Skip to main content
Lippincott Open Access logoLink to Lippincott Open Access
. 2023 Jun 7;109(7):2025–2036. doi: 10.1097/JS9.0000000000000326

Effectiveness and safety of central pancreatectomy in benign or low-grade malignant pancreatic body lesions: a systematic review and meta-analysis

Shiyuan Bi a, Yingyu Liu a, Wanlin Dai b, Liwei Pang a, Shaojie Yang a, Yuting Zheng a, Xiaolin Zhang a, Shuodong Wu a, Jing Kong a,*
PMCID: PMC10389642  PMID: 37300889

Background:

The best approach for treating benign or low-grade malignant lesions localized in the pancreatic neck or body remains debatable. Conventional pancreatoduodenectomy and distal pancreatectomy (DP) are associated with a risk of impairment of pancreatic function at long-term follow-up. With advances in technology and surgical skills, the use of central pancreatectomy (CP) has gradually increased.

Objectives:

The objective was to compare the safety, feasibility, and short-term and long-term clinical benefits of CP and DP in matched cases.

Methods:

The PubMed, MEDLINE, Web of Science, Cochrane, and EMBASE databases were systematically searched to identify studies published from database inception to February 2022 that compared CP and DP. This meta-analysis was performed using R software.

Results:

Twenty-six studies matched the selection criteria, including 774 CP and 1713 DP cases. CP was significantly associated with longer operative time (P<0.0001), less blood loss (P<0.01), overall and clinically relevant pancreatic fistula (P<0.0001), postoperative hemorrhage (P<0.0001), reoperation (P=0.0196), delayed gastric emptying (P=0.0096), increased hospital stay (P=0.0002), intra-abdominal abscess or effusion (P=0.0161), higher morbidity (P<0.0001) and severe morbidity (P<0.0001) but with a significantly lower incidence of overall endocrine and exocrine insufficiency (P<0.01), and new-onset and worsening diabetes mellitus (P<0.0001) than DP.

Conclusions:

CP should be considered as an alternative to DP in selected cases such as without pancreatic disease, length of the residual distal pancreas is more than 5 cm, branch-duct intraductal papillary mucinous neoplasms, and a low risk of postoperative pancreatic fistula after adequate evaluation.

Keywords: central pancreatectomy, distal pancreatectomy, pancreatic fistula

Introduction

Highlights

  • Most short-term complications after central pancreatectomy, including pancreatic fistula, delayed gastric emptying, postpancreatectomy hemorrhage, length of hospital stay, the rates of overall and severe morbidity, and reoperation rate were statistically higher than those in patients undergoing distal pancreatectomy.

  • A contour-enhanced funnel plot combined with a trim-and-fill method was used to determine whether the asymmetry in the funnel plot was due to publication bias. The results suggested that most of the missing studies were distributed within the white areas, indicating that the asymmetry in the funnel plot was due to publication bias.

  • Central pancreatectomy should be considered as an alternative to distal pancreatectomy in selected cases such as without pancreatic disease, length of the residual distal pancreas is more than 5 cm, branch-duct intraductal papillary mucinous neoplasms, and a low risk of postoperative pancreatic fistula after adequate evaluation.

With the widespread use of high-resolution abdominal imaging, the incidental diagnosis of benign or low-grade malignant pancreatic lesions has increased1,2. Pancreatic resection is an essential treatment for benign or low-grade malignant lesions localized in the pancreatic neck or body and includes two main procedures: pancreatoduodenectomy (PD) and distal pancreatectomy (DP)3,4. However, these surgical procedures result in a significant loss of normal pancreatic tissue, leading to a deficiency in the patient’s exocrine and endocrine functions. Tumor enucleation (EN) is appropriate for small and superficial lesions, which carry a risk of injury to the main pancreatic duct. Furthermore, EN is associated with a high risk for pancreatic leakage5.

In 1957, Guillemin and Bessot performed the first central pancreatectomy (CP) in a patient with chronic pancreatitis by anastomosing two pancreatic stumps with an omega-shaped jejunal loop6. The indication of CP requires benign or low-grade malignant tumors without histological vascular invasion in the body of the pancreatic neck. In addition, the tumor has a distance between the right cut edge and the common bile duct, while the remaining pancreas is more than 5 cm after the left pancreas is severed79.

Compared to DP, CP avoids the loss of normal pancreatic tissue and, in theory, it is better at protecting the secretory function of the pancreas, reducing the incidence of long-term complications in patients. However, possibly due to an insufficient sample size, many studies have not concluded that there is a difference in long-term pancreatic secretory function between CP and DP1013. Therefore, a meta-analysis is required. Higher postoperative pancreatic fistulas (POPFs) and overall complications have been indicated in previous meta-analyses for mid-pancreatic resection than for DP1418. However, there were some shortcomings in the previous meta-analysis, including the omission of some published studies and the small sample size of the test group. Using our study as a benchmark, the aim of this paper is to compare the safety, feasibility, and short-term and long-term clinical benefits of CP and DP in matched cases.

Methods

This study was fully compliant with the latest Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA 2020) guidelines19, Supplemental Digital Content 1, http://links.lww.com/JS9/A690 and was conducted and validated in accordance with AMSTAR2 guidelines20, Supplemental Digital Content 2, http://links.lww.com/JS9/A691. Our work has been reported in line with the PRISMA criteria19. The study was registered through http://www.researchregistry.com, and the study number is reviewregistry1471.

Literature search strategy

Two investigators independently conducted an online literature retrieval or search of the PubMed, MEDLINE, Web of Science, Cochrane, and EMBASE databases from inception to February 2022, without restriction to regions, languages, or publication types. The search strategy was searched with the following search terms ‘(central pancreatectomy OR medial pancreatectomy OR middle pancreatectomy OR segmental pancreatectomy OR central pancreatic resection OR organ-preserving pancreatectomy OR parenchyma-preserving pancreatectomy OR organ-sparing pancreatectomy OR parenchyma-sparing pancreatectomy OR segmental pancreatic resection OR non-standard pancreatic resection OR non-standard pancreatic resection OR meso-pancreatectomy OR mesopancreatectomy OR median pancreatectomy) AND (distal pancreatectomy OR left pancreatectomy)’. When multiple reports describing the same population over the same period were published, the most recent or highest-quality study was used. The references of the retrieved articles were manually searched. We resolved any differences in opinion through a group discussion with a third author (D.W.) to reach a consensus.

Inclusion criteria

  1. Study design: randomized controlled trials, case-matched controlled studies, retrospective cohort studies.

  2. Study: studies comparing the clinical outcomes of CP and DP.

  3. Participants: tumors with pathology of benign or low-grade malignant tumors in the pancreatic neck and proximal body.

  4. Language: without restriction to languages.

  5. Type of article: studies published as full-text articles.

  6. Minimum sample size: ten patients among all age groups.

Exclusion criteria

  1. Abstracts, letters, noncomparable or nonhuman studies, editorials, expert opinions, reviews without original data, and case reports.

  2. Studies lacking the outcomes of interest.

Selection of studies

To ensure the standardization of the literature screening procedure, the evaluation staff will receive training, and the literature used will be prescreened. The selection process requires at least two independent evaluators (Shiyuan Bi and Jing Kong). Following the screening phase, papers that are deemed relevant by at least one of the reviewers will be subjected to a full-text review. To choose the suitable articles, two reviewers will independently screen the titles and abstracts. Any disagreements between the two reviewers will be resolved by discussion with a third reviewer (Yingyu Liu). The study selection process will be detailed in the systematic evaluation plan and the full text. The following steps are included (Fig. 1): select the studies and exclude any duplications with EndNote; read the title and abstract of each study to exclude unrelated studies that clearly do not meet the inclusion criteria; and analyze and determine any duplicated publications.

Figure 1.

Figure 1

PRISMA flow diagram.

Data extraction

The following data were extracted: name of authors, study design, number of patients treated using surgical approaches (laparotomy, laparoscopy, and robotically assisted laparoscopy), age, intraoperative outcomes (operative time, intraoperative blood loss, and transfusion requirement), short-term postoperative outcomes (postoperative hospital stay, PF, clinically relevant PF, postoperative hemorrhage (POH), reoperation, overall morbidity, overall mortality, delayed gastric emptying (DGE), and intra-abdominal infection), and long-term outcomes (endocrine, exocrine functions, and tumor recurrence).

Quality assessment and statistical analysis

The levels of evidence were attributed according to the Oxford Center for Evidence-Based Medicine. The modified Newcastle–Ottawa scale (NOS) was used to appraise the methodological quality of the included studies8,21,22, which consisted of three factors: patient selection, comparability of the study groups, and assessment of outcomes. A score of 0–9 (allocated as stars) was assigned to each study, and observational studies receiving greater than or equal to seven stars considered to be of high quality.

Statistical analyses were performed using the R software (version 4.0.5). The mean difference (MD) and odds ratio (OR) were used to compare continuous and dichotomous variables, respectively. P value <0.05 were considered statistically significant. I 2 was used to represent statistical heterogeneity in these studies23. Values less than 30% indicated low, 30–60% moderate, and >60% high heterogeneity. The Mantel–Haenszel fixed-effect method model or the Mantel–Haenszel random-effects heterogeneity method model was used according to the heterogeneity results. Publication bias was examined using a funnel plot and Egger’s test. Publication bias was indicated by P<0.05.

Validation of methodological quality

The methods applied in this systematic review and meta-analysis were implemented, critically appraised, and validated using AMSTAR 220, Supplemental Digital Content 2, http://links.lww.com/JS9/A691, obtaining an overall rating of ‘high’ (16 points) (the scoring table was included in the supplementary materials), Supplemental Digital Content 3, http://links.lww.com/JS9/A692.

Results

The literature search resulted in a total of 10 750 studies before February 2022. No additional eligible studies were identified from other sources. Due to duplicity, 7630 articles were removed, and a further 2934 were eliminated following title and abstract screening based on the inclusion and exclusion criteria. Finally, 26 studies8,1013,21,22,2442, representing 774 CP and 1713 DP cases, were included in this meta-analysis. Figure 1 PRISMA flow diagram illustrates the identification and selection of studies, Supplemental Digital Content 4, http://links.lww.com/JS9/A693, and Table 1 describes the characteristics of the included articles. Among these 26 studies, eight were conducted in China1113,2527,31,32, four in Korea28-30,37, three in the USA22,35,36, two in Italy24,33, two in Germany21,34, three in Japan39-41, and one each in Romania10, Spain38, France42, and one combined study in the USA and Italy8. The results of the meta-analysis and details of the surgery are summarized in Table 2 and Table 3, respectively.

Table 1.

Characteristics of included studies.

References Country Group (CP/DP) Sex (M/F) Study type Quality scores ISGPF
Yamafuchi et al.41 Japan 10/47 27/30 Retrospective 7 No
Falconi et al.24 Italy 21/64 Retrospective 7 No
Balzano et al.33 Italy 32/21 16/37 Retrospective 8 No
Müller et al.21 Germany 40/40 38/42 Prospective 8 Yes
Crippa et al.8 Italy-USA 100/45 37/108 Prospective 7 Yes
Ocuin et al.22 USA 13/18 8/23 Retrospective 9 Yes
Hirono et al.40 Japan 24/28 19/33 Prospective 7 Yes
Lee et al.30 Korea 14/188 73/129 Retrospective 8 Yes
Shikano et al.39 Japan 26/35 30/31 Retrospective 7 Yes
Cataldegirmen et al.34 Germany 35/35 34/36 Retrospective 7 Yes
DiNorcia et al.36 USA 50/50 26/74 Retrospective 7 Yes
Kang et al.29 Korea 17/22 15/24 Retrospective 7 Yes
Dumitrascu et al.10 Romania 22/25 11/36 Retrospective 7 Yes
Xiang et al.26 China 44/55 36/63 Retrospective 7 Yes
Zhan et al.27 China 10/16 Retrospective 7 Yes
Du et al.25 China 36/26 20/42 Retrospective 8 Yes
Zureikat et al.35 USA 13/83 Retrospective 7 Yes
Herrera-Cabezón et al.38 Spain 10/105 57/58 Prospective 7 Yes
Song et al.28 Korea 40/96 42/94 Retrospective 8 Yes
Dokmak et al.42 France 35/165 74/126 Prospective 7 No
Lv et al.11 China 16/26 11/31 Retrospective 7 Yes
Zhang et al.12 China 23/36 19/40 Retrospective 7 Yes
Chen et al.32 China 30/353 129/254 Retrospective 7 Yes
Lee et al.37 Korea 55/55 34/76 Retrospective 8 Yes
Shi et al.13 China 38/38 49/27 Retrospective 7 Yes
Cai et al.31 China 20/41 17/44 Retrospective 8 Yes

Table 2.

Patient outcomes in CP and DP.

Studies CP/DP OR or MD 95% CI P I 2 (%) Model Egger test’s P
Interoperative outcome
 Operative time (min) 23 697/1532 49.22 [32.07, 66.37] <0.0001 90.3 Random 0.074
 Blood loss (ml) 19 564/1203 -63.74 [-116.49, -11.00] <0.0100 75.7 Random 0.419
 Blood transfusion (n) 17 497/1186 0.69 [0.44, 1.07] 0.0999 0 Fixed 0.499
Early postoperative outcome
 PF 26 774/1713 2.25 [1.81, 2.81] <0.0001 28.6 Fixed 0.019
 PF (grade B+C) 20 636/1391 2.73 [2.09, 3.58] <0.0001 41.8 Fixed 0.051
 DGE 12 404/952 2.56 [1.26, 5.19] 0.0096 0 Fixed 0.099
 POH 17 571/1041 2.80 [1.73, 4.55] <0.0001 7.2 Fixed 0.981
 intrabdominal abscess/effusion 10 361/826 1.88 [1.12, 3.16] 0.0161 3.2 Fixed 0.924
 LOS 21 635/1544 5.03 [2.42, 7.63] 0.0002 84.5 Random 0.020
 Reoperation 19 588/1149 1.74 [1.09, 2.76] 0.0196 36.1 Fixed 0.209
 Morbidity 21 650/1387 2.40 [1.91, 3.00] <0.0001 44.0 Fixed 0.010
 Severe surgical complications 11 307/890 2.20 [1.50, 3.22] <0.0001 45.7 Fixed 0.367
 Perioperative motality 22 671/1533 3.60 [0.69, 18.83] 0.1286 0 Fixed
Long-term postoperative outcome
 Endocrine insufficiency 19 615/912 0.23 [0.16, 0.33] <0.0001 0 Fixed 0.490
 DM worsening 10 369/571 0.19 [0.08, 0.47] <0.0001 0 Fixed
 Exocrine impairment 13 421/410 0.49 [0.31, 0.79] 0.0030 0 Fixed 0.240
 NODM 17 551/819 0.23 [0.15, 0.35] <0.0001 0 Fixed 0.139
 Recurrence 10 320/470 1.52 [0.65, 3.52] 0.3336 0 Fixed

DGE, delayed gastric emptying; LOS, length of hospital stay; NODM, new-onset diabetes mellitus; PF, pancreatic fistula; POH, postoperative hemorrhage.

Table 3.

Technical approaches and pathology of included studies.

CP
References Approach PG PJ Benign or borderline (CP/DP) Malignant (CP/DP) Tumor diameter (cm) (CP/DP)
Yamafuchi et al.41 Open 10/47 0/0
Falconi 24 Open
Balzano et al.33 Open 0 10 32/21 0/0
Müller et al.21 Open 0 40 36/36 4/4
Crippa et al.8 Open 5 95 93/17 7/28 2.6±1.9/4.9±4.0
Ocuin et al.22 Open 7 6 13/18 0/0 3.2±1.7/3.1±2.0
Hirono et al.40 Open 3 21 20/24 4/4 3.0±1.0/3.5±2.0
Lee et al.30 Open 14/121 0/22
Shikano et al.39 Open 24 2 24/33 2/2
Cataldegirmen et al.34 Open 32/34 3/1
DiNorcia et al.36 Open, laparoscopic 71 2 50/46 0/4 2.0±0.4/2.7±0.9
Kang et al.29 Open, robotic 3 16 17/22 0/0
Dumitrascu et al.10 Open, laparoscopic, and robotic 0 22 19/21 3/4 4.5±3.4/4.9±3.6
Xiang et al.26 Open 13 31 44/55 0/0
Zhan et al.27 Robotic
Du et al.25 Open 14 22 36/26 0/0 2.6±1.4/3.1±1.3
Zureikat et al.35 Open, Robotic
Herrera-Cabezón et al.38 Open 10/67 0/20
Song et al.28 Open, laparoscopic 0 40 40/96 0/0 2.5±1.2/4.0±2.4
Dokmak et al.42 Open,laparoscopic 25/102 10/63 2.1±0.9/3.5±2.2
Lv et al.11 Open 9 7 16/26 0/0 4.6±3.0/3.7±2.3
Zhang et al.12 Laparoscopic 0 23 23/36 0/0 2.7±0.7/3.2±0.9
Chen et al.32 Laparoscopic,open 0 30 30/270 0/83
Lee et al.37 Open 45 10 55/55 0/0
Shi et al.13 Open 38 0 38/38 0/0 2.5±1.4/2.6±1.5
Cai et al.31 Laparoscopic 0 20 20/41 0/0 2.8±0.8/3.6±2.2

Intraoperative outcomes

Operative time

A total of 23 studies, with 697 patients in the CP group and 1532 patients in the DP group, reported the operative time. There was a significantly shorter operative time in the DP group when compared to the CP group [mean (±SD): 208.61 (±80.86) vs. 248.22 (±76.74)] min (MD: 49.22; 95% CI: 32.07–66.37; P<0.0001) (Fig. 2A).

Figure 2.

Figure 2

Forest plots of meta-analysis. A operative time; B blood loss; C transfusions.

Blood loss

Nineteen studies, with a total of 1767 patients reported data on blood loss. Compared to the CP group (n=564), patients in the DP group (n=1203) had greater estimated blood loss [mean (± SD): 409.82 (± 483.77) vs. 352.27 (± 419.20) ml, and MD: −63.74; 95% CI: −116.49 to −11.00; P<0.01) (Fig. 2B).

Transfusions

Seventeen studies included this outcome. Intraoperative blood transfusions were observed in 7.4%(37/497) of patients in the CP group and 6.7%(80/1186) in the DP group. These were not statistically different (OR: 0.69, 95% CI: 0.44–1.07; P=0.0999) (Fig. 2C).

Postoperative outcomes

Pancreatic fistula (PF)

All of the included studies reported the overall PF rate. It was higher in the CP group (n=286, 36.9%) than in the DP group (n=346, 20.2%) (OR: 2.25, 95% CI: 1.81–2.81; P<0.0001) (Fig. 3A). Clinically relevant PF, considered Grades B or C according to International Study Group on Pancreatic Fistula Definition criteria43, was reported by 20 studies and was also significantly higher in the CP group (n=167, 26.3%) than in the DP group (n=179, 12.9%) (OR: 2.73; 95% CI: 2.09–3.58; P<0.0001) (Fig. 3B).

Figure 3.

Figure 3

Forest plots of meta-analysis. A pancreatic fistula; B Clinically relevant pancreatic fistula; C POH; D reoperation.

Postpancreatectomy hemorrhage (POH)

POH was compared in 17 studies, and CP (n=43, 7.9%) was associated with a significantly higher risk of POH than DP (n=32, 3.2%) (OR: 2.80; 95% CI: 1.73–4.55; P<0.0001) (Fig. 3C). In the DP group, major bleeding episodes did not occur in four studies, and not at all in the CP group.

Reoperation

Comparative data of reoperation were pooled from 19 studies. Significant differences were observed between the CP (n=33, 6.3%) and DP groups (n=41, 3.7%) (OR: 1.74; 95% CI: 1.09–2.76; P=0.0196) (Fig. 3D).

Delayed gastric emptying (DGE)

Twelve studies reported DGE. The DP group (n=25, 2.7%) had a reduced incidence of DGE compared to the CP group (n=20, 5.3%) (OR: 2.56; 95% CI: 1.26 –5.19; P=0.0096) (Supplementary Fig. 1a, Supplemental Digital Content 5, http://links.lww.com/JS9/A694).

Length of hospital stay (LOS)

We identified 21 studies with data on hospital stays. The LOS in the CP group was 5.03 days longer than that in the DP group (MD: 5.03; 95% CI: 2.42–7.63; P=0.0002) (Supplementary Fig. 1b, Supplemental Digital Content 5, http://links.lww.com/JS9/A694).

Severe morbidity

Eleven studies reported the rate of severe morbidity (Clavien–Dindo classification grade III or above). Significantly higher rates of severe postoperative complications were reported in the CP group (n=67, 21.8%) than in the DP group (n=114, 12.8%) (OR: 2.20; 95% CI: 1.50–3.22; P<0.0001) (Supplementary Fig. 1c, Supplemental Digital Content 5, http://links.lww.com/JS9/A694).

Mortality

Perioperative mortality was reported in 22 of the 26 studies. There were four deaths in total: three in the CP group (0.45%) and one in the DP (0.06%) group (OR: 3.60; 95% CI: 0.69–18.83; P=0.1286) (Supplementary Fig. 1d, Supplemental Digital Content 5, http://links.lww.com/JS9/A694).

Morbidity

The incidence of morbidity was reported in 21 studies. The results suggested that the CP group (n=326, 50.2%) had higher rates of associated complications than the DP group (n=471, 33.9%) (OR: 2.40; 95% CI: 1.91–3.00; P<0.0001) (Supplementary Fig. 2a, Supplemental Digital Content 5, http://links.lww.com/JS9/A694).

Intra-abdominal abscess or effusion

Intra-abdominal abscess or effusion data were recorded in 10 trials. Compared with the DP group (n=45, 5.4%), the CP group (n=41, 11.4%) had higher odds of intra-abdominal abscess or effusion (OR: 1.88; 95% CI: 1.12–3.16; P=0.0161) (Supplementary Fig. 2b, Supplemental Digital Content 5, http://links.lww.com/JS9/A694).

Long-term outcomes

The postoperative overall rate of endocrine insufficiency was observed in 19 studies. The CP group (n=41, 6.7%) had a lower occurrence of endocrine insufficiency than the DP group (n=188, 20.6%) (OR: 0.23; 95% CI: 0.16–0.33; P<0.0001) (Fig. 4A). Data on new-onset diabetes mellitus (NODM) were compared in 17 studies, and the pooled data demonstrated that patients in the CP group were less likely to be affected by NODM (OR: 0.23; 95% CI: 0.15–0.35; P<0.0001) (Fig. 4B). Significantly lower rates of worsening diabetes mellitus were observed in the CP group (n = 3, 0.8%) than in the DP group (n = 26, 4.6%) (OR: 0.19; 95% CI: 0.08–0.47; P<0.0001) (Fig. 4C). Data on postoperative exocrine function insufficiency were reported in thirteen studies. The DP group (n = 64, 15.6%) was more prone to exocrine insufficiency than the CP group (n = 36, 8.6%) (OR: 0.49; 95% CI: 0.31–0.79; P=0.003) (Fig. 4D). Data on tumor recurrence were obtained from 10 studies, and the results of a meta-analysis of CP versus DP tumor recurrence rates showed no statistical difference (OR: 1.52; 95% CI: 0.65–3.52; P=0.3336) (Supplementary Fig. 2c, Supplemental Digital Content 5, http://links.lww.com/JS9/A694).

Figure 4.

Figure 4

Forest plots of meta-analysis. A endocrine insufficiency; B NODM; C worsening diabetes mellitus; D exocrine insufficiency.

Sensitivity analyses and subgroup analyses

In the case of statistical heterogeneity, we performed sensitivity analyses for surgical outcomes by evaluating differences in the outcomes and significance using fixed and random effects models for the meta-analysis. I 2 was used to rank the variation in heterogeneity as follows: less than 40% low; 40–60% moderate; and greater than 60% high heterogeneity. Intraoperative blood transfusions showed low heterogeneity (Table 2).

However, a high degree of heterogeneity was found between the two variables (operative time and blood loss), and we divided the study into two subgroups: open or minimally invasive and prospective or nonprospective. However, we did not identify significant sources of heterogeneity for any of the parameters. This could be due to the differences in surgical experience between operators and the learning curve of CP.

In terms of postoperative short-term outcomes, subgroup analyses were performed based on the surgical approach including open as well as minimally invasive. We found no statistically significant differences between the two subgroups in the incidence of PF, clinically relevant PF, POH, reoperation, morbidity, severe morbidity, and LOS. Our results are supported by Huynh and Farrarons, who conducted a single-center study and meta-analysis of postoperative complications after open surgery and minimally invasive pancreatectomy, respectively44,45. Regarding DGE and intra-abdominal abscess or effusion we found that open surgery may increase the incidence of DGE and minimally invasive surgery may increase the incidence of abdominal abscesses (Supplementary materials, Supplemental Digital Content 5, http://links.lww.com/JS9/A694). In the above analysis, only conclusions were drawn on top of the existing ones due to the limitation on the number of studies now, and more articles may be needed in the future to conduct subgroup analysis to draw conclusions to confirm. Finally, sensitivity analyses were required, and after excluding each study, the effect sizes for the remaining included studies did not change significantly, suggesting that the results of this analysis are robust and reliable (Supplementary materials, Supplemental Digital Content 5, http://links.lww.com/JS9/A694).

Publication bias

Funnel plot and Egger’s test were used to test for publication bias for the surgical outcomes included in this study and P<0.05 indicated publication bias. In this meta-analysis, publication bias may have existed in postoperative PF (Fig. 5A), hospital stay (Fig. 5B), and morbidity (Fig. 5C) (Egger’s tests are shown in Table 2). The causes of funnel plot asymmetry include citation bias, true heterogeneity, selectivity bias, language bias, and publication bias. Therefore, for the above three outcomes, we used a contour-enhanced funnel plot combined with a trim-and-fill method to determine whether the asymmetry in the funnel plot was due to publication bias. The results suggested that most of the missing studies were distributed within the white areas, indicating that the asymmetry in the funnel plot was due to publication bias. As for the other outcomes, the funnel plot suggested basic symmetry, and the tests showed no significant publication.

Figure 5.

Figure 5

Funnel plots. A, pancreatic fistula; B, LOS; C, morbidity.

Discussion

For benign and low-grade malignant masses localized in the head or neck of the pancreas, DP is used more commonly than CP. This meta-analysis included studies up to February 2022, excluding those with small sample sizes and a poor representation, to reduce heterogeneity and make the surgical outcomes more meaningful. We included high-quality studies based on the NOS (Table 1)46. Although most of the studies included here were retrospective studies, in terms of the level of evidence, a paper published in 2010 showed that well-designed nonrandomized controlled trials were as accurate as randomized controlled trials47.

The most recent meta-analysis of DP and CP was published in 2020, which included 24 studies and a total of 1819 patients (CP=593, DP=1226)18. This concluded that CP better protected the function of the pancreas, but was associated with longer operative times, longer hospital stays, higher PF rates, and a higher overall postoperative complication rate. However, this meta-analysis excluded several studies and included few patients in the CP group, resulting in some common postoperative outcomes such as DGE, reoperation, and intraoperative blood loss, for which no statistical significance was observed.

EN, first reported in 196048, is also indicated for benign or low-grade malignant masses localized in the pancreas. However, the inclusion criteria are narrower than those for CP. Current surgical principles suggest that EN is only suitable for tumors less than 2 cm in diameter and that the distance between the tumor and the main pancreatic duct needs to be greater than 3 mm, making it suitable for superficial tumors that do not involve the main pancreatic duct. Although this has not been validated in large clinical trials, the evidence from small sample data studies is not sufficiently convincing9. In meta-analyses assessing EN versus pancreatic resection, EN had some advantages in terms of operative time, intraoperative blood loss, and POPF49,50 and better protected against pancreatic endocrine dysfunction. However, EN damage to the main pancreatic duct remains a concern.

This study showed that the CP group had a significantly longer operative time than the DP group. It is expected because the CP procedure requires digestive tract reconstruction11, which can take a significant amount of time. In terms of intraoperative blood transfusion, the conclusions of this study align with those obtained from three previous studies14,17,18, with no statistically significant differences (P=0.0999). In terms of intraoperative blood loss, the conclusions drawn from this study appear to be consistent with the findings of previously published meta-analyses15,16,18, with the CP group losing less blood intraoperatively than the DP group and was statistically significant (P<0.01). All meta-analyses showed high heterogeneity in terms of blood transfusion and duration of surgery, and further studies are needed to confirm this.

For procedures involving pancreatic resection, PF is always among the most common and prognostic complication, and the incidence of pancreatic leakage after surgery has been reported to be 3–40%51,52. In this meta-analysis, we mainly focused on clinically relevant pancreatic leaks, that is, grades B and C, than in the overall incidence of pancreatic leaks. Twenty of the 26 publications reported the incidence of clinically relevant pancreatic leaks, and the results showed that the incidence of clinically relevant pancreatic leaks was significantly higher in the CP group than in the DP group (P<0.0001). Three of the five previous meta-analyses reported the incidence14,17,18, but one suggested that it was not statistically significant14. And some studies have shown a high incidence of intra-abdominal effusion or abscess in patients with pancreatic leaks53,54. Ten studies were included to compare the incidence of peritoneal effusion or abscess in patients, and the results showed that patients in the CP group had a higher incidence of peritoneal effusion or abscess than those in the DP group (P=0.0161).

In terms of postoperative DGE, only one of the five meta-studies17 performed a correlation analysis, and the results suggested that no significant differences were found. In contrast, in this study, the probability of DGE after CP was higher than that after DP (P=0.0096). Studies have shown that the incidence of DGE can reach 5–40% in pancreatic resection, moderate to severe PF is an independent risk factor for secondary DGE, and other abdominal complications likewise increase the incidence of DGE5557. Therefore, abdominal complications control can reduce the occurrence of DGE. The current meta-analysis suggested that POH was significantly higher in the CP group than in the DP group (P<0.0001). POH is also a serious and common complication after pancreatic resection, and can be divided into early and late bleeding according to the time of occurrence, with early bleeding mostly due to inaccurate hemostasis or poorly ligated vascular dissection58. Late POH, although rare, is a very worrying sequela of POPF. Most commonly, it involves the development of pseudoaneurysms in the visceral arteries and their rupture during hemodynamic instability due to prolonged contact of the intra-abdominal vessels with pancreatic fluid containing high amounts of proteases59.

The incidence of reoperation was documented in 19 of 26 studies, and the present study suggests that the incidence of reoperation was significantly higher in the CP group than in the DP group (P=0.0196). These results were inconsistent with two meta-analyses published in 201314,15 and with the same conclusions as these three meta-analysis studies16-18, although these were not statistically different.

LOS was reported in 21 of the 26 studies, and our results showed that patients in the CP group, on average, were hospitalized for longer than those in the DP group (P=0.0002). Length of hospitalization increased due to the complex nature of CP compared to DP surgeries.

Overall, postoperative complications were significantly more common in the CP than the DP group, and this outcome was the same as the previous meta-analysis outcome, and both were statistically significant. Most complications occur due to a chain reaction triggered by pancreatic leakage; therefore, it is crucial to reduce the incidence of PF following CP surgery53,54,57,59.

Exocrine and endocrine insufficiencies, long-term postoperative complications, were significantly less common in the CP group than those in the DP group. The incidence of NODM and the rate of worsening diabetes were significantly lower in the CP group than in the DP group. We preferentially used the incidence of NODM and worsening diabetes as indicators of endocrine function60. CP surgery can improve the patient’s long-term quality of life by maximizing the preservation of normal tissue. The relevant literature reported that for benign masses, the incidence of NODM exocrine insufficiency after PD surgery reached 14–41%61,62. The incidence of NODM after DP surgery was 12.6–30.2% and the incidence of exocrine insufficiency was 20.2%60,63. Together, these data suggest that CP is recommended for patients who meet the surgery’s inclusion criteria. In this study, the two main methods of reconstructing the distal pancreatic stump with the digestive tract were summarized in Table 3.

Pancreaticojejunostomy (PJ) was performed in 61.0% (397/651) of patients and pancreaticogastrostomy (PG) in 35.6% (232/651) of patients. In recent years, the effects of PG and PJ on the incidence of POPF after PD has been controversial. Some studies suggested that the overall incidences of PF and clinically relevant PF were lower in the PG group than in the PJ group64,65. A meta-analysis by Crippa et al. 66 in 2016 did not demonstrate the superiority of pancreaticogastric anastomosis. The study showed no significant difference between the incidence of overall PF and that of clinically relevant PF. The heterogeneities in these studies may be due to the different diagnostic criteria for POPF, as well as inconsistent anastomotic techniques used in different centers and inconsistent perioperative management. Ricci et al. 67 performed a meta-analysis of seven prospective randomized controlled studies on the effect of PJ versus PG on POPF, controlling for heterogeneity. They showed that PG was superior to PJ in terms of PF occurrence. Therefore, PJ may increase the risk of POPF after CP.

In summary, our study showed that most short-term complications of this procedure were significantly higher than those of DP. Although DP had a higher incidence of long-term postoperative endocrine and exocrine insufficiency, this was well controlled by oral hypoglycemic agents, insulin, and pancreatic enzymes68,69. The main objective of CP is to preserve more normal pancreatic tissues to better protect the secretory function of the pancreas. CP is considered an ideal procedure for benign or low-grade malignant tumors (less than 5 cm in diameter) located in the neck and proximal body of the pancreas. The high incidence of short-term complications after CP, on the other hand, especially POPF, remains a challenge. It has been showed that patient related risk factors such as age (>70 years), sex (male), BMI greater than 25 or pancreas anatomic related factors such as pancreatic disease, pancreatic softness, pancreatic duct diameter less than or equal to 3 mm or procedure related factors such as anastomosis of residual pancreas digestive tract, and surgeon experience were risk factors for PF after PD7072. The selection of a surgical approach also needs to take the pathological type into account. Although CP can be used for neuroendocrine neoplasms, serous cystadenoma, and intraductal papillary mucinous neoplasms. It had been shown that patients with main-duct IPMN have a high rate of positive margin and recurrence8. Therefore, DP currently has greater clinical applicability.

Of course, there are some limitations in this article. First, the included studies were retrospective design. Patient selection bias and receipt collection bias would be unavoidable. Secondly, the diagnostic criteria of complications vary considerably among the reviewed articles. Lastly, the limited number of the included studies, with limited sample size, might compromise the power of the statistical inference.

Conclusion

CP cannot yet be routinely recommended for benign or low-grade malignant lesions occurring in the neck of the pancreas as well as in the proximal body. It should be considered as an alternative to DP in selected cases such as without pancreatic disease, length of the residual distal pancreas greater than or equal to 5 cm, branch-duct intraductal papillary mucinous neoplasms, and a low risk of POPF after adequate evaluation. Considering the surgical skills and treatment experience, the indications for CP should be broadened in center with a high volume case load.

Ethical approval

This meta-analysis has no ethical approval.

Sources of funding

  1. The Liaoning Science and Technology Plan Project (grant no. 2021JH2/10300118).

  2. The 345 Talent Project Program of China Medical University Shengjing Hospital (grant no. 2022-50A).

Author contribution

S.B.: contributed to the conception of the study, literature research and manuscript preparation; Y.L., W.D., L.P., S.Y., and Y.Z.: contributed significantly to data acquisition; S.W., J.K.: helped perform the analysis with constructive discussions.

Conflicts of interest disclosure

Shiyuan Bi, Yingyu Liu, Wanlin Dai, Liwei Pang, Shaojie Yang, Yuting Zheng, Xiaolin Zhang, Shuodong Wu, Jing Kong declare that they have no conflict of interest.

Research Registration Unique Identifying Number (UIN)

  1. Name of the registry: Effectiveness and safety of central pancreatectomy in benign or low-grade malignant pancreatic body lesions: A systematic review and meta-analysis.

  2. Unique Identifying number or registration ID: Reviewregistry1471.

  3. Hyperlink to your specific registration (must be publicly accessible and will be checked): https://www.researchregistry.com/browse-the registry#registryofsystematicreviewsmetaanalyses/registryofsystematicreviewsmetaanalysesdetails/63637ec1f98407002397246b/.

Guarantor

Dr Shiyuan Bi and Prof. Jing Kong are the guarantor.

Data availability statement

All data for this paper were obtained from the 26 original papers included. The datasets generated during and/or analyzed during the current study are available from the corresponding author on reasonable request.

Provenance and peer review

Not commissioned, externally peer-reviewed.

Supplementary Material

js9-109-2025-s001.pdf (352.4KB, pdf)
js9-109-2025-s002.docx (14.9KB, docx)
js9-109-2025-s003.tif (8.4MB, tif)
js9-109-2025-s004.docx (275.7KB, docx)

Footnotes

Sponsorships or competing interests that may be relevant to content are disclosed at the end of this article

Supplemental Digital Content is available for this article. Direct URL citations are provided in the HTML and PDF versions of this article on the journal’s website, www.lww.com/international-journal-of-surgery.

Published online 7 June 2023

Contributor Information

Shiyuan Bi, Email: bishiyuanyyy@163.com.

Yingyu Liu, Email: liuyingyu1997@163.com.

Wanlin Dai, Email: 3114239120@qq.com.

Liwei Pang, Email: 546790762@qq.com.

Shaojie Yang, Email: ysj6686@foxmail.com.

Yuting Zheng, Email: zyt19960909@163.com.

Xiaolin Zhang, Email: simmons1128@163.com.

Shuodong Wu, Email: wushuodong2010@163.com.

Jing Kong, Email: Dcanlasy@163.com.

References

  • 1. Del Chiaro M, Torphy RJ, Schulick RD. Pancreatic incidentalomas: investigation and management. J Intern Med 2021;290:969–79. [DOI] [PubMed] [Google Scholar]
  • 2. Liu H, Cui Y, Shao J, et al. The diagnostic role of CT, MRI/MRCP, PET/CT, EUS and DWI in the differentiation of benign and malignant IPMN: A meta-analysis. Clin Imaging 2021;72:183–93. [DOI] [PubMed] [Google Scholar]
  • 3. Hüttner FJ, Klotz R, Ulrich A, et al. Antecolic versus retrocolic reconstruction after partial pancreaticoduodenectomy. Cochrane Database Syst Rev 2016;9:Cd011862. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4. Song KB, Kwon J, Lee YJ, et al. The treatment indication and optimal management of fluid collection after laparoscopic distal pancreatectomy. Surg Endosc 2019;33:3314–24. [DOI] [PubMed] [Google Scholar]
  • 5. Shen X, Yang X. Comparison of outcomes of enucleation vs. standard surgical resection for pancreatic neoplasms: a systematic review and meta-analysis. Front Surg 2021;8:744316. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6. Guillemin P, Bessot M. [Chronic calcifying pancreatitis in renal tuberculosis: pancreatojejunostomy using an original technic]. Mem Acad Chir (Paris) 1957;83:869–871. [PubMed] [Google Scholar]
  • 7. Letton AH, Wilson JP. Traumatic severance of pancreas treated by Roux-Y anastomosis. Surg Gynecol Obstet 1959;109:473–478. [PubMed] [Google Scholar]
  • 8. Crippa S, Bassi C, Warshaw AL, et al. Middle pancreatectomy: indications, short- and long-term operative outcomes. Ann Surg 2007;246:69–76. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9. Marchese U, Tzedakis S, Abou Ali E, et al. Parenchymal sparing resection: options in duodenal and pancreatic surgery. J Clin Med 2021;10:1479. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10. Dumitrascu T, Scarlat A, Ionescu M, et al. Central pancreatectomy versus spleen-preserving distal pancreatectomy: a comparative analysis of early and late postoperative outcomes. Dig Surg 2012;29:400–407. [DOI] [PubMed] [Google Scholar]
  • 11. Lv A, Qian HG, Qiu H, et al. Is central pancreatectomy truly recommendable? A 9-year single-center experience. Dig Surg 2018;35:532–538. [DOI] [PubMed] [Google Scholar]
  • 12. Zhang H, Xu Q, Tan C, et al. Laparoscopic spleen-preserving distal versus central pancreatectomy for tumors in the pancreatic neck and proximal body. Medicine (Baltimore) 2019;98:e16946. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13. Shi Y, Wang Q, Shi Z, et al. Comparison between robot-assisted middle pancreatectomy and robot-assisted distal pancreatectomy for benign or low-grade malignant tumours located in the neck of the pancreas: a propensity score matched study. Int J Med Robot 2021;17:e2219. [DOI] [PubMed] [Google Scholar]
  • 14. Xu SB, Zhu YP, Zhou W, et al. Patients get more long-term benefit from central pancreatectomy than distal resection: a meta-analysis. Eur J Surg Oncol 2013;39:567–574. [DOI] [PubMed] [Google Scholar]
  • 15. Iacono C, Verlato G, Ruzzenente A, et al. Systematic review of central pancreatectomy and meta-analysis of central versus distal pancreatectomy. Br J Surg 2013;100:873–885. [DOI] [PubMed] [Google Scholar]
  • 16. Xiao W, Zhu J, Peng L, et al. The role of central pancreatectomy in pancreatic surgery: a systematic review and meta-analysis. HPB (Oxford) 2018;20:896–904. [DOI] [PubMed] [Google Scholar]
  • 17. Dragomir MP, Sabo AA, Petrescu GED, et al. Central pancreatectomy: a comprehensive, up-to-date meta-analysis. Langenbecks Arch Surg 2019;404:945–58. [DOI] [PubMed] [Google Scholar]
  • 18. Regmi P, Yang Q, Hu HJ, et al. Overall postoperative morbidity and pancreatic fistula are relatively higher after central pancreatectomy than distal pancreatic resection: a systematic review and meta-analysis. Biomed Res Int 2020;2020:7038907. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19. Page MJ, McKenzie JE, Bossuyt PM, et al. The PRISMA 2020 statement: an updated guideline for reporting systematic reviews. Int J Surg 2021;88:105906. [DOI] [PubMed] [Google Scholar]
  • 20. Shea BJ, Reeves BC, Wells G, et al. AMSTAR 2: a critical appraisal tool for systematic reviews that include randomised or non-randomised studies of healthcare interventions, or both. Bmj 2017;358:j4008. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21. Müller MW, Friess H, Kleeff J, et al. Middle segmental pancreatic resection: An option to treat benign pancreatic body lesions. Ann Surg 2006;244:909–918; discussion 18-20. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22. Ocuin LM, Sarmiento JM, Staley CA, et al. Comparison of central and extended left pancreatectomy for lesions of the pancreatic neck. Ann Surg Oncol 2008;15:2096–2103. [DOI] [PubMed] [Google Scholar]
  • 23. Higgins JP, Thompson SG, Deeks JJ, et al. Measuring inconsistency in meta-analyses. Bmj 2003;327:557–560. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24. Falconi M, Mantovani W, Frigerio I, et al. [Intermediate resection and distal pancreatectomy for benign neoplasms of the pancreas: comparison of postoperative complications and costs]. Chir Ital 2001;53:467–474. [PubMed] [Google Scholar]
  • 25. Du ZY, Chen S, Han BS, et al. Middle segmental pancreatectomy: a safe and organ-preserving option for benign and low-grade malignant lesions. World J Gastroenterol 2013;19:1458–1465. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26. Xiang GM, Tan CL, Zhang H, et al. Central pancreatectomy for benign or borderline lesions of the pancreatic neck: a single centre experience and literature review. Hepatogastroenterology 2012;59:1286–1289. [DOI] [PubMed] [Google Scholar]
  • 27. Zhan Q, Deng XX, Han B, et al. Robotic-assisted pancreatic resection: a report of 47 cases. Int J Med Robot 2013;9:44–51. [DOI] [PubMed] [Google Scholar]
  • 28. Song KB, Kim SC, Park KM, et al. Laparoscopic central pancreatectomy for benign or low-grade malignant lesions in the pancreatic neck and proximal body. Surg Endosc 2015;29:937–946. [DOI] [PubMed] [Google Scholar]
  • 29. Kang CM, Lee JM, Kim MW, et al. Experiences in central pancreatectomy. Dig Surg 2011;28:57–62. [DOI] [PubMed] [Google Scholar]
  • 30. Lee SE, Jang JY, Hwang DW, et al. Clinical efficacy of organ-preserving pancreatectomy for benign or low-grade malignant potential lesion. J Korean Med Sci 2010;25:97–103. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31. Cai H, Feng L, Peng B. Laparoscopic pancreatectomy for benign or low-grade malignant pancreatic tumors: outcomes in a single high-volume institution. BMC Surg 2021;21:412. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32. Chen K, Pan Y, Mou YP, et al. Evolution of laparoscopic pancreatic resections for pancreatic and periampullary diseases: perioperative outcomes of 605 patients at a high-volume center. J Laparoendosc Adv Surg Tech A 2019;29:1085–92. [DOI] [PubMed] [Google Scholar]
  • 33. Balzano G, Zerbi A, Veronesi P, et al. Surgical treatment of benign and borderline neoplasms of the pancreatic body. Dig Surg 2003;20:506–510. [DOI] [PubMed] [Google Scholar]
  • 34. Cataldegirmen G, Schneider CG, Bogoevski D, et al. Extended central pancreatic resection as an alternative for extended left or extended right resection for appropriate pancreatic neoplasms. Surgery 2010;147:331–338. [DOI] [PubMed] [Google Scholar]
  • 35. Zureikat AH, Moser AJ, Boone BA, et al. 250 robotic pancreatic resections: safety and feasibility. Ann Surg 2013;258:554–559; discussion 9-62. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36. DiNorcia J, Ahmed L, Lee MK, et al. Better preservation of endocrine function after central versus distal pancreatectomy for mid-gland lesions. Surgery 2010;148:1247–1254; discussion 54-6. [DOI] [PubMed] [Google Scholar]
  • 37. Lee DH, Han Y, Byun Y, et al. Central pancreatectomy versus distal pancreatectomy and pancreaticoduodenectomy for benign and low-grade malignant neoplasms: a retrospective and propensity score-matched study with long-term functional outcomes and pancreas volumetry. Ann Surg Oncol 2020;27:1215–24. [DOI] [PubMed] [Google Scholar]
  • 38. Herrera-Cabezón FJ, Sánchez-Acedo P, Zazpe-Ripa C, et al. Quality standards in 480 pancreatic resections: a prospective observational study. Rev Esp Enferm Dig 2015;107:143–151. [PubMed] [Google Scholar]
  • 39. Shikano T, Nakao A, Kodera Y, et al. Middle pancreatectomy: safety and long-term results. Surgery 2010;147:21–29. [DOI] [PubMed] [Google Scholar]
  • 40. Hirono S, Tani M, Kawai M, et al. A central pancreatectomy for benign or low-grade malignant neoplasms. J Gastrointest Surg 2009;13:1659–1665. [DOI] [PubMed] [Google Scholar]
  • 41. Yamaguchi K, Yokohata K, Ohkido M, et al. Which is less invasive–distal pancreatectomy or segmental resection? Int Surg 2000;85:297–302. [PubMed] [Google Scholar]
  • 42. Dokmak S, Aussilhou B, Ftériche FS, et al. Hanging maneuver for stomach traction in laparoscopic distal pancreatic resections: an original technique applied in 218 patients. Dig Surg 2017;34:89–94. [DOI] [PubMed] [Google Scholar]
  • 43. Bassi C, Dervenis C, Butturini G, et al. Postoperative pancreatic fistula: an international study group (ISGPF) definition. Surgery 2005;138:8–13. [DOI] [PubMed] [Google Scholar]
  • 44. Huynh F, Cruz CJ, Hwang HK, et al. Minimally invasive (laparoscopic and robot-assisted) versus open approach for central pancreatectomies: a single-center experience. Surg Endosc 2022;36:1326–31. [DOI] [PubMed] [Google Scholar]
  • 45. Farrarons SS, van Bodegraven EA, Sauvanet A, et al. Minimally invasive versus open central pancreatectomy: systematic review and meta-analysis. Surgery 2022;172:1490–501. [DOI] [PubMed] [Google Scholar]
  • 46. Cook DA, Reed DA. Appraising the quality of medical education research methods: the Medical Education Research Study Quality Instrument and the Newcastle-Ottawa Scale-Education. Acad Med 2015;90:1067–1076. [DOI] [PubMed] [Google Scholar]
  • 47. Abraham NS, Byrne CJ, Young JM, et al. Meta-analysis of well-designed nonrandomized comparative studies of surgical procedures is as good as randomized controlled trials. J Clin Epidemiol 2010;63:238–245. [DOI] [PubMed] [Google Scholar]
  • 48. Delannoy E, Combemale B. Pancreatic cystadenoma. Enucleation. Recovery]. Mem Acad Chir (Paris) 1964;90:521–523. [PubMed] [Google Scholar]
  • 49. Hüttner FJ, Koessler-Ebs J, Hackert T, et al. Meta-analysis of surgical outcome after enucleation versus standard resection for pancreatic neoplasms. Br J Surg 2015;102:1026–1036. [DOI] [PubMed] [Google Scholar]
  • 50. Ratnayake CB, Biela C, Windsor JA, et al. Enucleation for branch duct intraductal papillary mucinous neoplasms: a systematic review and meta-analysis. HPB (Oxford) 2019;21:1593–602. [DOI] [PubMed] [Google Scholar]
  • 51. Bassi C, Butturini G, Molinari E, et al. Pancreatic fistula rate after pancreatic resection. The importance of definitions. Dig Surg 2004;21:54–59. [DOI] [PubMed] [Google Scholar]
  • 52. Kawai M, Yamaue H. Analysis of clinical trials evaluating complications after pancreaticoduodenectomy: a new era of pancreatic surgery. Surg Today 2010;40:1011–1017. [DOI] [PubMed] [Google Scholar]
  • 53. Zhao N, Cui J, Yang Z, et al. Natural history and therapeutic strategies of post-pancreatoduodenectomy abdominal fluid collections: ten-year experience in a single institution. Medicine (Baltimore) 2019;98:e15792. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54. Sierzega M, Kulig P, Kolodziejczyk P, et al. Natural history of intra-abdominal fluid collections following pancreatic surgery. J Gastrointest Surg 2013;17:1406–1413. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55. Jilesen AP, van Eijck CH, in’t Hof KH, et al. Postoperative complications, in-hospital mortality and 5-year survival after surgical resection for patients with a pancreatic neuroendocrine tumor: a systematic review. World J Surg 2016;40:729–748. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 56. Herrera Cabezón J, Sánchez Acedo P, Tarifa Castilla A, et al. Delayed gastric emptying following pancreatoduodenectomy: a Roux-en-Y gastrojejunostomy vs Billroth II gastrojejunostomy randomized study. Rev Esp Enferm Dig 2019;111:34–39. [DOI] [PubMed] [Google Scholar]
  • 57. Hayama S, Senmaru N, Hirano S. Delayed gastric emptying after pancreatoduodenectomy: comparison between invaginated pancreatogastrostomy and pancreatojejunostomy. BMC Surg 2020;20:60. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58. Magge D, Zenati M, Lutfi W, et al. Robotic pancreatoduodenectomy at an experienced institution is not associated with an increased risk of post-pancreatic hemorrhage. HPB (Oxford) 2018;20:448–55. [DOI] [PubMed] [Google Scholar]
  • 59. Rana SS, Kumar A, Lal A, et al. Safety and efficacy of angioembolisation followed by endoscopic ultrasound guided transmural drainage for pancreatic fluid collections associated with arterial pseudoaneurysm. Pancreatology 2017;17:658–62. [DOI] [PubMed] [Google Scholar]
  • 60. Kusakabe J, Anderson B, Liu J, et al. Long-term endocrine and exocrine insufficiency after pancreatectomy. J Gastrointest Surg 2019;23:1604–13. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 61. Beger HG, Poch B, Mayer B, et al. New onset of diabetes and pancreatic exocrine insufficiency after pancreaticoduodenectomy for benign and malignant tumors: a systematic review and meta-analysis of long-term results. Ann Surg 2018;267:259–70. [DOI] [PubMed] [Google Scholar]
  • 62. Feng Q, Jiang C, Feng X, et al. Robotic versus laparoscopic distal pancreatectomy for pancreatic ductal adenocarcinoma: a systematic review and meta-analysis. Front Oncol 2021;11:752236. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 63. Hallac A, Aleassa EM, Rogers M, et al. Exocrine pancreatic insufficiency in distal pancreatectomy: incidence and risk factors. HPB (Oxford) 2020;22:275–81. [DOI] [PubMed] [Google Scholar]
  • 64. Clerveus M, Morandeira-Rivas A, Picazo-Yeste J, et al. Pancreaticogastrostomy versus pancreaticojejunostomy after pancreaticoduodenectomy: a systematic review and meta-analysis of randomized controlled trials. J Gastrointest Surg 2014;18:1693–1704. [DOI] [PubMed] [Google Scholar]
  • 65. Guerrini GP, Soliani P, D’Amico G, et al. Pancreaticojejunostomy Versus Pancreaticogastrostomy After Pancreaticoduodenectomy: An Up-to-date Meta-Analysis. J Invest Surg 2016;29:175–184. [DOI] [PubMed] [Google Scholar]
  • 66. Crippa S, Cirocchi R, Randolph J, et al. Pancreaticojejunostomy is comparable to pancreaticogastrostomy after pancreaticoduodenectomy: an updated meta-analysis of randomized controlled trials. Langenbecks Arch Surg 2016;401:427–437. [DOI] [PubMed] [Google Scholar]
  • 67. Ricci C, Casadei R, Taffurelli G, et al. Is pancreaticogastrostomy safer than pancreaticojejunostomy after pancreaticoduodenectomy? A meta-regression analysis of randomized clinical trials. Pancreatology 2017;17:805–13. [DOI] [PubMed] [Google Scholar]
  • 68. Sabater L, Ausania F, Bakker OJ, et al. Evidence-based guidelines for the management of exocrine pancreatic insufficiency after pancreatic surgery. Ann Surg 2016;264:949–58. [DOI] [PubMed] [Google Scholar]
  • 69. Kitazawa T, Yokoyama K, Kubota K. Combination therapy of glucagon-like peptide-1 receptor agonists and insulin for patients who developed diabetes after partial pancreatectomy. J Diabetes Investig 2016;7:381–385. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 70. Muscari F, Suc B, Kirzin S, et al. Risk factors for mortality and intra-abdominal complications after pancreatoduodenectomy: multivariate analysis in 300 patients. Surgery 2006;139:591–598. [DOI] [PubMed] [Google Scholar]
  • 71. Lin JW, Cameron JL, Yeo CJ, et al. Risk factors and outcomes in postpancreaticoduodenectomy pancreaticocutaneous fistula. J Gastrointest Surg 2004;8:951–959. [DOI] [PubMed] [Google Scholar]
  • 72. Hu BY, Wan T, Zhang WZ, et al. Risk factors for postoperative pancreatic fistula: analysis of 539 successive cases of pancreaticoduodenectomy. World J Gastroenterol 2016;22:7797–7805. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Data Availability Statement

All data for this paper were obtained from the 26 original papers included. The datasets generated during and/or analyzed during the current study are available from the corresponding author on reasonable request.


Articles from International Journal of Surgery (London, England) are provided here courtesy of Wolters Kluwer Health

RESOURCES