The Dendritic Cell Major Histocompatibility Complex II (MHC II) Peptidome Derives from a Variety of Processing Pathways and Includes Peptides with a Broad Spectrum of HLA-DM Sensitivity

Supplemental Data

• Supplement Figure 1 (.pdf, 77 KB) - FACS analysis of C57Bl6 thymocytes befor and after injection of the I-Ab restricted SPSQARLHLQGRTNAWRPQVNDPKQWLQVD peptide.
• Supplement Table S1 (.xlsx, 538 KB) - Analysis of the Lymph peptidome
• Supplement Table S2 (.xls, 56 KB) - Lymph peptides reported in the literature from MHC class I and class II elutions.
• Supplement Table S3 (.xlsx, 860 KB) - Proteases involved in the processing of the HLA-DR1-eluted peptidome
• Supplement Table S4 (.xls, 94 KB) - Lymph peptidome overlapping with HLA-DR1-eluted peptides
• Supplement Table S5 (.xls, 492 KB) - Peptides derived from Complement 3 processing
• Supplement Table S6 (.xls, 59 KB) - Peptides derived from Collagen II processing
• Supplement Table S7 (.xls, 265 KB) - Peptides derived from Gelsolin processing
• Supplement Table S8 (.xls, 401 KB) - Peptides derived from Thymosin beta4 processing processing