Sci. 1994;54:PL5–PL9. doi: 10.1016/0024-3205(94)00579-6. [DOI] [PubMed] [Google Scholar]
- 14.Bourinbaiar A.S., Coleman C.F. The effect of gramicidin, a topical contraceptive and antimicrobial agent with anti-HIV activity, against herpes simplex viruses type 1 and 2 in vitro. Arch. Virol. 1997;142:2225–2235. doi: 10.1007/s007050050237. [DOI] [PubMed] [Google Scholar]
- 15.Prenner E.J., Lewis R.N.A.H., McElhaney R.N. The interaction of the antimicrobial peptide gramicidin S with lipidbilayer model and biological membranes. Biochem. Biophys. Acta. 1999;1462:201–221. doi: 10.1016/S0005-2736(99)00207-2. [DOI] [PubMed] [Google Scholar]
- 16.Enayathullah M.G., Parekh Y., Banu S., Ram S., Nagaraj R., Kumar B.K., Idris M.M. Gramicidin S and melittin: Potential anti-viral therapeutic peptides to treat SARS-CoV-2 infection. Sci. Rep. 2022;12:3446. doi: 10.1038/s41598-022-07341-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Bansal P., Kumar R., Singh J., Dhanda S. In silico molecular docking of SARS-CoV-2 surface proteins with microbial nonribosomal peptides: Identification of potential drugs. J. Proteins Proteom. 2021;1:1–8. doi: 10.1007/s42485-021-00072-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Sencanski M., Perovic V., Milicevic J., Todorovic T., Prodanovic R., Veljkovic V., Paessler S., Glisic S. Identification of SARS-CoV-2 Papain-like Protease (PLpro) Inhibitors Using Combined Computational Approach. ChemistryOpen. 2022;11:e202100248. doi: 10.1002/open.202100248. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Wishart D.S., Feunang Y.D., Guo A.C., Lo E.J., Marcu A., Grant J.R., Sajed T., Johnson D., Li C., Sayeeda Z., et al. DrugBank 5.0: A major update to the DrugBank database for 2018. Nucleic Acids Res. 2018;46:D1074–D1082. doi: 10.1093/nar/gkx1037. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Fu Z., Huang B., Tang J., Liu S., Liu M., Ye Y., Liu Z., Xiong Y., Zhu W., Cao D., et al. The complex structure of GRL0617 and SARS-CoV-2 PLpro reveals a hot spot for antiviral drug discovery. Nat. Commun. 2021;12:488. doi: 10.1038/s41467-020-20718-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Skwarecki A.S., Nowak M.G., Milewska M.J. Amino Acid and Peptide-Based Antiviral Agents. ChemMedChem. 2021;16:3106–3135. doi: 10.1002/cmdc.202100397. [DOI] [PubMed] [Google Scholar]
- 22.Swierstra J., Kapoerchan V., Knijnenburg A., van Belkum A., Overhand M. Structure, toxicity and antibiotic activity of gramicidin S and derivatives. Eur. J. Clin. Microbiol. Infect. Dis. 2016;35:763–769. doi: 10.1007/s10096-016-2595-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23.Wishart D.S., Knox C., Guo A.C., Cheng D., Shrivastava S., Tzur D., Gautam B., Hassanali M. DrugBank: A knowledgebase for drugs, drug actions and drug targets. Nucleic Acids Res. 2008;36:D901–D906. doi: 10.1093/nar/gkm958. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Ahn J.H., Kim J., Hong S.P., Choi S.Y., Yang M.J., Ju Y.S., Kim Y.T., Kim H.M., Rahman M.T., Chung M.K., et al. Nasal ciliated cells are primary targets for SARS-CoV-2 replication in the early stage of COVID-19. J. Clin. Investig. 2021;131:e148517. doi: 10.1172/JCI148517. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Bustamante-Marin X.M., Ostrowski L.E. Cilia and mucociliary clearance. Cold Spring Harb. Perspect. Biol. 2017;9:028241. doi: 10.1101/cshperspect.a028241. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26.Keller L.A., Merkel O., Popp A. Intranasal drug delivery: Opportunities and toxicologic challenges during drug development. Drug Deliv. Transl. Res. 2022;12:735–757. doi: 10.1007/s13346-020-00891-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27.Lewis A.L., Richard J. Challenges in the delivery of peptide drugs: An industry perspective. Ther. Deliv. 2015;6:149–163. doi: 10.4155/tde.14.111. [DOI] [PubMed] [Google Scholar]
- 28.Thoene J., Gavin R.F., Towne A., Wattay L., Ferrari M.G., Navarrete J., Pal R. In vitro activity of cysteamine against SARS-CoV-2 variants. Mol. Genet. Metab. 2022;137:192–200. doi: 10.1016/j.ymgme.2022.08.009. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Veljkovic N., Glisic S., Perovic V., Veljkovic V. The role of long range intermolecular interactions in discovery of new drugs. Exp. Opin. Drug Discov. 2011;6:1263. doi: 10.1517/17460441.2012.638280. [DOI] [PubMed] [Google Scholar]
- 30.Veljkovic V., Veljkovic N., Este J., Huther A., Dietrich U. Application of the EIIP/ISM bioinformatics concept in development of new drugs. Curr. Med. Chem. 2007;14:441. doi: 10.2174/092986707779941014. [DOI] [PubMed] [Google Scholar]
- 31.Sencanski M., Sumonja N., Perovic V., Glisic S., Veljkovic N., Veljkovic V. The Application of Information Spectrum Method on Small Molecules and Target Recognition. arXiv. 20191907.02713 [Google Scholar]
- 32.James J.P. Stewart Computational Chemistry. Stewart Computational Chemistry; Colorado Springs, CO, USA: 2016. MOPAC2016. [Google Scholar]
- 33.Stewart J.J. Optimization of parameters for semiempirical methods VI: More modifications to the NDDO approximations and re-optimization of parameters. J. Mol. Model. 2013;19:1–32. doi: 10.1007/s00894-012-1667-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 34.Trott O., Olson A.J. AutoDock Vina: Improving the speed and accuracy of docking with a new scoring function, efficient optimization, and multithreading. J. Comput. Chem. 2010;31:455–461. doi: 10.1002/jcc.21334. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 35.Frisch M.J., Trucks G.W., Schlegel H.B., Scuseria G.E., Robb M.A., Cheeseman J.R., Gonzalez J.A., Pople J.A. Gaussian 09, Revision E. 01. Volume 121. Gaussian, Inc.; Wallingford, CT, USA: 2009. pp. 150–166. [Google Scholar]
- 36.PubChem [Internet] PubChem Compound Summary for CID 45267103, Gramicidin D. National Library of Medicine (US), National Center for Biotechnology Information; Bethesda, MD, USA: 2004. [(accessed on 13 January 2023)]. Available online: https://pubchem.ncbi.nlm.nih.gov/compound/Gramicidin-D. [Google Scholar]
- 37.PubChem [Internet] PubChem Compound Summary for CID 73357, Gramicidin S. National Library of Medicine (US), National Center for Biotechnology Information; Bethesda, MD, USA: 2004. [(accessed on 12 January 2023)]. Available online: https://pubchem.ncbi.nlm.nih.gov/compound/Gramicidin-S. [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Supplementary Materials
Data Availability Statement
Not applicable.




