. 2023 Feb 8;66(4):3088–3105. doi: 10.1021/acs.jmedchem.2c02074

Table 1. Modified Cys Residues upon Incubation of 3CL^pro with 3 Determined by Protein Digestion Analysis^a.

peptide	site of labeling	function
H.VIC[3]TSEDMLNPNYEDLLIR.K	Cys44	active site Cys
R.VIGHSMQNC[3]VLK.L	Cys85	surface accessible Cys
D.YDC[3]VSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR.Q	Cys156	surface accessible Cys
R.TILGSALLEDEFTPFDVVRQC[3]SGVTF.Q	Cys300	surface accessible Cys

Re(V)-modified residues are indicated by the C[3] designation. Periods at the start and end of each sequence indicate peptide cleavage sites. Experimental details can be found in the Experimental Section.

Table 1. Modified Cys Residues upon Incubation of 3CLpro with 3 Determined by Protein Digestion Analysisa.

Table 1. Modified Cys Residues upon Incubation of 3CL^pro with 3 Determined by Protein Digestion Analysis^a.