Significance
Direct cell–cell contacts are critical to diverse biological processes in multicellular organisms, including stem cell differentiation, tissue morphogenesis, neurotransmission, tumorigenesis, and immunological responses. However, identifying interacting cells in vivo is still a challenging task in complex tissues. Here, we introduce a new genetic tool, synthetic Notch receptor (synNQ), for efficient visualization and genetic manipulation of neighboring cells in vivo. This tool is functional in most fly tissues and can be easily applied using the widely adapted UAS/Gal4 system. Using both randomly generated clones and tissue-specific Gal4 lines, we demonstrate the applications of the synNQ system.
Keywords: Notch, sensor, Drosophila, cell–cell contact
Abstract
Detection and manipulation of direct cell–cell contact in complex tissues is a fundamental and challenging problem in many biological studies. Here, we report an optimized Notch-based synthetic receptor (synNQ) useful to study direct cell–cell interactions in Drosophila. With the synNQ system, cells expressing a synthetic receptor, which contains Notch activation machinery and a downstream transcriptional activator, QF, are activated by a synthetic GFP ligand expressed by contacting neighbor cells. To avoid cis-inhibition, mutually exclusive expression of the synthetic ligand and receptor is achieved using the “flippase-out” system. Expression of the synthetic GFP ligand is controlled by the Gal4/UAS system for easy and broad applications. Using synNQ, we successfully visualized cell–cell interactions within and between most fly tissues, revealing previously undocumented cell–cell contacts. Importantly, in addition to detection of cells in contact with one another, synNQ allows for genetic manipulation in all cells in contact with a targeted cell population, which we demonstrate in the context of cell competition in developing wing disks. Altogether, the synNQ genetic system will enable a broad range of studies of cell contact in developmental biology.
The ability of cells to interact with one another in multicellular organisms is central to almost all biological processes. Cells influence each other in two major ways: first, by indirect interaction through release of molecular signals into the free intracellular space, and, second, by direct interaction through physical cell–cell contacts, including the formation of junctions between mechanically coupled epithelial cells, synaptic connections between neurons, activation of lymphocytes by antigen-presenting cells, and infection of host cells by intracellular parasites. Malfunctions of direct cell–cell contact are associated with numerous diseases, including developmental defects, neurological disorders, immunological abnormalities, and cancers (1–3). Therefore, the ability to detect and manipulate cells that contact one another directly is fundamental to both basic and clinical research.
Detection of direct cell–cell contact can be challenging in complex tissues. Several methods have been used to address this problem, including different types of large-scale EM imaging, as well as labeling techniques (4, 5), GFP (green fluorescent protein) reconstitution across synaptic partners (GRASP) (6), HRP reconstitution (7), biotin labeling of intercellular contacts (8), and transsynaptic tracers (9). Although they are useful for specific applications, these approaches still suffer from several limitations, such as incompatibility with live cells, an inability to label and manipulate cells in contact simultaneously, artifactual effects on cell contact, or restriction to use in specific cell types.
To overcome these limitations and to visualize and manipulate direct cell–cell interactions effectively, we took a synthetic biology approach and engineered a genetic circuit that is activated by cell–cell contact. We focused on endogenous signaling mechanisms that require physical contact and found the highly conserved activity known as regulated intramembrane proteolysis (RIP) to be a suitable target for engineering. One of the best characterized RIP-dependent signaling molecules is Notch, a membrane receptor with a single transmembrane domain (10). Binding of a ligand to the extracellular domain of Notch induces proteolytic cleavage and release of its intracellular domain (ICD), which translocates to the nucleus and functions as a transcriptional factor (11) (Fig. 1 A and B). Notch signaling presents a number of advantages for engineering. First, the system is highly compact because it only involves a ligand and a receptor, together with several broadly expressed proteases (12). Second, unlike most other receptors, such as gated ion channels, G-protein–coupled receptors, and receptor tyrosine kinases, Notch is activated through mechanical forces generated by ligand–receptor binding (11, 13), such that the binding and activation machinery can be uncoupled to allow rewiring of the system with artificial interacting domains. Third, the ICD of Notch, which mediates downstream effects, can be replaced by other transcriptional factors without affecting its proteolytic activation (14, 15). We previously validated this approach in cultured Drosophila cells by replacing the ligand-binding domains of Notch with a GFP-binding nanobody, switching the ICD of Notch with the QF transcriptional activator, and activating this synthetic Notch receptor (synNQ) using a membrane-tethered artificial GFP ligand (16–18) (Fig. 1 A and B). More recently, similar synthetic Notch systems based on different artificial binding partners [i.e., mCD19, anti-mCD19 scFv (single-chain variable fragment)] were used to manipulate cell–cell communication in cultured mammalian cells, in the mouse immune system, and between fly neuron and glia cells (19–21).
Fig. 1.
Development of the synthetic cell–cell contact sensor in vitro and in vivo. (A) Schematic illustration of the Drosophila Notch receptor, Delta ligand, synNQ, and synthetic GFP ligand (GFP-mcd8-Ser). DSL, Delta/Serrate/Lag-2 motif; EGF, EGF-like repeats; GBN, GFP-binding nanobody; NICD, Notch intracellular domain; NRR, negative regulator region; PBM, PDZ-binding motif. (B) Activation of synNQ using GFP-mcd8-Ser. The artificial ligand and receptor first bind each other through GFP and GBN; then, the pulling force triggered by either cell movement or endocytosis triggers the conformational change of the NRR domain, and initiates the subsequent cleavage at the S2 and S3 sites to release the QF transcriptional factor into the cytosol. QF translocates into the nucleus to activate QUAS-controlled gene expression. (C) Testing of in vitro activation of synNQ using GFP-mcd8-Ser by mixing two cell populations expressing synNQ or ligand, respectively (transactivation), or cotransfection of both synNQ and ligand (cis-activation). Activity of synNQ was measured using a luciferase assay. The synNQ activity was not affected by native Delta ligand in either the trans-condition or cis-condition. GFP ligand significantly activated synNQ in the trans-condition and inhibited its activation in the cis-condition. The error bar indicates SEM. **P < 0.05, ***P < 0.01. (D) synNQ was expressed ubiquitously in the fly wing disk. The UAS-GFPmcd8Ser ligand was driven by ptc-Gal4. Partial activation of synNQ (reported by QUAS-tdTomato) was detected in cells surrounding the GFP-positive cells. All blue channels are DAPI staining. N.S., not significant. (Scale bar: 100 μm.)
Here, we further optimized our synNQ to develop an efficient genetic tool to study direct cell–cell contacts in vivo. We systematically tested the feasibility of synNQ to study cell interaction in various types of fly cells and tissues. Our results indicate that the synNQ system is highly robust and efficient in detecting cell–cell contact in different conditions and can be used effectively to manipulate gene expression in neighboring cells.
Results and Discussion
Development of an Optimized Synthetic Cell–Cell Contact Sensor for in Vitro and in Vivo Studies.
In a previous report, we achieved a sixfold increase in receptor activation using a transprovided artificial GFP ligand (16). Using the same fly tissue culture system, we optimized the synNQ and ligand by incorporating different numbers of EGF repeats, testing Notch receptors from mouse and worm models, and manipulating endocytosis and dimerization of the ligand (Fig. S1). Combining both the optimized ligand and receptor, we were able to achieve a more than 14-fold increase in receptor activation (ratio between ligand-triggered activity and background activity without a ligand), as well as a threefold increase in absolute activity (the absolute activity of the receptors at a similar expression level) of the receptor (Fig. 1 C and D and Fig. S1). The optimized synNQ and GFP ligand are referred to as synNQ and GFPmcd8Ser, respectively.
Fig. S1.
In vitro optimization of synNQs and ligands in cultured cells. (A) Schematic illustrations of different synNQs tested in fly tissue culture. FN, fly Notch; MN, mouse Notch; WN, worm Notch. A series of deletions of EGF repeats was generated. The C-terminal end of the Notch receptor contains a PEST [proline (P), glutamic acid (E), serine (S) and threonine (T)-rich] degradation domain that may negatively regulate the stability of the Notch intracellular domain. The PEST domain may work as a mechanism to reduce the undesirable background activation of Notch by controlled proteolysis. Including a small portion of the endogenous Notch cytoplasmic domain (FNQ8) significantly reduced both the background and ligand-triggered activity, which is probably due to the presence of a myristoylation signal in the region. (B) Test of the activation efficiency of the activity different synNQs using a luciferase assay. All receptors were activated by mixing with cells expressing the GFP-mcd8-LDL ligand. QUAS-luciferase was used as a reporter for the receptor activation. A.U., arbitrary unit. (C) Fold changes of receptor activation before and after activation. FNQ9 was used for further in vivo studies and termed synNQ. (D) Schematic illustration of different GFP ligands tested in tissue culture. The PDZ-binding motif for Delta or Serrate (Ser) ligands was added to the tail of the artificial ligand, because the cytoplasmic tail of the ligands undergoes ubiquitination, which further promotes endocytosis and generates the pulling force. Adding the cytoplasmic tail or endocytotic signal from LDL to the artificial mcd8 ligand can increase the response of the synNQ up to 50–90%. The GPI anchoring signal and dimerization of transmembrane domains were used to cluster the acritical ligand to test if changes in local ligand concentration affect the activation efficiency. (E) Fold changes of luciferase activities using different GFP ligands. FNQ9 (synNQ) was used for the assay. The error bar indicates SEM. DI, Delta; NL, no ligand.
Following in vitro optimization, we tested synNQ in vivo. Although synNQ does not interact with an endogenous ligand (Fig. 1C), the effect of overexpressing the synthetic receptor is unknown. Thus, we first tested the potential toxicity of synNQ using the fly heat shock (hs) promoter, which allowed us to control the expression time and level by shifting the temperature (22). Strong ubiquitous expression of synNQ can be induced after 1 h of hs at 37 °C (Fig. S2A). Ubiquitous expression of synNQ throughout developmental stages did not cause any detectable developmental defects or obvious abnormalities in adult flies, suggesting that synNQ is well tolerated in vivo. We also systematically tested the ligand-independent activity of synNQ in most larval and adult tissues, including the larval CNS (central nervous system), midgut, and imaginal disks and the adult brain, midgut, ovary, and testis. SynNQ is inactive in most of the tested tissues, with only a few specific cells constantly showing a detectable level of ligand-independent activation, which indicates potential machinery for noncanonical Notch activation in these cells (Fig. S2B). We also generated transgenic flies expressing synNQ ubiquitously using the Drosophila Ubiquitin promoter (pUbi), and found that these flies are viable and fertile without developmental phenotypes.
Fig. S2.
In vivo expression and spontaneous activation of the synNQ. (A) Expression of hs-synNQ-Myc in the third-instar larval wing disk. After hs at 37 °C for 60 min, strong synNQ expression was detected in essentially all fly tissues after 1 d (an example of a wing disk is shown here). A high-magnification image showing that the receptor localizes correctly to the plasma membrane is included. (B) hs-synNQ, QUAS-tdTomato animals were used to test the ligand-independent activation of synNQ. Larvae or adult flies were heat-shocked for at 37 °C for 60 min 1 d before dissection. Different tissues were tested, including larval CNS, imaginal disks, midgut, fat body, and lymph gland as well as adult brain, midgut, ovary, and testis. Receptors were activated in posterior photoreceptors in eye disks that project axons into the larval optic lobe, pericardial nephrocytes associated with larval heart and lymph gland, nephrocytes associated with larval midgut proventriculus, and large secretory cells in the female spermatheca. No signal is detected in QUAS-tdTomato-only samples. (Scale bars: 100 μm.)
Next, we generated GFP ligand-positive cells using ptc-Gal4, UAS-GFPmcd8Ser at the anterior-posterior compartment boundary of the larval wing disk. Activation of synNQ was visualized through QUAS-controlled expression of the membrane-tethered mtdTomato. However, although the GFP ligand is strongly expressed using the UAS/Gal4 system (23), activation of synNQ in contacting cells was not very efficient (Fig. 1D), likely due to binding between synNQ and the GFP ligand in the same cell. Indeed, in cultured cells, expressing GFP ligand and synNQ in the same cell not only failed to activate the receptor but also significantly reduced background activity (Fig. 1C), suggesting that cis-provided synNQ interacts with the GFP ligand, thus reducing availability of the ligand. Similar cis-inhibition between a synNQ and a ligand has also been reported in mammalian tissue culture cells (19).
A previous study used different enhancers to drive the ligand and receptor in nonoverlapping domains (20). However, this approach is highly limited to available enhancers. To generate mutually exclusive expression of the ligand and receptor, we used the “FLP-out” strategy (24, 25), which uses flippase (FLP) recombinase-catalyzed excision of DNA sequences between tandemly oriented FLP recombination target (FRT) sites. We combined synNQ with a transcription stop signal, flanked it by FRT sequences, inserted the whole cassette before the GFP ligand, and put the entire construct under the control of the constitutive Ubi promoter (Fig. 2 A and B). In the absence of FLP recombinase, synNQ is expressed ubiquitously in all cells and expression of the GFP ligand is blocked. In the presence of FLP, synNQ is excised, allowing the expression of the GFP ligand (Fig. 2B). We tested this system by expressing FLP using UAS-FLP and ptc-Gal4. Without cis-provided synNQ, GFP-positive cells triggered a very strong activation of synNQ in neighboring cells with 100% efficiency (Fig. 2 C–E), even though the expression level of the ligand induced by the Ubi promoter is weaker than the expression level of the ligand driven by the UAS/Gal4 system. This observation is consistent with the model that low-activation efficiency is indeed due to a cis-inhibition effect.
Fig. 2.
Efficient activation of synNQ in neighboring cells using FLP-out strategy. (A) Genotype of flies to achieve mutual exclusive expression of GFP ligand and synNQ. (B) Schematic illustration of the synNQ FLP-out system using FLP driven by specific Gal4 lines. (C–E) Activation of the synNQ FLP-out system using ptc-Gal4. The whole disk was imaged in a series of z-sections, with the top and middle sections shown in C and D. Myoblast (MB) cells associated with the wing notum are indicated by a white arrow. The zoomed-in image and z-sections of zoom 1 and 2 (Z1 and Z2) are shown in E. synNQ activation in peripodial cells (PC) is indicated by arrowheads (Z1 and Z2 sections) (Fig. S4A). (F) Activation of synNQ using Pct-Gal4 combined with tubGal80TS. All blue channels are DAPI staining. (Scale bars: C, D, and F, 100 μm; E, 25 μm.)
Activation of neighboring cells mainly occurred within a range of one to two cells, consistent with the idea that activation requires direct cell–cell contact (Fig. 2E and Fig. S3 E and F). In addition to activation in the neighboring disk epithelium, we observed strong synNQ activation in disk-associated myoblast cells (Fig. 2 C and E). This observation confirms the previously reported direct cell contact between myoblasts and disk epithelial cells (26). In addition, we detected a relatively weak but consistent activation of synNQ in squamous peripodial cells that lay over the GFP-positive columnar disk-proper cells (Fig. 2E and Fig. S4A). This observation is similar to a previous report that ectopic expression of Delta in peripodial cells triggers Notch activation in disk-proper cells (27), and provides further support that direct cell–cell contact occurs between the apical surfaces of these two distinct epithelial cell types. In addition, we noticed a clear enrichment of the GFP ligand in puncta associated with cytoneme-like cell protrusions (Fig. S3 E and F). Note that these puncta were not observed in the red channel (a membrane-tethered tdTomato through myristoylation), suggesting that they are not due to general membrane association (Fig. S3 E and F). Because the cytonemes are considered to be an important structure for morphogen movement and signaling (28), our observation suggests that the synNQ system does not affect endogenous signaling, and could be used to study signal transduction through cytonemes.
Fig. S3.
Activation of synNQ by randomly generated ligand-positive cells. (A) Genotype of flies used in the experiments. (B) Schematic illustration of synNQ FLP-out system using FLP driven by hs promoter (hsFlp). (C) Larvae were heat-shocked at 37 °C for 30 min and tested for receptor activity after 5 d. Controls were kept at 25 °C without hs. (D–G) Activation of the synNQ receptor surrounding the GFP-ligand–expressing clones in wing and eye disks. Cytoneme-like membrane structures were observed in cells expressing the GFP ligand but not in the membrane-tethered tdTomato cells. (H) Activation of synNQ in the adult midgut. (Scale bars: C, 500 μm; D, G, and H, 100 μm; E and F, 50 μm.)
Fig. S4.
In vivo activation of synNQ by ptc-Gal4. A projection of the z-section of peripodial cells is shown. Activation of synNQ in squamous centripetal cells is indicated by arrows. (Scale bar: 100 μm.)
Because the FLP-out system can be used at all developmental stages, all cells derived from ptc-Gal4–positive cells are permanently labeled with the GFP ligand. Thus, our system can also be used as a lineage-tracing tool reminiscent of the previously reported G-trace system (29). Importantly, a tubGal80ts allele can be used to repress early Gal4 activity and achieve “real-time” capture of cell–cell interactions (Fig. 2F).
Test of SynNQ in Different Fly Organs Using Randomly Generated Ligand-Positive Cells.
We further tested the induction of synNQ in adult and larval tissues by generating random GFP ligand-positive clones using hs-controlled hs-FLP (Fig. 3A and Fig. S3). In addition to disk epithelia (Fig. S3 A–G), activation of synNQ was observed in tracheal cells associated with gastric caeca (Fig. 3B), adult midgut progenitors in the larval midgut (Fig. 3C), salivary glands (Fig. 3D), lymph glands (Fig. 3E), follicle cells in the female ovary (Fig. 3 F and G), and adult midguts (Fig. S3H). Notably, when the entire germline of egg chambers expresses the GFP ligand, all of the follicle cells surrounding the germline (anterior and posterior follicle cells), or surrounded by germline cells [the migratory border cell (BC) cluster], showed synNQ activation (Fig. 3G).
Fig. 3.
Test of synNQ activation in neighboring cells through stochastically generated ligand-positive cells. (A) Genotype of flies used. (B) Activation of synNQ in tracheal cells surrounding the gastric cecum of the larval midgut. (C) Activation of synNQ in larval midgut adult midgut precursor cells. (D) Activation of synNQ in larval salivary glands. (E) Activation of synNQ in the larval lymph gland. (F and G) Activation of synNQ in adult female ovary follicle cells. Clones expressing GFP ligand efficiently activate synNQ in surrounding follicle cells in F. The germline (including both oocyte and nurse cells) expressing the GFP ligand activates all synNQ-expressing follicle cells surrounding them. A migratory BC cluster is highlighted by the arrowhead in G. MB, main body follicle cells. All blue channels are DAPI staining. (Scale bars: B–D, F, and G, 100 μm; E, 50 μm.)
One concern about the application of synNQ is that it introduces artificial binding between neighboring cells, which may affect normal biological process that require rapid changes in relative cell positions, such as cell migration. However, global induction of ligand-positive cells during early fly development (from the first-instar larval stage) does not cause any obvious lethality or developmental defects. Moreover, when the entire female germline expresses the GFP ligand, BCs migrate normally through the germline cells, remodeling of the centripetal follicle cell is unaffected, and posterior migration of the main body follicle cells is also unaffected (30) (Fig. 3F). The absence of detrimental effects is probably due to proteolytic activation of Notch, which removes the artificial bond after activation. This observation suggests that synNQ has advantages over other cell–cell contact visualization techniques, such as GRASP, that create a permanent artificial cell–cell bond (6).
Mapping Cell–Cell Contact Between Different Cell Types.
Using different tissue-specific Gal4 lines, we detected activation of synNQ triggered by interactions between different cell types. For example, btl-Gal4 triggers GFP-ligand expression specifically in tracheal cells (31). Expressing the ligand in the tracheal air sac strongly activated synNQ in the underlying myoblast cells and the disk epithelium (Fig. 4 A and B), consistent with previous reports of direct cell contact between these cell types (26, 32). This tracheal–myoblast interaction is confirmed by activation of synNQ in tracheal cells when the GFP ligand is expressed in myoblast cells with dMef-Gal4 (Fig. S5 A and B). We also found that there are some fibroblast-like cells surrounding GFP-positive tracheal cells, a cell–cell contact that has not been reported before (Fig. 4B). These fibroblast-like cells, positioned on the top of tracheal cells, are dMef-positive, suggesting that they are also myoblast cells (Fig. S5C). Previously, myoblast cells have been reported to migrate proximally out of the wing disk notum to form the dorsal longitudinal indirect flight muscles (33). Our observation suggests that this migration may occur along the tracheal cells. In addition, we find that blt-Gal4 labels larval brain motor neurons in the ventral nerve cord and activates the ensheathing glia cells (Fig. 4C). Further, the GFP ligand from tracheal cells specifically activates synNQ in proventricular ganglion cells in the larval midgut (34) (Fig. 4D), which is not activated by GFP ligands from midgut epithelial cells (Fig. S5D), suggesting that a special interaction exists between tracheal cells and particular neurons.
Fig. 4.
Activation of synNQ in neighboring cells using tissue-specific Gal4 drivers. Activation of synNQ using tracheal-specific Btl-Gal4 in the wing disk (A and B), larval brain (C), and larval midgut (D). In B, tracheal associated fibroblast-like cells are indicated by the arrowheads, and L1 and L2 are cross-sections of the sample at the indicated position using the dashed line. (E–G) Activation of synNQ using slit-Gal4 in the larval brain ventral nerve cord and ring gland. CA, corpus allatum. CA-LP, corpus allatum innervating neurosecretory neurons of the lateral protocerebrum; CC-LP, corpora cardiaca innervating neurosecretory neurons of the lateral protocerebrum; PG-LP, prothoracic gland innervating neurosecretory neurons of the lateral protocerebrum. (H) SynNQ activity in eye disk-associated hemocytes labeled by He-Gal4. (I) SynNQ activation in motor neurons associated with the male accessory gland using Elav-Gal4. (J and K) Activation of synNQ controlled by a mushroom body-specific Gal4 in the adult brain. The indicated white rectangular region is enlarged in K. All blue channels are DAPI staining. (Scale bars: A, D, E, H, I, and J, 100 μm; B, 25 μm; C, 10 μm; F, G, and K, 20 μm.)
Fig. S5.
In vivo activation of synNQ by dMef-Gal4. (A) Activation of synNQ in the air sac and trachea cells by myoblast cells in the wing disk. The dotted line indicates the position of Z-section shown in B. (B) GFP ligand expressed in disk-associated myoblast activates synNQ in both trachea cells and underlying wing disk epithelium. (C) Fibroblast-like cells associated with the tracheal tissue are GFP-positive myoblast cells. Images (from left to right) are different focal planes taken from the top section to the middle section. (D) Expression of GFP in larval midgut epithelium does not activate synNQ in the neurons. (Scale bar: 50 μm.)
Interaction between glia and neurons in the larval brain was tested using the midline glia-specific slit-Gal4 driver (35). The GFP ligand derived from Slit-positive cells strongly activated synNQ in specific neurons in the ventral ganglion (Fig. 4 E and F). Slit-Gal4 also leads to strong ligand expression in the fly prothoracic gland and activated synNQ in the corpus allatum. Importantly, consistent with previous results (36), neurons that send axons into the ring gland can be clearly visualized after a longer exposure (Fig. 4G). These data, together with previous observations made using a trachea-specific Gal4 (Fig. 4D), suggest that synNQ is an efficient tool for identification of neurons that target an organ of interest.
We also tested whether synNQ can detect interactions between hemocytes and other larval tissues using Hermese-Gal4 (He-Gal4), a commonly used pan-hemocyte marker expressed in both undifferentiated and differentiated larval hemocytes (37–39). However, no clear synNQ activation was detected in the larval organs examined, including the brain, disk epithelium, and midgut. Interestingly, however, synNQ was activated in a special group of cells with hemocyte-like morphology that associate with the posterior region of the eye imaginal disk (40) (Fig. 4H). We checked whether these cells correspond to migratory glia also located at the posterior region of the eye disk. However, they were negative for the glia-specific marker Repo (Fig. S6A). One possible explanation is that the FLP-out system fails to label all of the hemocytes that are expressing He-Gal4 efficiently; therefore, the observed synNQ-active red cells may still be regular hemocytes positive for He. To test this possibility, we used He-Gal4 combined with UAS-nlsGFP to activate synNQ. If the observation is due to inefficient labeling, synNQ-active cells should also be positive for nlsGFP. Strikingly, synNQ-positive cells were negative for nlsGFP (Fig. S6 B and C). In addition, synNQ triggered by another classic pan-hemocyte marker, HmlΔ-Gal4, combined with UAS-nlsGFP also revealed similar unlabeled cell populations (Fig. S6D). These data suggest that there may be a previously unidentified population of hemocytes that are not derived from He- or Hml-positive cells.
Fig. S6.
In vivo activation of synNQ in eye disk-associated hemocytes. (A) Glia cells that migrate into the eye imaginal disk are stained by anti-Repo antibody. (B and C) He-Gal4, UAS-nlsGFP is used to activate synNQ in eye disk-associated hemocytes. Cells with synNQ activity are negative for nlsGFP. The dotted box (B) indicates the position of zoomed-in image (C). The arrowheads (B) indicate cells that are He negative and synNQ positive. (D) HmlΔ-Gal4, UAS-nlsGFP is used to activate synNQ in eye disk-associated hemocytes. The dotted box indicates the position of the zoomed-in image on the right. (Scale bar: 50 μm.)
Another unexpected synNQ activation was observed with Elav-Gal4, which is thought to label all neurons (23). Elav-Gal4 triggers GFP expression in larval CNS and motor neurons, and activates synNQ in the associated glia cells (Fig. S7 A and B). Surprisingly, in the adult male reproductive organ, ensheathing glia cells surrounding the motor neurons are positive for GFP ligand, and strong activation of synNQ in the motor neurons was observed (Fig. 4I and Fig. S6). Labeling of glial cells is expected because Elav is transiently expressed in glia cells during differentiation (41). However, the absence of GFP ligand in motor neurons suggests that Elav-Gal4 may not label all neuronal lineages.
Fig. S7.
In vivo activation of synNQ by Elav::Gal4. (A) SynNQ activity is activated using pan-neuron Elav-Gal4 in the larval CNS. (B) Expression of GFP ligand in larval motor neurons and activation of synNQ in the associated glia cells. A projection of different depths of the z-stack is shown: surface (Top) and entire z-stack (Bottom). (C) Activation of synNQ in the male reproductive organ. The GFP ligand is expressed in the ensheathing glia cells (Repo-positive). A zoom-in view (zoom 1) and z-section (zoom 2) of the neuron projection are shown. The dotted line and dotted box indicate the positions of zoomed-in images in columns zoom 1 and zoom 2, respectively. (D) Magnification of the motor neurons innervating the accessary gland. AG, accessary gland; ED, ejaculatory duct. (Scale bars: A, 100 μm; C, 500 μm.)
Finally, we tested the ability of the synNQ system to map long-distance connections between neurons. Using R28H05-Gal4, which specifically labels neurons of the mushroom body in the adult brain (42), we observed activation of synNQ within the same neuron cluster (in this experiment, the FRT > synNQ.Stop.FRT > GFPmcd8Ser was controlled by the Elav promoter to avoid activation of synNQ in glia cells) (Fig. 4 J and K). However, no clear axon extending in or out of the mushroom body was observed. We also tested whether the synNQ system can be used to detect interneuron connections through a single axon by testing the ability of the system to detect the connection between olfactory-receptor neurons (ORNs) and neurons in the antennal lobe. Expressing the GFP ligand in ORNs using Gr21a-Gal4 did not trigger any detectable activation of synNQ in the adult brain (Fig. S8B). Previously, in a mammalian tissue system, a similar synNQ detected cell interactions in cocultured primary neurons and leukemia cells; however, in that case, a considerably larger contact surface was formed between the cells (19).
Fig. S8.
In vivo activation of synNQ in the mushroom body (MB) of the larval brain. (A, Left) Activation of synNQ with Dpp-Gal4 in the larval MB. (A, Right) Receptor activation in the MB is magnified (regions are indicated by white boxes). SynNQ is activated in cells closely associated with the GFP-positive cell cluster. However, no significant neuron in or out of the cluster was observed. (B) No significant synNQ activation was observed by Gr21a-Gal4 in the fly brain olfactory lobe. Z1, zoom 1; Z2, zoom 2. (Scale bar: 100 μm.)
The current synNQ system is effective in mapping cell–cell contacts between most types of cells. However, mapping special types of cell–cell contacts still requires specific engineering. Such contacts include transient interactions, such as interactions between hemocytes and other tissues, and stable interactions with a highly limited interaction surface, such as neurons that are connected through few synapses. In such applications, all current synthetic Notch systems have the same caveat; that is, they respond to the trigger linearly, with the amount of activated receptor, and thus released transcriptional factor, generally proportional to the contacting surface area and the duration of this contact. A stable contact (several hours) and a large cell–cell contact surface (∼10–20 μm2) between epithelial cells will generate significantly stronger signal than an unstable contact (several minutes) and/or a small interacting surface (<1 μm2 for a typical synapse). One strategy to overcome the weak signal issue is to increase the concentration of the ligand and receptor at the contact location, which should have an effect equal to the effect of an increase in the functional contact surface. Therefore, one solution is to increase the expression level of the ligand and the receptor using a stronger binary expression system and to target the ligand and receptor to a specific area of interest, such as a synapse. Another solution would be to use a nonlinear response system as a readout, such as a binary switch system like FLP/FRT or a similar system.
Manipulation of Neighboring Cells to Study Cell–Cell Competition in Developing Epithelia.
Cell competition is a contact-dependent cell–cell interaction mechanism that eliminates slowly dividing cells or damaged cells with tumorigenesis potential, a mechanism that can sometimes be hijacked by tumor cells to expand at the expense of wild-type (WT) neighbors (43, 44) (Fig. 5A). To test the effectiveness of synNQ for genetic manipulation of neighboring cells, we used synNQ to control the expression of QUAS-LglRNAi, which knocks down the cell polarity gene lethal giant larvae (Lgl) (Fig. 5A). Cells with reduced Lgl are eliminated through cell competition (45). Interestingly, after induction of random clones in the wing disk, knocking down Lgl in cells surrounding the GFP-positive clones causes a significant reduction in both synNQ-active cells (red cells labeled by mtdTomato) and the surrounding WT GFP-positive cells (Fig. 5 B and C). The elimination of GFP-positive WT cells may be caused by sustained activation of JNK in WT cells during the cell competition process or by the destabilization of the cell–cell boundary caused by apoptosis of neighboring cells (46).
Fig. 5.
Manipulation of contacting cells using the synNQ system. (A) Cell competition happens between mutant cells (pink) and WT cells (blue). (Top) Previous reports have shown that mutant cells are eliminated by a WT neighbor. (Bottom) Here, mutant cells are created in the surrounding cells around a WT clone. (B) SynNQ was activated in cells surrounding the GFP-positive clone in control tissue. Knocking down Lgl in cells surrounding the GFP-positive clones with QUAS-LglRNAi eliminates not only the mutant cells but also the WT GFP-positive cells. Imaginal disks were tested after 5-d hs induction of clones. All blue channels are DAPI staining. (Scale bar: 100 μm.) (C) Quantification of GFP-positive and RFP-positive cell areas compared with the total wing disk area. The error bar indicates SEM. **P < 0.05.
Concluding Remarks.
We report the optimization of a genetic tool, the synNQ system, and its effectiveness in vivo. Our results showed that synNQ is an efficient method to label and manipulate cells in contact with one another in various cell types and tissues, including flat epithelial cells, neurons, glia, hemocytes, myoblasts, and tubular tracheal cells. The synNQ system combines user-friendly genetics for direct application with a single cross to any Gal4 lines of interest. In addition, using the tubGal80 temperature-sensitive system, precise spatiotemporal control of the synNQ can be easily achieved. When the QF transcriptional factor is used as the downstream effector, its effects can also be inhibited by the QF-specific inhibitor QS and derepressed by quinic acid, thus providing another layer of flexibility to the system (17). Finally, the QF transcriptional factor of synNQ could be replaced with different flavors of Cas9 to either change the target gene (generation of targeted mutation) permanently or manipulate endogenous gene expression (CRISPRi or CRISPRa) (47).
The synNQ system is a robust tool for developmental biology studies. For example, we identified cell–cell interactions between tracheal cells and neurons, unreported cells associated with hemocytes, and a potential new origin of motor neurons. These observations greatly benefit from the ability of synNQ to highlight contacting cells functionally in a way that no previous genetic tool has achieved.
We anticipate that synNQ will be generally useful for many studies, including study of cell–cell interactions in tumor invasion; detection of GFP-tagged proteins immobilized in the extracellular space, such as extracellular matrix (ECM) protein or secreted factors associated with ECM; or imaging cell–cell interactions in real-time using live-cell imaging. We also expect that future engineering of better ligand and receptor pairs with low background activity and high induced responses, as well as using different protein-targeting strategies or alternative signal readouts, will make synthetic Notch systems useful for a much broader range of applications.
Materials and Methods
All DNA constructs were verified by sequencing. Sequences of cDNAs and plasmids can be found in Dataset S1 Transgenic flies were generated by BestGene, Inc. Flies were reared on standard cornmeal/agar medium supplemented with yeast. Adult flies were entrained in 12:12 light/dark cycles at 25 °C. For the FLP-out experiments, first-instar larvae or young adults (3–5 d after eclosion) were heat-shocked at 37 °C for 0.5 h. Additional information about the experimental methods and full genotypes of each figure can be found in SI Materials and Methods.
SI Materials and Methods
Molecular Biology.
The QF2.0 cDNA was obtained from Chris Potter, Johns Hopkins School of Medicine, Baltimore (48). The cDNA of fly Notch was cloned from a whole-fly cDNA preparation. The cDNA of mouse Notch was obtained from Clifford Tabin, Harvard Medical School, Boston. The cDNA of worm Notch/GLP-1 was cloned from a whole-Caenorhabditis elegans cDNA preparation. The cDNA of GFP-binding nanobody (GBN) was synthesized by Integrated DNA Technologies (18). The destination vectors, pWALIUM10-roe, pCaspR4 hs Gateway, Drosophila Ubiquitin promoter (pUbi) Gateway, and pElav Gateway with an attB sequence for site-directed insertion, were from laboratory stocks.
A PCR assay was performed with the proofreading enzyme Phusion (New England Biolabs). Plasmid purification, PCR purification, and gel extraction were performed with a QIAprep Spin Miniprep Kit (QIAGEN), QIAquick PCR Purification Kit (QIAGEN), and QIAquick Gel Extraction Kits (QIAGEN), respectively. In-Fusion cloning and Gateway cloning were performed using In-Fusion HD Liquid Kits (Clontech), and BP and LR Clonase Enzyme Mixes (Thermo Fisher Scientific). All cloning experiments were verified by DNA sequencing.
Signal peptide (SP) from mouse CD8 transmembrane (TM) glycoprotein (MASPLTRFLSLNLLLLGESIILGSGEA), GBN, and QF2.0 with 3XMyc tag were amplified by PCR and assembled into pENTR vector using In-Fusion cloning. A 28-aa linker sequence (SSPRGGGASGGGSGGGGSGGGPRGLADL) was added between the GBN and synNotch sequence to provide maximal flexibility of GFP binding from any direction. To generate GBN-synNQs, different sequences of fly, mouse, and worm Notch receptors were cloned by PCR and inserted between the GBN and QF. The PEST domain of fly Notch (amino acids 2,593–2,703) was inserted between the QF and 3XMyc tag. The synNQ (FNQ9) in the pENTR vector was subcloned into pCaspR4 hs and pUbi Gateway destination vectors. To generate the FRT > synNQ.Stop.FRT > mcd8GFPSer construct, synNQ with Hsp70 polyadenylation signal flanked by the FRT sequence (GAAGTTCCTATACTTTCTAGAGAATAGGAACTTC) was amplified by PCR and inserted- before the kozak sequence (AAA) of the GFP-mcd8-Ser ligand in the pENTR vector. The resulting construct was subsequently recombined into the pUbi-GWattB and pElav-GWattB destination vectors.
For the generation of different GFP-mcd8 ligands, SP of mcd8, EGFP, and the coding sequence of mcd8 (amino acids 33–222) was amplified by PCR and assembled in the pENTR vector using In-Fusion assembly. A 22-aa flexible linker (SRSGGGASGGGSGGGGSGGGRS) was inserted between the GFP and mcd8. Endocytosis signals of Delta, Serrate, or low-density lipoprotein were inserted at the C-terminal of mcd8. GPI anchoring signal (SSNKSISVYRDKLVKCGGISLLVQNTSWMLLLLLSLSLLQALDFISL) from Thy-1 was used to replace the TM domain of mcd8 (amino acids 195–222). Protein dimerization signals from the TM domain of Neuropilin-1 (NRP1; ILITIIAMSALGVLLGAVCGVVLYRKR) or Discoidin domain receptor tyrosine kinase 1 (DDR1; AILIGCLVAIILLLLLIIALMLW) were used to replace the TM domain of mcd8.
A shRNA against Lgl (sequence: CACGAAGATGGTTCTGTTAAA) was generated as previously reported and inserted into pQUAS Gateway expression vector (49). Transgenic flies were generated by BestGene, Inc., using phiC31 site-directed insertion.
Cell Culture Experiments.
The pET-6×HisGFP was transformed into BL21 bacteria and induced by 0.5 mM isopropyl-β-d-thiogalactopyranoside for 12 h. His-tagged GFP was purified as previously described using Ni-NTA agarose beads (Thermo Fisher Scientific) (50). The purified GFP was dialyzed against PBS buffer and concentrated to 2.0 mg/mL using a 3-kDa Amicon Ultra-15 Centrifugal Filter Unit.
Drosophila S2R-positive cells were grown in Schneider’s Drosophila media (Gibco) supplemented with 10% FBS and 0.5% penicillin/streptomycin. Cells were transfected using the Effectene transfection reagent (QIAGEN). To test the efficiency of the synthetic Notch system, cells in one well of a 12-well plate were transfected with DNA mixture that contains 0.01 μg of synNQ in pUbi vector and 0.19 μg of pQUAS-luciferase (for signal-receiving cells) or 0.2 μg of pUbi-GFP ligand (for signal-sending cells). After 2 d of transfection, the signal-sending and signal-receiving cells were washed twice in fresh culture medium, suspended, and mixed together in a 1:1 ratio. The cell mixture was cultured for one additional day before testing for luciferase activity. For the ligand and receptor cotransfection experiment, 0.01 μg of synNQs in pUbi vector, 0.01 μg of pUbi-GFP ligand, and 0.18 μg of pQUAS-luciferase were transfected into S2R-positive cells (a mixture containing 0.01 μg of empty vector, instead of pUbi-GFP ligand, was used as a control). A luciferase assay was performed using the Steady-Glo Luciferase Assay Kit (Promega), and bioluminescent signal was collected on a SpectraMax Paradigm Multi-Mode Microplate Reader.
Drosophila Stocks and Genetics.
The following strains were obtained from the Bloomington Drosophila Stock Center: Hemese-Gal4 (8699); Hemese-Gal4, UAS-nlsGFP (8700); ptc-Gal4 (2017); R28H05-Gal4 (49472); UAS-Flp-PEST (55807); QUAS-tdTomato3XHA/CyO (30043); and hs-Flp, UAS-mcd8GFP, QUAS-tdTomato3XHA (30118). The btl-Gal4 (109128) was from the Kyoto Stock Center. The slit-Gal4/CyO was from C. Klambdt, University of Münster, Münster, Germany. QUAS-LglRNAi, Myo1A-Gal4, Dpp-Gal4, HmlΔ-Gal4, and dMef-Gal4 were from laboratory stocks.
UAS-GFPmcd8Ser was inserted on the second chromosome (attP40), and hs-synNQ, hs-synNQ-PEST, Ubi-synNQ, Ubi-FRT > synNQ.Stop.FRT > GFPmcd8Ser, Elav-FRT > synNQ.Stop.FRT > GFPmcd8Ser, and QUAS-LglRNAi were inserted on third chromosome (attP2).
Immunohistochemistry.
Different Drosophila tissues were dissected and fixed in 4% formaldehyde, blocked by 2% BSA, incubated with a first antibody at 4 °C overnight, washed and incubated with a second antibody for 1 h at room temperature, and finally washed and mounted in Vectashield with DAPI (Vector Laboratories). The following primary antibodies were used: mouse anti–c-Myc antibody (9E10; Santa Cruz Biotechnology), chicken anti-GFP (ab13970; Abcam), mouse anti-HA (ab18181; Abcam), and mouse anti-Repo (DSHB). Secondary antibodies were goat anti-chicken Alexa 488, goat anti-mouse Alexa 488, Alexa 555, and Alexa 647 (used at 1:500; Molecular Probes).
Microscopy and Image Processing.
All images were acquired on Zeiss LSM 780 confocal microscope at 405 nm (for DAPI), 488 nm (for EGFP), 561 nm (for tdTomato), and 633 nm (for Alexa 647). Objectives used were Plan-Neofluar 10×/0.30 lens, Plan-Neofluar 25×/oil 0.8-N.A. lens, and Plan-Apochromat 63× DIC (differential interference contrast) 1.4-N.A. lens. In all micrographs, blue staining shows the nuclear marker DAPI. All images were adjusted and assembled in NIH ImageJ.
The genotypes used in each figure are as follows:
QUAS-tdTomato3XHA; UAS-GFPmcd8Ser/ptc-Gal4; pUbi-synNQ (Fig. 1D)
UAS-Flp-PEST; QUAS-tdTomato3XHA/ptc-Gal4; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser (Fig. 2C)
UAS-Flp-PEST/tub-Gal80ts; QUAS-tdTomato3XHA/ptc-Gal4; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser (Fig. 2F)
hs-Flp, QUAS-tdTomato3XHA; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser (Fig. 3)
UAS-Flp-PEST; QUAS-tdTomato3XHA/btl-Gal4; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser (Fig. 4 A–D)
UAS-Flp-PEST; QUAS-tdTomato3XHA/slit-Gal4; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser (Fig. 4 E–G)
UAS-Flp-PEST; QUAS-tdTomato3XHA; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser/He-Gal4 (Fig. 4H)
UAS-Flp-PEST; QUAS-tdTomato3XHA; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser/Elav-Gal4 (Fig. 4I)
UAS-Flp-PEST/tubGal80ts; QUAS-tdTomato3XHA; Elav-FRT > synNQ.Stop.FRT > GFPmcd8Ser/R28H05-Gal4 (Fig. 4 J and K)
hs-Flp, QUAS-tdTomato3XHA; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser and hs-Flp, QUAS-tdTomato3XHA; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser/QUAS-LglRNAi (Fig. 5)
hs-synNQ (Fig. S2A)
UAS-tdTomato3XHA; hs-synNQ (Fig. S2B)
hs-Flp, QUAS-tdTomato3XHA; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser (Fig. S3)
UAS-Flp-PEST; QUAS-tdTomato3XHA/ptc-Gal4; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser (Fig. S4A)
UAS-Flp-PEST; QUAS-tdTomato3XHA; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser/dMef-Gal4 (Fig. S5 A–C)
UAS-Flp-PEST; QUAS-tdTomato3XHA/esg-Gal4; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser (Fig. S5D)
UAS-Flp-PEST; QUAS-tdTomato3XHA; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser/He > Flp (Fig. S6A)
UAS-Flp-PEST; QUAS-tdTomato3XHA; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser/ He > Flp, UAS-nlsGFP (Fig. S6 B and C)
UAS-Flp-PEST; QUAS-tdTomato3XHA; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser/HmlΔ>Flp, UAS-nlsGFP (Fig. S6D)
UAS-Flp-PEST; QUAS-tdTomato3XHA; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser/Elav-Gal4 (Fig. S7)
UAS-Flp-PEST; QUAS-tdTomato3XHA/dpp-Gal4; pUbi-FRT > synNQ.Stop.FRT > GFPmcd8Ser (Fig. S8A)
UAS-Flp-PEST/ tubGal80ts; QUAS-tdTomato3XHA/Gr21a-Gal4; pElav-FRT > synNQ.Stop.FRT > GFPmcd8Ser (Fig. S8B)
Supplementary Material
Acknowledgments
We thank Dr. Ginger L. Hunter, Dr. Stephen C. Blacklow, Dr. Xiang Ma, and Dr. Qinghua Zhou for support and advice and Stephanie Mohr, Ben Ewen-Campen, and Justin Bosch for comments on the manuscript. This work was supported by the Damon Runyon Cancer Research Foundation (L.H.) and NIH Grant R21DA039582. J.H. is funded by the China Scholarship Council (CSC) (Award 201306260106). N.P. is an investigator of the Howard Hughes Medical Institute.
Footnotes
The authors declare no conflict of interest.
This article contains supporting information online at www.pnas.org/lookup/suppl/doi:10.1073/pnas.1703205114/-/DCSupplemental.
References
- 1.Kamińska K, et al. The role of the cell-cell interactions in cancer progression. J Cell Mol Med. 2015;19:283–296. doi: 10.1111/jcmm.12408. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2.Akins MR, Biederer T. Cell-cell interactions in synaptogenesis. Curr Opin Neurobiol. 2006;16:83–89. doi: 10.1016/j.conb.2006.01.009. [DOI] [PubMed] [Google Scholar]
- 3.Mammoto T, Ingber DE. Mechanical control of tissue and organ development. Development. 2010;137:1407–1420. doi: 10.1242/dev.024166. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Rah JC, Feng L, Druckmann S, Lee H, Kim J. From a meso- to micro-scale connectome: Array tomography and mGRASP. Front Neuroanat. 2015;9:78. doi: 10.3389/fnana.2015.00078. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Cazemier JL, Clascá F, Tiesinga PH. Connectomic analysis of brain networks: Novel techniques and future directions. Front Neuroanat. 2016;10:110. doi: 10.3389/fnana.2016.00110. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Feinberg EH, et al. GFP Reconstitution Across Synaptic Partners (GRASP) defines cell contacts and synapses in living nervous systems. Neuron. 2008;57:353–363. doi: 10.1016/j.neuron.2007.11.030. [DOI] [PubMed] [Google Scholar]
- 7.Martell JD, et al. A split horseradish peroxidase for the detection of intercellular protein-protein interactions and sensitive visualization of synapses. Nat Biotechnol. 2016;34:774–780. doi: 10.1038/nbt.3563. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Desbois M, Cook SJ, Emmons SW, Bülow HE. Directional trans-synaptic labeling of specific neuronal connections in live animals. Genetics. 2015;200:697–705. doi: 10.1534/genetics.115.177006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Wickersham IR, Finke S, Conzelmann KK, Callaway EM. Retrograde neuronal tracing with a deletion-mutant rabies virus. Nat Methods. 2007;4:47–49. doi: 10.1038/NMETH999. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Lal M, Caplan M. Regulated intramembrane proteolysis: Signaling pathways and biological functions. Physiology (Bethesda) 2011;26:34–44. doi: 10.1152/physiol.00028.2010. [DOI] [PubMed] [Google Scholar]
- 11.Chillakuri CR, Sheppard D, Lea SM, Handford PA. Notch receptor-ligand binding and activation: Insights from molecular studies. Semin Cell Dev Biol. 2012;23:421–428. doi: 10.1016/j.semcdb.2012.01.009. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Hébert SS, et al. Coordinated and widespread expression of gamma-secretase in vivo: Evidence for size and molecular heterogeneity. Neurobiol Dis. 2004;17:260–272. doi: 10.1016/j.nbd.2004.08.002. [DOI] [PubMed] [Google Scholar]
- 13.Gordon WR, et al. Structural basis for autoinhibition of Notch. Nat Struct Mol Biol. 2007;14:295–300. doi: 10.1038/nsmb1227. [DOI] [PubMed] [Google Scholar]
- 14.Struhl G, Adachi A. Nuclear access and action of notch in vivo. Cell. 1998;93:649–660. doi: 10.1016/s0092-8674(00)81193-9. [DOI] [PubMed] [Google Scholar]
- 15.Lieber T, Kidd S, Struhl G. DSL-Notch signaling in the Drosophila brain in response to olfactory stimulation. Neuron. 2011;69:468–481. doi: 10.1016/j.neuron.2010.12.015. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16.Gordon WR, et al. Mechanical allostery: Evidence for a force requirement in the proteolytic activation of Notch. Dev Cell. 2015;33:729–736. doi: 10.1016/j.devcel.2015.05.004. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Potter CJ, Tasic B, Russler EV, Liang L, Luo L. The Q system: A repressible binary system for transgene expression, lineage tracing, and mosaic analysis. Cell. 2010;141:536–548. doi: 10.1016/j.cell.2010.02.025. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Rothbauer U, et al. Targeting and tracing antigens in live cells with fluorescent nanobodies. Nat Methods. 2006;3:887–889. doi: 10.1038/nmeth953. [DOI] [PubMed] [Google Scholar]
- 19.Morsut L, et al. Engineering customized cell sensing and response behaviors using synthetic Notch receptors. Cell. 2016;164:780–791. doi: 10.1016/j.cell.2016.01.012. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Huang TH, Velho T, Lois C. Monitoring cell-cell contacts in vivo in transgenic animals. Development. 2016;143:4073–4084. doi: 10.1242/dev.142406. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Roybal KT, et al. Engineering T cells with customized therapeutic response programs using synthetic Notch receptors. Cell. 2016;167:419.e16–432.e16. doi: 10.1016/j.cell.2016.09.011. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22.Pelham HR. A regulatory upstream promoter element in the Drosophila hsp 70 heat-shock gene. Cell. 1982;30:517–528. doi: 10.1016/0092-8674(82)90249-5. [DOI] [PubMed] [Google Scholar]
- 23.Brand AH, Perrimon N. Targeted gene expression as a means of altering cell fates and generating dominant phenotypes. Development. 1993;118:401–415. doi: 10.1242/dev.118.2.401. [DOI] [PubMed] [Google Scholar]
- 24.Harrison DA, Perrimon N. Simple and efficient generation of marked clones in Drosophila. Curr Biol. 1993;3:424–433. doi: 10.1016/0960-9822(93)90349-s. [DOI] [PubMed] [Google Scholar]
- 25.Golic KG, Lindquist S. The FLP recombinase of yeast catalyzes site-specific recombination in the Drosophila genome. Cell. 1989;59:499–509. doi: 10.1016/0092-8674(89)90033-0. [DOI] [PubMed] [Google Scholar]
- 26.Huang H, Kornberg TB. Myoblast cytonemes mediate Wg signaling from the wing imaginal disc and Delta-Notch signaling to the air sac primordium. eLife. 2015;4:e06114. doi: 10.7554/eLife.06114. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27.Pallavi SK, Shashidhara LS. Signaling interactions between squamous and columnar epithelia of the Drosophila wing disc. J Cell Sci. 2005;118:3363–3370. doi: 10.1242/jcs.02464. [DOI] [PubMed] [Google Scholar]
- 28.Kornberg TB. Cytonemes and the dispersion of morphogens. Wiley Interdiscip Rev Dev Biol. 2014;3:445–463. doi: 10.1002/wdev.151. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Evans CJ, et al. G-TRACE: Rapid Gal4-based cell lineage analysis in Drosophila. Nat Methods. 2009;6:603–605. doi: 10.1038/nmeth.1356. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Horne-Badovinac S, Bilder D. Mass transit: Epithelial morphogenesis in the Drosophila egg chamber. Dev Dyn. 2005;232:559–574. doi: 10.1002/dvdy.20286. [DOI] [PubMed] [Google Scholar]
- 31.Shiga Y, Tanaka-Matakatsu M, Hayashi S. A nuclear GFP/ beta-galactosidase fusion protein as a marker for morphogenesis in living Drosophila. Dev Growth Differ. 1996;38:99–106. [Google Scholar]
- 32.Roy S, Hsiung F, Kornberg TB. Specificity of Drosophila cytonemes for distinct signaling pathways. Science. 2011;332:354–358. doi: 10.1126/science.1198949. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Roy S, VijayRaghavan K. Homeotic genes and the regulation of myoblast migration, fusion, and fibre-specific gene expression during adult myogenesis in Drosophila. Development. 1997;124:3333–3341. doi: 10.1242/dev.124.17.3333. [DOI] [PubMed] [Google Scholar]
- 34.Schoofs A, Hückesfeld S, Surendran S, Pankratz MJ. Serotonergic pathways in the Drosophila larval enteric nervous system. J Insect Physiol. 2014;69:118–125. doi: 10.1016/j.jinsphys.2014.05.022. [DOI] [PubMed] [Google Scholar]
- 35.Scholz H, Sadlowski E, Klaes A, Klämbt C. Control of midline glia development in the embryonic Drosophila CNS. Mech Dev. 1997;64:137–151. doi: 10.1016/s0925-4773(97)00078-6. [DOI] [PubMed] [Google Scholar]
- 36.Siegmund T, Korge G. Innervation of the ring gland of Drosophila melanogaster. J Comp Neurol. 2001;431:481–491. doi: 10.1002/1096-9861(20010319)431:4<481::aid-cne1084>3.0.co;2-7. [DOI] [PubMed] [Google Scholar]
- 37.Zettervall CJ, et al. A directed screen for genes involved in Drosophila blood cell activation. Proc Natl Acad Sci USA. 2004;101:14192–14197. doi: 10.1073/pnas.0403789101. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38.Evans CJ, Liu T, Banerjee U. Drosophila hematopoiesis: Markers and methods for molecular genetic analysis. Methods. 2014;68:242–251. doi: 10.1016/j.ymeth.2014.02.038. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.Jung SH, Evans CJ, Uemura C, Banerjee U. The Drosophila lymph gland as a developmental model of hematopoiesis. Development. 2005;132:2521–2533. doi: 10.1242/dev.01837. [DOI] [PubMed] [Google Scholar]
- 40.Froldi F, et al. The lethal giant larvae tumour suppressor mutation requires dMyc oncoprotein to promote clonal malignancy. BMC Biol. 2010;8:33. doi: 10.1186/1741-7007-8-33. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Berger C, Renner S, Lüer K, Technau GM. The commonly used marker ELAV is transiently expressed in neuroblasts and glial cells in the Drosophila embryonic CNS. Dev Dyn. 2007;236:3562–3568. doi: 10.1002/dvdy.21372. [DOI] [PubMed] [Google Scholar]
- 42.Li HH, et al. A GAL4 driver resource for developmental and behavioral studies on the larval CNS of Drosophila. Cell Reports. 2014;8:897–908. doi: 10.1016/j.celrep.2014.06.065. [DOI] [PubMed] [Google Scholar]
- 43.Merino MM, Levayer R, Moreno E. Survival of the Fittest: Essential roles of cell competition in development, aging, and cancer. Trends Cell Biol. 2016;26:776–788. doi: 10.1016/j.tcb.2016.05.009. [DOI] [PubMed] [Google Scholar]
- 44.Di Gregorio A, Bowling S, Rodriguez TA. Cell competition and its role in the regulation of cell fitness from development to cancer. Dev Cell. 2016;38:621–634. doi: 10.1016/j.devcel.2016.08.012. [DOI] [PubMed] [Google Scholar]
- 45.Menéndez J, Pérez-Garijo A, Calleja M, Morata G. A tumor-suppressing mechanism in Drosophila involving cell competition and the Hippo pathway. Proc Natl Acad Sci USA. 2010;107:14651–14656. doi: 10.1073/pnas.1009376107. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46.Tamori Y, Deng WM. Cell competition and its implications for development and cancer. J Genet Genom. 2011;38:483–495. doi: 10.1016/j.jgg.2011.09.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 47.Dominguez AA, Lim WA, Qi LS. Beyond editing: Repurposing CRISPR-Cas9 for precision genome regulation and interrogation. Nat Rev Mol Cell Biol. 2016;17:5–15. doi: 10.1038/nrm.2015.2. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 48.Riabinina O, et al. Improved and expanded Q-system reagents for genetic manipulations. Nat Methods. 2015;12:219–222. doi: 10.1038/nmeth.3250. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 49.Ni JQ, et al. Vector and parameters for targeted transgenic RNA interference in Drosophila melanogaster. Nat Methods. 2008;5:49–51. doi: 10.1038/nmeth1146. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50.Spriestersbach A, Kubicek J, Schäfer F, Block H, Maertens B. Purification of His-tagged proteins. Methods Enzymol. 2015;559:1–15. doi: 10.1016/bs.mie.2014.11.003. [DOI] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.













