Abstract
The main role of RALF small signaling peptides was reported to be the alkalization control of the apoplast for improvement of nutrient absorption; however, the exact function of individual RALF peptides such as RALF34 remains unknown. The Arabidopsis RALF34 (AtRALF34) peptide was proposed to be part of the gene regulatory network of lateral root initiation. Cucumber is an excellent model for studying a special form of lateral root initiation taking place in the meristem of the parental root. We attempted to elucidate the role of the regulatory pathway in which RALF34 is a participant using cucumber transgenic hairy roots overexpressing CsRALF34 for comprehensive, integrated metabolomics and proteomics studies, focusing on the analysis of stress response markers. CsRALF34 overexpression resulted in the inhibition of root growth and regulation of cell proliferation, specifically in blocking the G2/M transition in cucumber roots. Based on these results, we propose that CsRALF34 is not part of the gene regulatory networks involved in the early steps of lateral root initiation. Instead, we suggest that CsRALF34 modulates ROS homeostasis and triggers the controlled production of hydroxyl radicals in root cells, possibly associated with intracellular signal transduction. Altogether, our results support the role of RALF peptides as ROS regulators.
Keywords: Cucumis sativus (cucumber), small signaling peptides, RALF34, root development, overexpression, hairy root transformation, tandem mass spectrometry, proteomics, metabolomics
1. Introduction
Peptides can act as signaling molecules [1,2,3,4]. Small signaling peptides participate in various aspects of the plant life cycle, including development, nutrient availability signaling, and response to environmental cues, similar to canonical phytohormones [5,6,7,8,9,10].
Peptides of the rapid alkalinization factor (RALF) family were isolated from tobacco leaves [11] and have been studied for over twenty years as plant developmental regulators [12]. RALF peptides were discovered to be factors causing rapid alkalization of the medium [11]. They regulate various processes such as root growth and development [13,14,15], root nodule formation [16], fertilization [17,18], fruit ripening [19], and plant–pathogen interactions [20,21].
The Arabidopsis RALF family consists of 37 members [15]. The Arabidopsis RALF34 (AtRALF34) peptide was suggested to be involved in the gene regulatory network controlling lateral root initiation [14]. AtRALF34, regulated by auxin and likely by ethylene, is expressed before the first asymmetric divisions of pericycle cells at the xylem pole [14], as well as before the expression of AtGATA23, the earliest known marker for lateral root initiation, which controls founder cell identity [22]. Arabidopsis RALF34 serves as a negative regulator of lateral root initiation and probably prevents initiation in close proximity to existing primordia [14], acting in a non-cell-autonomous manner similarly to CLE peptides [23,24].
Previously, 17 members of the RALF protein family were identified in cucumber [25]. One peptide, CsRALF34, was proposed to be the ortholog of AtRALF34. CsRALF34, the gene encoding this peptide, is expressed in most plant organs, i.e., in the roots, hypocotyls, cotyledons, leaves, male and female flowers, as well as fruits. The expression of CsRALF34 in roots is not regulated by auxin but seems to be partially inducible by ethylene [25]. Relative transcript levels of CsRALF34 were downregulated in roots treated with 10 μM 1-aminocylopropane-1-carboxylic acid (ACC, a precursor of ethylene) but were not affected by treatment with 1 μM 2-aminoisobutyric acid (AIB, an inhibitor of ethylene biosynthesis).
In the roots of Arabidopsis and cucumber, the expression of RALF34 started in the protoxylem cells before any visible sign of lateral root initiation [14,25]. In contrast to Arabidopsis, in cucumber, this process began very close to the initial cells in the apical part of the root meristem [25]. In the cucumber pericycle, RALF34 promoter activity was first detected in the single lateral root founder cell before auxin response maxima were established in the two pericycle cells, which gave rise to lateral root primordia. RALF34 promoter activity was found in lateral root primordia until lateral root emergence. Recently, we have shown that in cucumber roots, RALF34 was synthesized in the xylem and pericycle cells, then transported and accumulated in the apoplast and cell walls of the cortex cells in the basal part of the meristem [25].
Signal transduction involving RALF peptides and their receptors includes dozens of different signaling pathways and signal molecules. There are numerous reviews analyzing and systematizing individual components of this complex signaling machinery [12,26,27,28,29,30]. However, each molecular player of the RALF signaling pathway is not clearly understood, nor are the accompanying alterations in root metabolism. Although the dynamics of root cell metabolism can efficiently be characterized by conventional biochemical methods [31,32], in the most efficient and straightforward way, this can be addressed by post-genomic research methods in terms of the proteomics and metabolomics methodological platforms [33,34,35]. A combination of these two bioanalytical techniques is universally recognized as the best suited to analyze the metabolic shifts during root development [36].
To gain deeper insight into the changes in the cucumber proteome associated with the overexpression of CsRALF34, a bottom-up shotgun proteomics approach can be employed. This analytical strategy relies on the limited digestion of total protein isolates with site-specific proteases combined with subsequent analysis of the resulting proteolytic peptides using nano-flow liquid chromatography-mass spectrometry (nanoLC-MS) [37]. This method is free from any bias for protein pI, hydrophobicity, and molecular weight when combined with highly efficient phenol-based extraction procedures and MS-friendly digestion techniques [38] that enable an analysis of the total proteome [39]. Therefore, shotgun bottom-up proteomics are the method of choice for the characterization of plant proteome responses, i.e., dynamics of the abundance of individual proteins, in the context of the biochemical and physiological changes accompanying developmental processes [40,41].
However, metabolic shifts can be caused not only by changes in protein levels but also by the modulation of enzyme activity [42]. The latter effects cannot be recognized at the proteome level. Thus, the dynamics of corresponding metabolites need to be addressed by metabolomics. Nevertheless, analysis of primary and secondary metabolites can efficiently complement the proteomics data towards a better insight into the biochemical response accompanying lateral root formation [43]. The overlay of the protein and metabolite dynamics can provide a generalized overview of the metabolic pathways which are up- or downregulated under experimental conditions [44]. This information is also important for the identification of the signaling pathways involved, although the patterns of post-translational enzyme modifications are informative in this context as well [45]. A comprehensive study of the proteome, metabolism, and biochemical markers of stress is required for a thorough analysis of the effect of RALF34.
In this study, CsRALF34 overexpression in cucumber roots was used to elucidate the role of this gene at the early stages of lateral root initiation in the apical meristem of the parental root. The effect of CsRALF34 overexpression was analyzed in detail at the molecular level using proteomics and metabolomics techniques.
2. Results
2.1. Overexpression of CsRALF34 Does Not Affect Lateral Root Initiation in Cucumber
Transgenic hairy root systems overexpressing CsRALF34 were used to clarify the role of CsRALF34 during the early steps of lateral root initiation in the apical meristem of cucumber parental roots (Figure 1). Hairy root transformation of cucumber was performed with a control construct (p35S::gusA) and the overexpression construct (p35S::CsRALF34), respectively. Expression levels of CsRALF34 were analyzed using RT-qPCR in individual transgenic roots, showing that relative expression levels of CsRALF34 were upregulated compared with control roots by 12- to 59-fold (Figure 1A). The Lateral Root Initiation Index (ILRI) was determined for the control group (GUS control) and for roots overexpressing CsRALF34 (RALF34-OE) (Figure 1B). The ILRI of roots overexpressing CsRALF34 showed no statistically significant differences from the ILRI of control roots.
Figure 1.
Overexpression of Cucumis sativus RALF34 in transgenic roots. (A) Expression of CsRALF34 in control roots (GUS control) and in roots with an overexpression construct (RALF34-OE). RT-qPCR analysis was performed using RNA isolated from the control group (mix of roots) and from individual transgenic roots. Statistical analysis using Wilcoxon’s signed-rank test showed a significant increase (*, p < 0.001) of expression levels in the overexpression group compared with the control. The y-axis indicates the relative transcript level (2–ΔΔCT method). (B) The Lateral Root Initiation Index in three outer cortical layers of control roots (GUS control) and of roots overexpressing RALF34 (RALF34-OE). Statistical analysis using Wilcoxon’s signed-rank test showed no significant differences (p > 0.05) in the ILRI of individual roots in the overexpression group compared with control roots.
2.2. Treatment of Cucumber Roots with Synthetic CsRALF34 Affects Root Growth but Not Lateral Root Initiation
Wild-type cucumber roots were treated with 2 μM CsRALF34 peptide for 48 h (Figure 2A). Before the start of the experiment, no statistically significant differences in root length were observed between cucumber seedlings in the control and in the peptide-treated group; the average initial root length was 6.03 cm for the control and 6.11 cm for the peptide-treated group. After 48 h of treatment, the average root length of the control group had increased from 6.03 cm to 9.71 cm (root length increment of 3.68 cm). In the peptide-treated group, it had increased from 6.11 cm to 8.75 cm (root length increment 2.64 cm). The root length increment of the peptide-treated group was 1.04 cm lower than that of the control group, a statistically significant difference (p < 0.001). The ILRI was determined for both groups (Figure 2B); there was no statistically significant difference between the ILRI of peptide-treated roots and control group roots.
Figure 2.
Comparison of Cucumis sativus roots treated with 2 μM synthetic CsRALF34 peptide for 48 h. (A) Comparison of average root length between the control group (mock, n = 100) and treated roots (+CsRALF34, n = 100). Statistical analysis using Wilcoxon’s signed-rank test showed no significant differences in root length before treatment (ns) and significant differences in root length (*, p < 0.001) after treatment. (B) Comparison of the Lateral Root Initiation Index in three outer cortical layers. Statistical analysis using Wilcoxon’s signed-rank test showed no significant differences (p > 0.05) between the ILRI values of control roots (mock, n = 14) and treated roots (+CsRALF34; n = 10).
2.3. Overexpression of CsRALF34 Does Not Affect the Expression of CsGATA14, CsGATA24, and CsE2F/DP Genes
During the overexpression experiment (2.1), we also analyzed the expression levels of representatives of the CsE2F/DP family, i.e., CsE2Fa, etc., and of the cucumber orthologs of AtGATA23. The cucumber proteome contains six members of the E2F/DP protein family (CsE2F/DP) (Figure 3). The expression of the six cucumber CsE2F/DP genes encoding these proteins were analyzed in control roots and in roots overexpressing CsRALF34. CsRALF34 overexpression did not affect the expression levels of any of these genes (Figure 4). Expression of levels of the GATA genes, CsGATA14 and CsGATA24, previously proposed to represent AtGATA23 orthologs in cucumber [46], were examined as well. The expression levels of both genes did not change in response to CsRALF34 overexpression (Figure 4).
Figure 3.
Phylogenetic tree of E2F/DP proteins from Arabidopsis thaliana and Cucumis sativus. The three different clades of E2F/DP proteins are presented in different colors. Gene ID prefixes: AT, A. thaliana based on the Arabidopsis Information Resource; Csa, C. sativus cv. Chinese Long v2 based on the Cucurbit Genomics Database v1. Scale bar: 0.05 amino acid substitutions per site.
Figure 4.
Relative transcript levels of Cucumis sativus RALF34, GATA14, GATA24, and E2F/DP genes in control roots and in roots overexpressing CsRALF34. GUS control, transgenic roots expressing GUS; RALF34-OE, transgenic roots overexpressing CsRALF34. Statistical analysis using Wilcoxon’s signed-rank test showed significant differences (*, p < 0.05) between expression levels in the overexpression group compared with the control only for CsRALF34 (asterisk). The y-axis indicates relative transcript levels (2−ΔΔCT method).
2.4. Analysis of Biochemical Stress Response Markers in Cucumis Sativus Roots
The effects of the RALF34 peptide might be related to the plant stress response. To obtain a preliminary overview of the dynamics of lipid peroxidation, membrane integrity, and the status of antioxidant defense in control roots vs. roots overexpressing CsRALF34, several markers of the cellular antioxidant defense status, i.e., the tissue levels of hydrogen peroxide, lipid hydroperoxides, thiobarbituric acid-reactive substances (expressed as malondialdehyde equivalents, TBARS), and ascorbic acid/dehydroascorbate balance, were analyzed (Figure 5). The results clearly indicated that hydrogen peroxide levels were significantly lower in roots overexpressing CsRALF34 in comparison to control roots (Figure 5A). In contrast, the contents of thiobarbituric acid-reactive substances were increased almost two-fold in roots overexpressing CsRALF34 compared with control roots (Figure 5B). On the other hand, the levels of lipid hydroperoxides and ascorbate were not affected by the overexpression of CsRALF34 (Figure S1-2A,B). Interestingly, the contents of ascorbic acid were below the quantification limit in all samples, i.e., the ascorbate pool was represented only by the oxidized form of ascorbate, dehydroascorbate (data not shown).
Figure 5.
Biochemical characterization of Cucumis sativus transgenic control roots (p35S::gusA, GUS-control) compared with roots overexpressing CsRALF34 (p35S::CsRALF34, RALF34-OE). (A) Hydrogen peroxide contents in control roots and roots overexpressing CsRALF34; (B) contents of thiobarbituric acid-reactive substance (TBARS) in control roots and roots overexpressing CsRALF34 (determined as malondialdehyde equivalents). Asterisks denote statistically significant differences between groups of samples, t-test: p < 0.05. The raw data are summarized in Supplementary Information S2.
2.5. Metabolomics Analysis
2.5.1. Analysis of Primary Metabolites
The analysis of primary metabolites relied on two methods: gas chromatography-quadrupole mass spectrometry with EI ionization (GC-EI-Q-MS) and ion-pair reversed-phase high-performance liquid chromatography coupled online with triple quadrupole tandem mass spectrometry (RP-IP-HPLC-QqQ-MS/MS). After processing, both datasets were merged into one matrix prior to statistical evaluation.
The first approach, GC-EI-Q-MS, aimed to identify and relatively quantify thermally stable primary metabolites and revealed 321 total compounds, annotated in the aqueous methanolic extracts, obtained from cucumber control roots (GUS control) or from roots overexpressing CsRALF34 (RALF34-OE), respectively (Table S1-4). In this group, 234 individual compounds were identified as primary metabolites by spectral similarity search against available libraries and/or co-elution with authentic standards. Some metabolites appeared as several isomers and/or methoxyamine-trimethylsilyl derivatives; therefore, the total number of metabolites identified was only 175. The identified metabolites represented 27 amino acids, 6 amines, 15 fatty acids and esters, 29 organic acids (lactic, glycolic, salicylic, benzoic acids, as well as di- and tricarboxylic intermediates of the TCA cycle), 53 sugars (monosaccharides with uronic, aldonic acids, and phosphorylated derivatives, di- and oligosaccharides), 16 phenolic compounds, 3 heterocyclic compounds, 3 co-factors, 1 sterol, and 22 representatives of other classes.
The second metabolomics approach, RP-IP-HPLC-QqQ-MS, aimed to identify and relatively quantify thermally labile metabolites and revealed 157 annotated analytes in total (Table S1-5). This included: 37 nucleosides and nucleotides and their derivatives; 26 amino acids; 8 sugars and their derivatives, sugar acids and sugar alcohols; 24 sugar phosphates; 27 carboxylic acids; 4 fatty acid derivatives; 7 non-nucleotide heterocyclic compounds, including 3 imidazoles, 3 inorganic compounds, 4 inositol phosphate derivatives, and 7 terpenes; 3 thioesters; 4 vitamins; 1 benzene derivative; and 2 representatives of other classes.
After merging the two result sets, a combined matrix with 391 entries was built and processed using the MetaboAnalyst 5.0 online software tool. Hierarchical clustering analysis with a heatmap representation of the normalized relative abundances corresponding to the individual metabolites revealed essential intra-group variability in both the control group and in CsRALF34 overexpressing roots (Figure 6A). Thus, variability within the control group was higher than in the CsRALF34-overexpressing group (Figure S1-3). The principal component analysis did not show a complete separation of the two groups in the corresponding score plots, while 75.6% of the total variance could be explained by the first principal component (PC1, Figure 6B).
Figure 6.
Illustration of quantitative differences in the profiles of primary metabolites associated with CsRALF34 overexpression. (A) Results of hierarchical clustering with a heatmap representation of the 30 most abundant metabolites obtained from Cucumis sativus control roots and roots overexpressing CsRALF34 (GUS control and RALF34-OE, respectively). (B) Principal component analysis with a score plot and (C) volcano plot with a graphical representation of differentially abundant analytes (Benjamini–Hochberg false discovery rate correction at p ≤ 0.05 and fold change (FC) ≥ 1.5) obtained for GUS control and RALF34-OE, respectively.
Despite the essential intra-group variability, the control group and the CsRALF34 overexpressors demonstrated clear differences in their metabolic profiles. A t-test with Benjamini–Hochberg false discovery rate (FDR) correction at p ≤ 0.05 revealed that 26 metabolites were significantly downregulated in transgenic cucumber hairy roots overexpressing the CsRALF34 gene (Figure S1-4). A fold change (FC) analysis (with an FC cut-off of FC ≥ 1.5) revealed 33 upregulated and 15 downregulated metabolites, demonstrating abundance dynamics associated with CsRALF34 overexpression (Figure S1-5). Finally, the combination of these two criteria yielded ten metabolites, three of which were downregulated, while seven were upregulated upon the overexpression of CsRALF34 (Table 1, Figure 6C). D-mannose, cGMP, and gluconic and/or galacturonic acid appeared to be most responsive to CsRALF34 overexpression and demonstrated clear down-regulation in the RALF34-OE roots. The group of upregulated metabolites included nicotinic acid, adenosine, glucose-1-phosphate, arginine, orotidine 5′-monophosphate, ornithine, and 6-phosphogluconic acid.
Table 1.
Primary metabolites of Cucumis sativus roots demonstrating statistically significant regulation associated with the overexpression of CsRALF34.
| Regulated Metabolites | FC * | log2(FC) | p adjusted | −lg(p) | |
|---|---|---|---|---|---|
| DOWNREGULATED | D-mannose | 0.343 | −1.542 | 0.029 | 1.538 |
| cGMP | 0.391 | −1.356 | 0.006 | 2.242 | |
| gluconic/galacturonic acid | 0.648 | −0.625 | 0.047 | 1.324 | |
| UPREGULATED | nicotinic acid | 1.665 | 0.735 | 0.006 | 2.242 |
| adenosine | 1.745 | 0.803 | 0.009 | 2.053 | |
| glucose-1-phosphate | 1.813 | 0.858 | 0.049 | 1.310 | |
| arginine | 1.825 | 0.868 | 0.020 | 1.703 | |
| orotidine 5′-monophosphate | 1.916 | 0.938 | 0.049 | 1.310 | |
| ornithine | 2.151 | 1.105 | 0.011 | 1.965 | |
| 6-phosphogluconic acid | 2.346 | 1.230 | 0.029 | 1.538 | |
* FC, fold change in the abundance of individual metabolites in the Cucumis sativus roots with CsRALF34 overexpression compared with GUS control roots; only Benjamini–Hochberg false discovery rate correction-adjusted (padjusted) data (p ≤ 0.05, FC ≥ 1.5) are presented.
2.5.2. Analysis of Semi-Polar Secondary Metabolites
The analysis of semi-polar secondary metabolites revealed 486 and 374 compounds detected in negative and positive ion mode, respectively, which were organized in two data matrices according to their ionization mode. The principal component analysis (PCA) of both datasets combined revealed no group separation in the corresponding score plots (Figure S1-6A,B). As can be seen from the results of hierarchical clustering with heat map representation (Figure S1-6C,D), this observation might be explained by high intra-group variability, which was comparable to the inter-group dispersion. However, as can be seen from the corresponding volcano plots (Figure S1-6E,F), the majority of the analytes only exhibited minimal (within 1.5-fold) non-significant inter-group differences. Although several analytes demonstrated very strong FC responses to CsRALF34 overexpression, the intensity of the corresponding levels varied strongly within the groups. Thus, in contrast to the primary metabolome, the secondary metabolome was not significantly affected by CsRALF34 overexpression.
2.6. Protein Isolation and Tryptic Digestion
To ensure the efficient extraction of root proteins and the maximal possible coverage of the Cucumis sativus proteome, we selected the phenol-based protein extraction method. Determination of the protein concentrations in the obtained isolates revealed extraction yields in the range of 0.234–0.463 mg/g fresh weight (Table S1-3). The assay precision was determined by SDS-PAGE with 5 µg of protein per lane (Figure S1-7). Gel-based cross-validation by the densitometric assessment of Coomassie-stained gels revealed overall lane densities of 1.53 × 106–1.82 × 106 arbitrary units (AU, RSD = 5.8%, Table S1-6). This RSD value was sufficient for sample amount normalization and did not require additional recalculation. The signal patterns observed in the electropherograms were similar between lanes (Figure S1-7A,B). Tryptic digestion of the obtained protein isolates was considered to be complete, as no bands could be detected (Figure S1-7C,D) [47].
2.7. Annotation of Cucumis sativus Proteins
In total, 10,378 peptides were identified by MS/MS spectra in the whole dataset. Among them, 8561 and 8780 peptides were identified in control roots and in roots overexpressing CsRALF34, respectively (Figure S1-8A, Supplementary information S3, Table S3-1). Among these, 6983 peptides (67.3%) occurred in both groups, while 1598 (15.4%) and 1797 (17.3%) peptides were unique for either control or CsRALF34-overexpressing roots, respectively. Based on these identifications, 2302 possible proteins could be annotated (2147 and 2120 in control roots and in CsRALF34 overexpressors, respectively, Figure S1-8B, Table S3-2), which represented 1946 non-redundant proteins (i.e., protein groups): 1821 vs. 1802 in control roots vs. CsRALF34 overexpressors (Figure S1-8C, Table S3-3). Among these, 1965 proteins (85.4%) were common for both groups, 182 (7.9%) and 155 (6.7%) proteins were unique for controls or CsRALF34 overexpressors, respectively (Figure S1-8B, Table S3-2). However, all these identifications relied exclusively on MS/MS spectra and did not consider inter-group alignments, which can result in the identification of some proteins as group-specific, although the corresponding peptide signal was detectable in the other group as well, but not fragmented. Fortunately, this issue can be solved by label-free quantification.
2.8. Label-Free Quantification
In the first step, we characterized the observed differences by principal component analysis applied to the whole dataset (Figure 7). The results indicated low intra-group dispersion and a high degree of explained inter-group variance, i.e., more than 93% of group-specific proteins provided reliable group separation by principal component 1 (PC1). On the PC2 axis, no inter-group separation could be observed.
Figure 7.
Principal component analysis with a score plot for transgenic Cucumis sativus roots containing either p35S::gusA (GUS controls) or p35S::CsRALF34 (RALF34-OE). Principal component 1 (PC1) showed the inter-group differences (93% of explained variability) associated with CsRALF34 overexpression.
Label-free quantification revealed 208 differently expressed proteins (t-test: p ≤ 0.05, FC ≥ 1.5, Supplementary information S4) in cucumber hairy roots overexpressing CsRALF34 among the 2302 annotated proteins. Among the differentially expressed proteins, 92 were upregulated, and 116 were downregulated in CsRALF34 overexpressors compared with control roots (Table S4-1 and Table 2, respectively). The most strongly upregulated proteins were thioredoxin (17.8-fold), glutathione peroxidase (17.2-fold), carnitine operon protein CaiE (16.6-fold), and wound/stress protein (16.5-fold) (Table 2). The 70 kDa heat shock protein (21.1-fold), ubiquitin-like domain-containing CTD phosphatase (18.7-fold), and phloem lectin (18.2-fold) demonstrated the most pronounced downregulation (Table 2). PCA of the set of differentially expressed proteins confirmed the inter-group separation observed with the whole root proteome based on principal component 1 (PC1, 99.1% of the explained variance can be seen in the score plot presented in Figure S1-9A). To assess the contribution of individual proteins to the differences associated with CsRALF34 overexpression, the corresponding loading plot, and biplot were analyzed (Figure S1-9B,C). The top 25 loadings which most strongly contributed to the CsRALF34-associated alterations in the cucumber root proteome are listed in Table 2 (all loadings of differentially expressed proteins are listed in Table S1-7). Among them, thioredoxin, glutathione peroxidase, acidic endochitinase, tripeptidyl peptidase II, and protein transport protein SEC23 were upregulated (FC range 17.8–1.9-fold) and 70 kDa heat shock protein, ubiquitin-like domain-containing CTD phosphatase, phloem lectin, 10 kDa chaperonin, NADH dehydrogenase, and UDP-glycosyltransferase 1 were downregulated (FC range 21.1–1.6-fold).
Table 2.
Top 25 differentially expressed proteins with the highest impact on the inter-group differences observed in the principal component analysis performed for 208 differentially expressed proteins.
| Protein Name | Accession a | Direction of Alterations b | PC1 | FC c | p adjusted d | Functional Annotation | Prediction of Localization |
|---|---|---|---|---|---|---|---|
| Thioredoxin | Csa2g362500.1 | up | 0.084 | 17.8 | 5.3 × 10–35 | redox homeostasis | cytosol |
| Glutathione peroxidase | Csa5g154200.1 | up | 0.081 | 17.2 | 4.4 × 10–35 | redox homeostasis | cytosol, mitochondrion |
| Ribosomal protein L19 | Csa4g001980.1 | up | 0.081 | 17.0 | 5.6 × 10–35 | protein biosynthesis | cytosol |
| CHP-rich zinc finger protein-like | Csa3g850660.1 | up | 0.081 | 17.2 | 6.8 × 10–35 | not assigned | cytosol |
| 40S ribosomal protein S24 | Csa2g012120.1 | up | 0.080 | 16.7 | 3.2 × 10–34 | protein biosynthesis | cytosol |
| Carnitine operon protein CaiE | Csa1g001460.1 | up | 0.079 | 16.6 | 5.6 × 10–35 | cellular respiration | mitochondrion |
| Wound/stress protein | Csa6g500520.1 | up | 0.078 | 16.5 | 4.4 × 10–35 | not assigned | endoplasmic reticulum |
| Porin/voltage-dependent anion-selective channel protein | Csa6g404150.1 | up | 0.078 | 16.5 | 5.6 × 10–35 | solute transport | mitochondrion |
| 60S ribosomal protein L18a | Csa4g608120.1 | up | 0.077 | 16.4 | 6.8 × 10–35 | protein biosynthesis | cytosol |
| Phosphofructokinase | Csa1g575110.1 | up | 0.077 | 16.0 | 8.7 × 10–35 | cellular respiration | cytosol |
| Eukaryotic translation initiation factor 3 subunit C | Csa3g223320.1 | up | 0.077 | 16.3 | 1.4 × 10–32 | protein biosynthesis | nucleus |
| Pleckstrin homology domain-containing family A member | Csa3g134900.1 | up | 0.077 | 16.3 | 5.0 × 10–16 | lipid metabolism | plasma membrane |
| 3-oxoacyl-[acyl-carrier-protein] synthase 3 | Csa5g160250.1 | up | 0.076 | 16.3 | 9.0 × 10–35 | lipid metabolism | plastid |
| RNA-binding protein 8A | Csa1g616290.1 | up | 0.076 | 16.1 | 8.3 × 10–35 | RNA processing | nucleus |
| Transmembrane 9 superfamily protein member | Csa1g256720.1 | up | 0.075 | 15.3 | 9.5 × 10–35 | not assigned | plasma membrane |
| 70 kDa heat shock protein | Csa2g070310.1 | down | −0.100 | 21.1 | 1.7 × 10–35 | protein homeostasis | cytosol |
| Ubiquitin-like domain-containing CTD phosphatase | Csa5g587150.1 | down | −0.089 | 18.7 | 4.5 × 10–35 | protein modification | nucleus |
| Phloem lectin | Csa4g500830.1 | down | −0.086 | 18.2 | 4.8 × 10–35 | not assigned | plastid |
| AP-4 complex accessory subunit tepsin | Csa3g462690.1 | down | −0.083 | 17.6 | 2.4 × 10–34 | vesicle trafficking | Golgi apparatus |
| 10 kDa chaperonin | Csa5g570400.1 | down | −0.083 | 17.6 | 4.8 × 10–35 | protein homeostasis | plastid |
| Pentatricopeptide repeat-containing protein | Csa3g840460.1 | down | −0.082 | 17.5 | 1.7 × 10–35 | not assigned | plastid |
| 60S ribosomal protein L32 | Csa1g462020.2 | down | −0.082 | 17.3 | 2.0 × 10–30 | protein biosynthesis | cytosol |
| Subtilisin-like serine protease | Csa5g187860.1 | down | −0.081 | 17.4 | 8.3 × 10–35 | protein homeostasis | vacuole |
| Protein MEMO1 | Csa2g382410.1 | down | −0.081 | 17.2 | 6.8 × 10–35 | not assigned | mitochondrion |
| NADH dehydrogenase 1 alpha subcomplex subunit 13 | Csa2g169710.1 | down | −0.079 | 16.9 | 5.6 × 10–35 | cellular respiration | mitochondrion |
a The identification of peptides and annotation of proteins relied on a search against amino acid sequences from Cucumis sativus cv. Chinese Long v2 using the SEQUEST algorithm; Mercator4 was used for protein annotation; subcellular localization of proteins was predicted with the WoLF PSORT tool. Data are available via ProteomeXchange with the identifier PXD037725. b The direction of alteration is specified as upregulated (up) or downregulated (down); c FC, fold change; d padjusted, adjusted p-value.
2.9. Functional Annotation of CsRALF34-Regulated Proteins
Functional annotation of the prospective CsRALF34-dependently regulated proteome (i.e., 208 proteins identified as differentially expressed) relied on Mercator4 software. The analysis revealed 26 functional classes (bins, Figure 8, Supplementary Information S5) among the 29 available. The up- or downregulated proteins were represented by 25 and 22 bins, respectively (i.e., proteins involved in the DNA damage response, multi-process regulation, and solute transport were downregulated, whereas the polypeptides related to chromatin organization, photosynthesis, RNA biosynthesis, secondary metabolism, and solute transport were upregulated).
Figure 8.
Functional annotation of the proteins identified as differentially abundant in Cucumis sativus transgenic roots overexpressing CsRALF34 compared with transgenic GUS control roots. Numerical values indicate the numbers of proteins constituting individual up- (green) or downregulated (red) functional classes. The individual proteins comprising each functional group (in addition to all related information) are listed in Supplementary Information S5.
The group of upregulated proteins was dominated by those involved in protein biosynthesis (15 entries), with ribosomal proteins L19, L18a, L35, S24, and eukaryotic translation initiation factor 3 showing the highest abundance gain in CsRALF34 overexpressors (17.0-, 16.4-, 15.7-, 16.7-, and 16.3-fold, respectively). Proteins involved in vesicle tracking also strongly contributed to the upregulated group with eight entries in total (for example, vacuolar-sorting receptor 7, exocyst complex component, and general vesicular transport factor p115 with 14.9-, 14.9-, or 13.1-fold changes in abundance) were part of this group. For 12 proteins (13.3% of all upregulated species), no function could be assigned in terms of the available bins; these were indicated as “not assigned” (Figure 8).
The group of downregulated polypeptides was dominated by those involved in protein homeostasis (15 entries) with 70 kDa heat shock protein, 10 kDa chaperonin, subtilisin-like serine protease, and Clp protease showing a decreased abundance in CsRALF34 overexpressors (21.1-, 17.6-, 17.4-, and 16.2-fold, respectively). Enzymes involved in protein modification also strongly contributed to the downregulated group, represented by seven entries. These included glycylpeptide N-tetradecanoyltransferase and dolichyl-diphosphooligosaccharide-protein glycosyltransferase with 16- and 15.4-fold abundance changes, respectively. For 22 downregulated proteins (17.6%), the function could not be established, and they were indicated as “not assigned” (Figure 8).
The prediction of subcellular localization relied on WoLF PSORT with subsequent manual verification based on database and literature data (Supplementary Information S6). The results showed that the cytosol, plastids, and nucleus most strongly contributed to the CsRALF34-affected proteome (33.3%, 18.1%, and 17.6%, respectively (Figure 9A,B). On the other hand, the cell wall, peroxisome, oil body, and cytoskeleton proteins (1.9%, 1.9%, 1.0%, and 0.5%, respectively) were least affected by CsRALF34 overexpression in cucumber roots. Interestingly, the localization patterns of up- and downregulated proteins were rather similar.
Figure 9.
Prediction of the sub-cellular localization of proteins identified as up- (A) or downregulated (B) in Cucumis sativus transgenic roots overexpressing CsRALF34. Numerical values indicate the numbers of proteins with locations predicted to specific compartments. The individual proteins annotated to specific predicted compartments are listed in Supplementary Information S6.
2.10. The Effects of CsRALF34 on Root Metabolic and Signaling Pathways
The metabolic and signaling pathways affected by CsRALF34 overexpression were examined by mapping individual regulated proteins using the Kyoto Encyclopedia of Genes and Genomes (KEGG) database. Based on these data, the activation of specific signaling pathways, changes in sugar and tricarboxylic acid metabolism, and enhancement of protein biosynthesis and transport could be observed in root cells of CsRALF34 overexpressors compared with control roots (Figure 8, Supplementary Information S5).
In addition to the metabolic shifts, the overexpression of CsRALF34 resulted in pronounced increases in the abundance of calcium-dependent protein kinase (2.7.11.1), protein phosphatase 2C (3.1.3.16), and checkpoint kinase (2.7.11.1). These proteins have been linked to cell cycle control and stress adaptation (Figure 10). Furthermore, the levels of thioredoxin 1, heat shock proteins Hsp 90 and Hsp 72, ubiquitin carboxyl-terminal hydrolase 1, universal stress protein, and glutathione peroxidase (1.11.1.9) were increased, whereas the relative abundances of NADH-dehydrogenase, proliferating cell nuclear antigen, glutathione S-transferase (2.5.1.18), and aminocyclopropane carboxylate oxidase (1.14.17.4) were decreased (Tables S4-1 and S4-2). Other effects of CsRALF34 overexpression were increases in Rab-protein, enzymes of glycolysis, pentose phosphate pathway, mannose and purine metabolism, valine, leucine, and melatonin biosynthesis (Figure 11).
Figure 10.
Signaling pathway involved in the regulation of the cell cycle and response to abiotic stress was activated in CsRALF34 overexpressors. The up- or downregulated proteins are marked by green and red color, respectively. The pathway mapping relied on the KEGG signal pathway database, Shimotohno et al. [48], Dekomah et al. [49], and Asano et al. [50]. CDKA, cyclin-dependent kinase A (2.7.11.22); CDPK12, calcium-dependent protein kinase 12 (2.7.11.1); PP2C, protein phosphatase 2C (3.1.3.16); PYR-PYL, pyrabactin resistance, pyrabactin resistance-like component of abscisic acid receptor; ROS, reactive oxygen species; KRB, kip-related protein. Narrow arrows indicate individual steps of a pathway, dotted arrows indicate several steps of a pathway, while broad arrows point to the final effect of a pathway.
Figure 11.
Metabolic pathways affected by the overexpression of CsRALF34. The up- or downregulated proteins are marked by green and red, respectively. Pathway mapping relied on the KEGG signal pathway database. AMPK, adenosine monophosphate-activated protein kinase; TBC1D1, TBC1 domain family member 1 (TBC1, tre-2/USP6, BUB2, CDC16); Rab, member of the Ras superfamily of small G proteins (Rab, Ras-related in brain); ATP, adenosine triphosphate; 5.4.2.8, mannose phosphomutase; 6.3.3.1, phosphoribosyl formylglycinamidine cyclo-ligase; 4.3.2.2, adenylosuccinate lyase; 2.7.1.11, 6-phosphofructokinase; 2.7.1.90, diphosphate-dependent phosphofructokinase; 2.2.1.1, transketolase; 2.2.1.6, acetolactate synthase; 4.2.3.4, 3-dehydroquinate synthase; 1.1.1.42, isocitrate dehydrogenase; 6.2.1.5, succinyl-CoA synthetase. Narrow arrows indicate one step of the pathway; dotted arrows indicate several steps.
The relative abundances of TCA cycle enzymes were also changed in CsRALF34 overexpressors. The levels of isocitrate dehydrogenase (1.1.1.42) were increased, whereas the relative contents of succinyl-CoA synthetase (6.2.1.5) were decreased (Figure 11). Furthermore, clear decreases in the relative abundances of aquaporin-7 (AQP-7) and oligosaccharyl transferase (OST) could be observed (Table S4-2).
Further cellular processes affected by CsRALF34 overexpression were protein biosynthesis, transport, and exocytosis (Figure 8, Supplementary Information S5). RNA-binding family protein (Y14), ribosome biosynthesis proteins (NOP4, nucleolar protein 4 and NMD3, ribosome export adaptor), small and large ribosome subunit proteins (S10, 12, 24, 25, 29, 32, 38, L14, 15, 18, 19, and 35), mannosyl-oligosaccharide alpha-1,3-glucosidase (GlcII), protein transport protein Sec23/24, betaine-homocysteine S-methyltransferase (1.1.1.5), and 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase (2.1.1.14) were upregulated in roots overexpressing CsRALF34 (Table S4-1). Interestingly, several proteins involved in proteasomal degradation (PDIs, protein disulfide-isomerase A1, TRAP, translocon-associated protein subunit alpha, Hsp70, 70kDa heat shock protein, p97, transitional endoplasmic reticulum ATPase), protein transport into lytic vacuoles (VAMP7, vesicle-associated membrane protein 7) and endocytosis (dynamin, AP-2 complex subunit alpha (AP2), vacuolar protein-sorting-associated protein 4 (VPS4), and vacuolar protein sorting-associated protein (VTA1)) were downregulated in roots overexpressing CsRALF34 compared with control roots (Table S4-2).
3. Discussion
3.1. CsRALF34 Is Not Involved in the Lateral Root Initiation
In this study, an integrated multiomics approach was used to elucidate the role of the small signal peptide CsRALF34 in the development of cucumber root systems. The study was carried out on transgenic hairy roots of cucumber overexpressing CsRALF34 compared with transgenic hairy roots expressing p35S::gusA. In the roots overexpressing CsRALF34, as confirmed by RT-qPCR, the lateral root initiation index (ILRI) remained unchanged compared with transgenic control roots, indicating that the number of initiated lateral root primordia was not affected (Figure 1).
In contrast, the number of lateral root primordia was reduced in Arabidopsis ralf34 loss-of-function mutants [14]. Another effect on root development by AtRALF34 was a change in the root growth rate. A stunted root growth rate was described for plants treated with the synthetic AtRALF34 peptide compared with the control group [15]. Consistent with this result, Atralf34 mutant roots were characterized by an increase in growth rate compared with the roots of wild-type plants [51]. Individual developing hairy roots always differ from each other in age and growth rate; therefore, the effects of CsRALF34 overexpression on the growth rate of hairy roots cannot be determined. Therefore, wild-type cucumber seedlings’ roots were treated with synthetic CsRALF34 to determine its effect on root growth. This effect was similar to that described for Arabidopsis [15]: treatment led to a statistically significant decrease in the root length increment (Figure 2). At the same time, the number of initiated lateral root primordia calculated using ILRI was unchanged in cucumber roots treated with the synthetic CsRALF34 peptide (Figure 2), as well as in transgenic roots overexpressing CsRALF34 (Figure 1).
It has also been proposed that AtRALF34 might indirectly regulate the expression of AtGATA23 [14], the key marker gene of the early steps of lateral root initiation [22]. We previously proposed CsGATA14 and CsGATA24 to represent the putative cucumber orthologs of AtGATA23 [46]. Here, we show that neither CsGATA14 nor CsGATA24 expression levels were changed in response to CsRALF34 overexpression (Figure 4).
Next, we tested the hypothesis that the expression of CsRALF34 may be involved in gene regulatory networks participating in the early steps of lateral root initiation. It is known that expression of the transcription factor E2Fa in Arabidopsis, a member of the E2F/DP family [52], is regulated by auxin-dependent activation of the transcription factors LBD18/LBD33 [53]. This is a common mechanism of the auxin-dependent activation of the mitotic cycle occurring in the xylem pole of the pericycle before the first asymmetric division during lateral root initiation. Phylogenetic analysis of Arabidopsis and cucumber E2F/DP (CsE2F/DP) proteins was carried out, leading to the identification of cucumber orthologs of Arabidopsis E2F/DP genes (Figure 3). Expression levels of all CsE2F/DP genes were not changed in response to CsRALF34 overexpression (Figure 4).
Taken together, the data obtained using ILRI calculations for transgenic hairy roots overexpressing CsRALF34, as well as for CsRALF34-treated roots, and the evaluation of CsE2F/DP, CsGATA14, and CsGATA24 expression suggest that CsRALF34 does not represent a key player in lateral root initiation occurring in the root apical meristem of the cucumber parental root. However, although CsRALF34 overexpression does not affect lateral root initiation (i.e., it does not change the number of initiated lateral roots), an effect on the root growth rate cannot be excluded at this point.
The absence of any visible phenotype in roots overexpressing CsRALF34 prompted us to perform a comprehensive analysis of changes in the proteome and metabolome in response to CsRALF34 overexpression. Protein isolation followed by tryptic digestion was performed. The variability in protein yields (0.234–0.463 mg/g fresh weight, Table S1-6) was relatively low, in agreement with the low amounts of protein in roots compared with other parts of the plant [54,55]. Importantly, the precise estimation of protein extraction recoveries (RSD = 5.8%) were in line with our prior results [56]. Therefore, the observed lower variability in protein yields and precise estimation of the protein concentrations in the extracts enabled the reliable implementation of label-free quantification in the analysis of heterogeneous root proteomes [47].
PCA applied to the whole proteome (Figure 7) exhibited low intra-group variance and a high degree of inter-group variance (more than 93%). These results indicated a high likelihood that the observed differences were predominantly associated with the effects of CsRALF34 overexpression.
3.2. The Functions of CsRALF34
3.2.1. Activation of Protein Biosynthesis
Our experiments clearly demonstrated that the overexpression of CsRALF34 resulted in a pronounced upregulation of proteins involved in protein biosynthesis and transport (Figure 12). Upregulation of proteins constituting the small and large ribosomal subunits, RNA-binding family protein, nucleolar protein 4, ribosome export adaptor, protein transporter Sec23/24, and others were observed (Figure 12, Table S4-1).
Figure 12.
The pathways of protein synthesis and transport activated by CsRALF34 overexpression (based on the KEGG signal pathway database). Green, upregulated; red, downregulated proteins. PP2A, serine/threonine-protein phosphatase 2A; S10, 12, 24, 25, 29, 32, and 38, proteins of the small ribosomal subunit; L14, 15, 18, 19, and 35, proteins of the large ribosomal subunit; GlcII, mannosyl-oligosaccharide alpha-1,3-glucosidase; TRAP, translocon-associated protein subunit alpha; Hsp70, heat shock 70 kDa protein; p97, transitional endoplasmic reticulum ATPase; VAMP7, vesicle-associated membrane protein 7; Sec23/24, protein transporter from ER to Golgi.
3.2.2. Inhibition of Root Growth and Regulation of Cell Proliferation
To date, in several studied plant species (e.g., Medicago truncatula and Solanum lycopersicum), the main role of the RALF34 peptide was reported to be the control of the alkalization of the environment for growth inhibition by suppressing the functions of H+-ATPase [11,16,57]. This should also prevent cell elongation. However, in other studies, this effect was discussed as a result of the molecular signaling cascade activated by RALF34. Pearce, Moura, Stratmann, and Ryan [11] showed that the expression of RALF34 was associated with a decrease in the activity of the mitogen-activated protein kinase (MAPK), which was associated with the inhibition of lateral root growth. The data presented here revealed that the overexpression of CsRALF34 in cucumber roots resulted in a decrease in CDKA levels, which, in turn, could lead to a G2/mitosis transition block [48].
Furthermore, we observed downregulation of the proliferating cell nuclear antigen (PCNA; Csa6g188070.1, Table S4-1), which is known to be involved in DNA replication and serves as an interaction partner of DNA polymerases [58,59]. Combined with the decrease in the levels of helicases, these data support the assumption that CsRALF34 overexpression results in blockage of G2/mitosis transition in cucumber root cells (Figure 10).
3.2.3. Impact of CsRALF34 on ROS Signaling and Stress Adaptation
The exact mechanisms behind the contribution of RALF peptides to stress response and adaptation are still unknown. However, Stegmann et al. [60] showed that several AtRALFs are involved in the regulation of intracellular ROS levels. The authors reported that AtRALF23 mediated an increase in ROS production, whereas AtRALF17, in contrast, caused a decrease in ROS levels. Our results generally support the role of RALF peptides as ROS regulators, suggesting that CsRALF34 modulates ROS homeostasis. At least CsRALF34 caused alterations in the function of the respiratory chain combined with activation of the antioxidant defense systems.
We observed decreases in the relative abundances of NADH-dehydrogenase, complex I of the respiratory chain, and succinyl-CoA synthetase, the enzyme that converts succinyl-CoA to succinate (Supplementary Information S4, Table S4-2). Succinate deficiency is known to suppress the activity of succinate dehydrogenase, which is an enzyme of the TCA cycle and simultaneously represents complex II of the mitochondrial respiratory chain. The loss of its activity leads to a deficit of electrons in the respiratory chain. Moreover, as NADH-dehydrogenase reduces ubiquinone, which, in its reduced form, is the substrate of cytochrome c reductase, the activity of complex III could also be negatively affected by CsRALF34. Thus, given that complexes I and III are the main generators of the superoxide anion radical [61,62], this decrease in the electron flow through the entire respiratory chain might lead to a decrease in the rate of superoxide generation.
As shown here, the levels of H2O2 were significantly lower in roots overexpressing CsRALF34 compared with control roots (Figure 5A). This can be explained by the inhibition of electron transfer along the respiratory chain described above because superoxide anions are converted to H2O2 by superoxide dismutase. On the other hand, the increased levels of thioredoxin 1, heat shock proteins Hsp90 and Hsp72, ubiquitin carboxyl-terminal hydrolase 1, and universal stress protein indicate that the cellular antioxidant defense was upregulated.
Equally importantly, glutathione peroxidase levels were also upregulated in response to CsRALF34 overexpression (Table S4-1). This enzyme is directly involved in antioxidant defense, specifically in the reduction of lipid hydroperoxides to the corresponding alcohols and in the reduction of hydrogen peroxide to water [63]. Thus, it can be concluded that CsRALF34 is critically involved in the suppression of H2O2 production and the activation of multiple cellular antioxidant systems. It can be assumed that CsRALF34 mediated these effects via signaling cascades.
Due to their upregulation upon CsRALF34 overexpression, we could identify protein phosphatase 2C (PP2C) and calcium-dependent protein kinase 12 (CDPK12) as the components of the signaling pathways involved in the RALF34-dependent responses. PP2C is involved in abscisic acid (ABA) signal transduction. Binding of ABA to its receptors, the pyrabactin resistance/pyrabactin resistance-like/regulatory components of the abscisic acid receptor (PYR/PYL/RCAR), leads the receptors to bind to PP2C, which, in turn, leads to its inhibition and the activation of the SNF1-related protein kinase 2 (SnRK2). In the absence of ABA, SnRK2 proteins are inhibited by PP2C-dependent dephosphorylation (Hsu et al., 2021). Briefly, PP2C plays an important role in ABA signaling [64]. Importantly, CDPK12 is known to contribute to regulating the expression of antioxidant defense genes; therefore, its activity might affect plant adaptations to stress [50]. Thus, the RALF34-induced upregulation of PP2C could affect ABA signaling and, thereby, plant adaptation to osmotic stress. In this context, it is possible that the upregulation of the cellular antioxidant pathways, the decrease in ROS production, and other metabolic shifts (Figure 10 and Figure 11) could be mediated by increases in PP2C expression levels.
The involvement of ROS in this process was supported by the analysis of the tissue oxidative status in control and CsRALF34 overexpressing roots (Figure 5 and Figure S1-2). Consistent with the upregulation of the ROS-detoxifying enzymes, a clear decrease in H2O2 content was observed in CsRALF34 overexpressing roots. On the other hand, levels of thiobarbituric acid-reactive substances were increased in CsRALF34 overexpressors compared with wild-type roots, indicating a complex effect of RALF34 on different aspects of antioxidant defense.
This conclusion is in agreement with the work of Song et al. [65], who showed that a mutation in FERONIA (FER), the RALF receptor gene in Arabidopsis, was associated with lower levels of ROS formation. Thus, it appears to be likely that RALF might directly affect ROS production. Moreover, because CDPK is activated by interaction with Ca2+ ions [66], upregulation of the production of this kinase might result in increased sensitivity of the root to intracellular calcium levels. Upon treatment with nanomolar concentrations of natural or synthetic RALF peptides, the increasing levels of cytoplasmic Ca2+ reached their maximum within 40 s [67]. This permits us to speculate that different RALF peptides can act in a concerted way; some RALF peptides might bind to the RALF receptor and initiate the release of Ca2+, whereas the others could increase the levels of sensitivity to ABA. Finally, it is important to mention that Ca2+ levels might fluctuate strongly even over short periods of time. Interference of these dynamically altering calcium levels with RALF-mediated responses might underlie a plethora of RALF effects.
3.2.4. RALF-Related Dynamics of Cellular Metabolism
Based on the results of our study, CsRALF34 appeared to affect the energy metabolism of the root cell. As mentioned above, the overexpression of CsRALF34 was accompanied by the downregulation of NADH-dehydrogenase and succinyl-CoA synthetase. It appears likely that a compensatory mechanism of ATP generation was in effect, related to the upregulation of the TCA cycle, glycolysis, pentose phosphate pathway, and purine biosynthesis de novo (Figure 11); the effect of CsRALF34 treatment on the root growth increment was not dramatic.
Altogether, the analysis of the primary and secondary metabolome showed that the primary metabolome was much more affected by CsRALF34 overexpression (Table 1). The levels of D-mannose and cGMP were decreased, whereas the levels of glucose-1-phosphate, 6-phosphogluconic acid, ornithine, and adenosine were upregulated (Table 1). These results are consistent with the proteome analysis data with regard to enzymes involved in sugar metabolism.
3.2.5. RALF34 as a Modulator of Phytohormone Responses
Currently, the effect of RALF peptides on hormonal regulation is discussed in the literature [12]. In the most comprehensive way, this aspect was addressed in the studies of fer mutants, i.e., the plants defect at the gene of receptor-like kinase FER, which is one of the RALF receptors [28]. As was shown recently, this receptor is involved in the modulation of jasmonic acid, ethylene, ABA, and brassinosteroid dynamics in plants [28].
The results of this study (Section 2.10, Figure 10) clearly indicate an upregulation of PPC2, which can be expected to lead to a downregulation of SnRK2. This, in turn, would affect responses to ABA, ethylene, jasmonic acid, and to abiotic stress in general (Figure 10). This is consistent with the observation that a fer loss-of-function mutant demonstrated hypersensitivity to both ABA and abiotic stresses associated with exposure to high salt concentrations and low temperatures [68]. The results of this study support the assumption that RALF34 is involved in the response to abiotic stress.
In addition to the effects related to the ABA signaling pathway, the overexpression of CsRALF34 was associated with a downregulation of aminocyclopropane carboxylate oxidase, which is responsible for the final step of ethylene biosynthesis [69]. This fact might suggest a decrease in the ethylene levels in the roots overexpressing CsRALF34. Notably, Mao et al. [70] showed that Arabidopsis fer mutants displayed higher levels of ethylene in plant tissues combined with a dwarf phenotype. Therefore, the authors assumed that the FER receptor kinase interacts with S-adenosylmethionine synthases and downregulates ethylene biosynthesis in response to environmental stress, as well as the external application of auxin and brassinosteroids [70]. Remarkably, Deslauriers and Larsen [71] showed that mutation of fer led to a loss of sensitivity to brassinosteroids and resulted in enhancement of the ethylene response. Finally, Bergonci et al. [13] showed that RALF1 can compete with brassinosteroids for components shared by both signal transduction pathways.
In summary, the available data are consistent with our results. It is likely that after binding to its receptor, RALF34 suppresses the expression of aminocyclopropane carboxylate synthase, which then leads to a decrease in ethylene levels.
4. Materials and Methods
4.1. Plant Material and Bacterial Strains
Cucumber (Cucumis sativus L.) cv. Phoenix (Sortsemovosch, Saint Petersburg, Russia) was used in this study.
Escherichia coli strain XL-1 Blue was used for molecular cloning. Rhizobium rhizogenes (Agrobacterium rhizogenes) strain R1000 was used for the genetic transformation of plants.
4.2. Reagents
The full list of the reagents is given in Supplementary Information S1 (Protocol S1-1).
4.3. Phylogeny and Bioinformatics
Sequences of six Arabidopsis E2F proteins [72] and two Arabidopsis DP proteins [73] were downloaded from the Arabidopsis Information Resource (TAIR, www.arabidopsis.org, accessed on 10 March 2023) [74] and used as a query to find amino acid sequences of C. sativus (cucumber, cv. Chinese Long v2) [75] in the Cucurbit Genomics Database v1 (CuGenDB v1, cucurbitgenomics.org, accessed on 10 March 2023) [76]. All alignments were performed using online Clustal Omega software (www.ebi.ac.uk/Tools/msa/clustalo/, accessed on 10 March 2023) [77] at default settings. The alignment file was transferred into MEGA7.0 software [78], followed by phylogenetic tree construction using the Maximum Likelihood method [79]. The Jones–Taylor–Thornton model [80] with evolutionary rate differences among sites (+G parameter) (Yang, 1994) was used for phylogeny reconstruction of the E2F/DP family in cucumber. Phylogeny was tested using the bootstrap method with 1000 replicates.
4.4. RT-qPCR Assays
Total RNA was extracted from frozen plant material using ExtractRNA reagent (Evrogen, Moscow, Russia). RNA quantity and integrity were measured using a Qubit 4.0 fluorimeter (Thermo Fisher Scientific, Waltham, MA, USA) using Qubit RNA BR Assay and IQ Assay Kits. Reverse transcription was performed as described previously [46]. For each qPCR assay, 1 μL of cDNA (80–120 ng) from a non-diluted sample (total volume 20 μL) was used.
The RT-qPCR analysis was performed using a Quant Studio 5 Real-Time PCR system (Thermo Fisher Scientific) in a total volume of 20 μL. qPCR and PCR conditions were described previously [46]. Primers used for qPCR (Table S1-1) were designed using Vector NTI Advance v 11.0 software (Thermo Fisher Scientific). Purified PCR primers were purchased from Evrogen (Moscow, Russia). Quantification cycles (Cq) were determined using Quant Studio Design and Analysis software v. 1.5.1 (Thermo Fisher Scientific). Relative transcript levels were calculated as described previously [46]. Elongation factor EF1α was chosen as a reference gene according to data on the stability of reference gene expression in cucumbers presented in the literature [81].
RT-qPCR analysis of CsRALF34 relative expression levels in the first replicate of the overexpression experiment was performed five times independently from the control group (GUS control, mixed root sample) and for each individual transgenic root (RALF34-OE, n = 9). The second replicate of the CsRALF34 overexpression experiment was conducted to analyze the transcript levels of CsRALF34 as well as the CsGATA14, CsGATA24, and CsE2F/DP genes in response to CsRALF34 overexpression. RT-qPCR analysis of the second replicate was performed four times independently.
4.5. Lateral Root Initiation Index (ILRI) Estimation
The Lateral Root Initiation Index (ILRI) [82] was estimated for two groups of roots: individual transgenic roots overexpressing CsRALF34 (n = 8) and GUS control roots (n = 8), as well as for wild-type roots treated with synthetic CsRALF34 peptide (n = 10) and for corresponding wild-type control roots (n = 14). The ILRI was calculated on longitudinal root sections as described previously [83]. The most proximal lateral root primordia were detected in the region located 2–5 mm from the root tip above the division zone of the cortex [84].
4.6. Treatments with Synthetic CsRALF34 Peptide
A synthetic CsRALF34 peptide (FWRRVHYYISYGALSANRIPCPPRSGRPYYTHNCYKARGPVNPYTRGCSAITRCRR; >87% purity) was synthesized by ProteoGenix (Schiltigheim, France), and its structure was validated independently by mass spectrometry. Lyophilized peptide was diluted in a mixture of acetonitrile and double distilled water (1:3). Five-day-old wild-type cucumber seedlings with 5–7 cm long roots were incubated in aerated Hoagland’s medium [85] supplemented with 2 μM CsRALF34 [15,86,87] or with the same volume of the solvent (control) for 48 h. Each experiment included 50 seedlings (both in the control and in the group with CsRALF34 treatment) and was repeated twice independently. For each seedling, the root length was measured before and after peptide treatment.
4.7. Molecular Cloning and Vector Design
Two genetic constructs were developed for overexpression assays using multisite Gateway technology (Gateway LR Clonase II plus, Thermo Fisher Scientific): for CsRALF34 overexpression using the 35SCaMV promoter and a control vector for gusA (β-glucuronidase A) overexpression under the control of the same promoter. The pKGW-RR-MGW binary vector, carrying the pAtUBQ10::DsRED1 [88] screening cassette in the backbone, was used as the destination vector (kindly provided by Erik Limpens, Wageningen University, Wageningen, The Netherlands). LR plus clonase reactions were prepared according to the manufacturer’s instructions. The sequences of the cassettes of all constructs were verified by the PCR amplification of fragments and sequencing of the products. All primer sequences and their combinations are listed in Tables S1-2 and S1-3.
The p35S-pENTRattL4attR1 entry vector (Wageningen University, The Netherlands) was used as a donor of the 35SCaMV promoter. Two entry vectors were developed harboring CsRALF34 or gusA (β-glucuronidase A) coding sequences, respectively. CsRALF34 was PCR amplified using cucumber genomic DNA as a template, cloned into the pJET1.2 vector (Thermo Fisher Scientific), and verified by sequencing. Then, CsRALF34 and gusA coding sequences were amplified using CsRALF34-pJET1.2 and NLS-Egfp-gusA–pUC18-entry8 as templates [83], respectively, and KpnI-NotI cloned into the pUC18-entry8 vector [89]. pENTRattR2attL3-TermAct [46] was used as a donor of the Arabidopsis thaliana Actin2 gene terminator. The resulting constructs were pKGW-RR-MGW-p35S::CsRALF34 for CsRALF34 overexpression assays and pKGW-RR-MGW-p35S::gusA as controls (Figure S1-1). The binary vectors were introduced in agrobacterial cells by electroporation [90].
4.8. Plant Transformation and Handling for CsRALF34 Overexpression Assays
Agrobacterium rhizogenes (Rhizobium rhizogenes)-mediated transformation of cucumber seedlings was carried out as described previously [46,90] with minor modifications. The experiment was performed in two replicates. At least 25 composite plants with roots overexpressing CsRALF34 (p35S::CsRALF34) and GUS control plants (p35S::gusA) were obtained in each transformation. Transformants were cultured in vermiculite moistened with 4x Hoagland’s medium. Transgenic roots 6–10 cm in length were harvested from both groups four times at 7-day intervals and flash-frozen in liquid nitrogen. The total number of roots was as follows: 220 for GUS control plants and 246 for CsRALF34 overexpressors.
4.9. Determination of Hydrogen Peroxide Contents
Analysis of H2O2 contents in cucumber roots relied on the method described by Chantseva et al. [91], with modifications explained in Supplementary Information S1 (Protocol S1-2). The absorbance was measured at 575 nm (length of the optical path: 1 cm), and calculations were performed as described previously [91].
4.10. Determination of Lipid Peroxidation Product Contents
Lipid peroxidation products were quantified as malondialdehyde equivalents according to the protocol described by Soboleva et al. [92], with modifications presented in Supplementary Information S1 (Protocol S1-3).
4.11. Determination of Lipid Hydroperoxide Contents
Analysis of lipid hydroperoxide contents relied on the method of Frolov et al. [56], with modifications described in Supplementary Information S1 (Protocol S1-4).
4.12. Determination of Ascorbic Acid Contents
The determination of ascorbate contents and the respective statistical calculations were performed as described by Shumilina et al. [54] with modifications presented in Supplementary Information S1 (Protocol S1-5).
4.13. Analysis of Primary Metabolites
The primary metabolomics study relied on two techniques: thermally stable metabolites were analyzed by gas chromatography-electron ionization-quadrupole-mass spectrometry (GC-EI-Q-MS), whereas the temperature-labile metabolites were analyzed by reversed-phase-ion-pair-ultrahigh-performance liquid chromatography-electrospray ionization-triple quadrupole tandem mass spectrometry (RP-IP-UHPLC-ESI-QqQ-MS/MS) (Table S1-9, Protocol S1-6). The analysis of temperature-labile anionic primary metabolites was described by Leonova et al. [93].
4.14. Analysis of Semi-Polar Secondary Metabolites
The semi-polar secondary metabolites were analyzed using chromatography and mass spectrometry (RP-HPLC-ESI-QqTOF-MS) settings specified in Supplementary Information S1 (Table S1-10, Protocol S1-7).
4.15. Processing of the Acquired Metabolomics Data
Data pre-processing and processing relied on the Automated Mass Spectral Deconvolution and Identification System v.2.66 (www.amdis.net, accessed on 10 March 2023), Xcalibur v.2.0.7 and LCquan v.2.5.6 (Thermo Fisher Scientific), MSDial v.3.12 (prime.psc.riken.jp/Metabolomics_Software/MS-DIAL/, accessed on 10 March 2023). For interpretation of the LC-MS data LabSolution (Shimadzu, Kyoto, Japan) and MSDial (prime.psc.riken.jp/compms/msdial/, accessed on 10 March 2023) were used. Metabolite identification relied on a broad panel of available spectral libraries: National Institute of Standards and Technology (NIST), Golm Metabolome Database (GMD), Human Metabolome Database (HMDB), MS/MS and electron ionization (EI)-MS spectra curated by RIKEN Center for Sustainable Resource Science (prime.psc.riken.jp/Metabolomics Software/MS-DIAL/, accessed on 10 March 2023), and an in-house library (partially with Kovats retention time indices, calculated by the retention times of alkane standards). The post-processing and statistical interpretation of the acquired data relied on MetaboAnalyst 5.0 (www.metaboanalyst.ca, accessed on 10 March 2023) [94].
4.16. Protein Isolation and Determination
For protein extraction, approximately 250 mg of milled frozen root material was used, as described previously [95], with some modifications (Supplementary Information S1 (Protocol S1-6)). The precision of the assay was cross-verified by SDS-PAGE, according to Greifenhagen et al. [96], with some modifications. Briefly, after the gels were stained with 0.1% Coomassie Brilliant Blue G-250 for 12 h, the average densities across individual lanes (expressed in arbitrary units) were determined using a ChemiDoc XRS imaging system controlled by Quantity One 1-D analysis software (Bio-Rad Laboratories, Hercules, CA, USA). To calculate the relative standard deviations (RSDs), the densities of individual lines were normalized to the gel average value by ImageJ software [97].
4.17. Tryptic Digestion and Sample Pre-Cleaning
The day before the digestion procedure, Amicon Ultra 30K filter units (Sigma-Aldrich, Saint-Louis, MO, USA) were passivated in 500 µL 5% Tween-20 by shaking (350 rpm, 25 °C, 12 h). The next day, the filter units were washed twice with Milli-Q water while shaking (450 rpm, 30 min, 25 °C). Subsequently, 35 µg of protein was transferred to filter units, and 200 µL of urea solution (8 M urea, 50 mM Tris-HCl buffer, pH 7.5, UA) was added. Then the tubes with filters were centrifuged (14,000× g, 10 min, 4 °C), and the supernatants were discarded. All these steps with UA were repeated three times. Furthermore, 100 µL of reducing solution (100 mmol/L dithiothreitol in UA) was added, and incubated under continuous shaking (450 rpm, 25 °C, 1 h). Then, the mixtures were centrifuged (14,000× g, 10 min, 25 °C), and the supernatants were discarded. The same centrifugation and discarding steps were performed after the subsequent addition of 100 µL of alkylation solution (50 mmol/L iodoacetamide in UA); the incubation under continuous shaking (450 rpm, 25 °C, 1 h) was performed in the dark. The next step was washing filters with 200 µL of UA twice (centrifugation at 14,000× g, 10 min, 4 °C and discarding of supernatant after each step). Then, the same procedures were carried out with the digestion buffer (50 mmol/L ammonium bicarbonate, ABC) twice. The stock solution of trypsin (0.5 µg/µL) was freshly prepared, added to the solutions on the filters, and then incubated under continuous shaking (450 rpm, 37 °C, 4 h). The incubations were further continued after the addition of trypsin stock solution (enzyme-to protein-ratio w/w 1:50) under continuous shaking (450 rpm, 37 °C) overnight. The samples were centrifuged (14,000× g, 10 min, 25 °C), and the filtrates containing the mixtures of proteolytic peptides were supplemented with 40 µL of ABC buffer and centrifuged again (14,000× g, 10 min, 25 °C). This step was repeated twice; then, proteolytic hydrolysates were frozen at –20 °C. The completeness of the digestion was verified by SDS-PAGE [96].
4.18. Solid Phase Extraction
The proteolytic hydrolysates were pre-cleaned by reverse-phase solid-phase extraction (RP-SPE) using the elution scheme of Spiller et al. [98], with minor modifications specified in Supplementary Information S1 (Protocol S1-7).
4.19. Nano LC-MS/MS
The protein hydrolysates were loaded on an Acclaim PepMap 5 mm Trap Cartridge (Thermo Fisher Scientific) and separated on a Bruker FORTY separation column (C18 ReproSil AQ, 40 cm × 75 µm, 1.9 µm, 120 A; Bruker Daltonics, Bremen, Germany) using a nanoElute UHPLC chromatography system (Bruker Daltonics) coupled on-line to a TimsToF Pro quadrupole time-of-flight mass spectrometer (QqTOF-MS) via a CaptiveSpray ion source (Bruker Daltonics). The details of the chromatographic separation method are summarized in Supplementary Information S1 (Table S1-11). The UHPLC-QqTOF-MS/MS analysis relied on data-dependent acquisition experiments performed in the positive ion mode, comprising a survey TOF-MS scans and dependent MS/MS scans for the most abundant signals in the following 3 s (at certain tR) with charge states ranging from 2 to 5. The mass spectrometer settings are summarized in Table S1-12.
4.20. Data Post-Processing and Analysis
The acquired raw LC-MS data were processed with PEAKS Studio software (v. 10.6, Bruker Daltonics) (for the search settings, see Table S1-13). Thereby, the identification of peptides and annotation of proteins relied on a search against amino acid sequences of Cucumis sativus cv. Chinese Long v2 [75] (Cucurbit Genomics Database v1) accomplished with the SEQUEST algorithm [99,100]. Proteomics data were post-processed in RStudio (posit.co, accessed on 10 March 2023), which is an R programming language environment [101]. Quantitative protein analysis was accomplished on log2-transformed normalized data using the limma package with the minimal abundance alteration cut-off of 1.5 logarithmic fold change [102]. Additionally, Mercator4 (v. 2.0, plabipd.de/portal/mercator4, accessed on 10 March 2023) was used for protein annotations [103,104]. The subcellular localization of proteins was defined using WoLF PSORT [105]. Enrichment analysis was carried out using KOBAS-i [106].
4.21. Statistical Analysis
All boxplots were prepared using R programming language [101] and RStudio software (posit.co, accessed on 10 March 2023). The default code for the boxplot and stripchart functions from the base R package were used. Statistical analyses of qPCR, CsRALF34 treatment, and ILRI data were performed using Wilcoxon’s signed-rank test from the base R package. For stress response markers (e.g., H2O2, TBARS, 13(RS)-HPOD, Asc), the Student’s t-test for independent samples combined with a normality test was applied. t-tests with Benjamini–Hochberg false discovery rate correction were also performed for the identification of metabolites and proteins up- or downregulated during CsRALF34 overexpression. In all statistical tests, differences with p-values < 0.05, <0.01, or <0.001 were considered statistically significant.
5. Conclusions
The results of our study on the function of the cucumber ortholog of Arabidopsis RALF34 showed that in contrast to Arabidopsis, CsRALF34 did not affect lateral root initiation at all but did affect root growth. At the proteome level, the overexpression of CsRALF34 led to increased levels of protein phosphatase 2C (PP2C) and calcium-dependent protein kinase 12 (CDPK12), i.e., regulators involved in phytohormone signaling, developmental processes, and the response to several stress factors. These effects should lead to the suppression of CDKA activity and, thus, to a block of G2/mitosis transition. Reduced levels of proliferating cell nuclear antigen and helicases are consistent with reduced mitotic activity in the basal part of the root meristem apical and might also explain the reduction in root growth. Reduced levels of NADH-dehydrogenase and succinyl CoA synthetase suggested suppression of the mitochondrial electron transport, which would be consistent with the reduced ROS levels in CsRALF34 overexpressors. However, it is difficult to determine which one has the primary effect.
Altogether, these results show that a better understanding of RALF34-receptor interactions in non-model plants should be key to understanding the physiological role of these small signaling peptides.
Acknowledgments
This study was performed using equipment of the Core Facility Center of Cell and Molecular Technologies in Plant Science at the Komarov Botanical Institute (Saint Petersburg, Russia) and the Core Facility Center of Genomic Technologies, Proteomics, and Cell Biology at the Research Institute for Agricultural Microbiology (Saint Petersburg, Pushkin, Russia). We greatly acknowledge the support of the Research Park of St. Petersburg State University (St. Petersburg, Russia) for providing the equipment: the UHPLC-QqTOF-MS/MS measurements were performed in the Centre for Molecular and Cell Technologies, whereas the GC-MS and the UHPLC-MS/MS measurements were performed at the Center for Chemical Analysis and Materials Research, with support provided in the agreement with Timiryazev Institute of Plant Physiology, Russian Academy of Sciences (theme no. 12204270043-9).
Abbreviations
GC-EI-Q-MS, gas chromatography-quadrupole mass spectrometry with EI ionization; MS/MS, tandem mass spectrometry; PCA, principal component analysis; RSD, relative standard deviation; TCA cycle, tricarboxylic acid cycle; ROS, reactive oxygen species; RT-qPCR, reverse transcription-quantitative polymerase chain reaction.
Supplementary Materials
The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/ijms24087654/s1.
Author Contributions
K.N.D. and A.S.K. planned and designed the research. A.S.K., J.S. and E.L.I. performed most experiments and analyzed the data. A.S.K. performed the microscopy, phylogeny, and bioinformatics. J.S. performed the proteomics experiments, and interpretation of proteomics data in the context of metabolism and regulation and contributed to writing the first draft. E.L.I. carried out the design of all vectors. N.F. performed the processing, post-processing, and interpretation of metabolomics data and contributed to writing the first draft. V.M. performed sample preparation for the proteomics analysis. K.D. performed the processing and post-processing of proteomics data. S.S. and A.O. performed sample preparation for metabolomics. E.B.S., E.R. and A.S. performed UHPLC-QqTOF-MS/MS method optimization and measurements. T.B. performed the biochemical tests. A.F. supervised the biochemical tests, proteomics, and metabolomics experiments and contributed to the writing of the first draft. K.N.D. acquired the funding. K.P. contributed to critical reading and discussion. K.N.D., J.S., A.S.K. and K.P. conceptualized the study and prepared the final version of the manuscript. All authors contributed to the final version. All authors have read and agreed to the published version of the manuscript.
Institutional Review Board Statement
Not applicable.
Informed Consent Statement
Not applicable.
Data Availability Statement
All relevant data are available within the paper and its Supplementary Materials files.
Conflicts of Interest
The authors declare no conflict of interest.
Funding Statement
This research was financially supported by the Russian Science Foundation, grant number 20-16-00115.
Footnotes
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
References
- 1.Fletcher J.C., Brand U., Running M.P., Simon R., Meyerowitz E.M. Signaling of cell fate decisions by CLAVATA3 in Arabidopsis shoot meristems. Science. 1999;283:1911–1914. doi: 10.1126/science.283.5409.1911. [DOI] [PubMed] [Google Scholar]
- 2.Matsubayashi Y., Sakagami Y. Phytosulfokine, sulfated peptides that induce the proliferation of single mesophyll cells of Asparagus officinalis L. Proc. Natl. Acad. Sci. USA. 1996;93:7623–7627. doi: 10.1073/pnas.93.15.7623. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Pearce G., Strydom D., Johnson S., Ryan C.A. A polypeptide from tomato leaves induces wound-inducible proteinase inhibitor proteins. Science. 1991;253:895–897. doi: 10.1126/science.253.5022.895. [DOI] [PubMed] [Google Scholar]
- 4.Schopfer C.R., Nasrallah M.E., Nasrallah J.B. The male determinant of self-incompatibility in Brassica. Science. 1999;286:1697–1700. doi: 10.1126/science.286.5445.1697. [DOI] [PubMed] [Google Scholar]
- 5.Araya T., Miyamoto M., Wibowo J., Suzuki A., Kojima S., Tsuchiya Y.N., Sawa S., Fukuda H., von Wirén N., Takahashi H. CLE-CLAVATA1 peptide-receptor signaling module regulates the expansion of plant root systems in a nitrogen-dependent manner. Proc. Natl. Acad. Sci. USA. 2014;111:2029–2034. doi: 10.1073/pnas.1319953111. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Chilley P.M., Casson S.A., Tarkowski P., Hawkins N., Wang K.L., Hussey P.J., Beale M., Ecker J.R., Sandberg G.K., Lindsey K. The POLARIS peptide of Arabidopsis regulates auxin transport and root growth via effects on ethylene signaling. Plant Cell. 2006;18:3058–3072. doi: 10.1105/tpc.106.040790. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7.Delay C., Imin N., Djordjevic M.A. CEP genes regulate root and shoot development in response to environmental cues and are specific to seed plants. J. Exp. Bot. 2013;64:5383–5394. doi: 10.1093/jxb/ert332. [DOI] [PubMed] [Google Scholar]
- 8.Kumpf R.P., Shi C.L., Larrieu A., Sto I.M., Butenko M.A., Peret B., Riiser E.S., Bennett M.J., Aalen R.B. Floral organ abscission peptide IDA and its HAE/HSL2 receptors control cell separation during lateral root emergence. Proc. Natl. Acad. Sci. USA. 2013;110:5235–5240. doi: 10.1073/pnas.1210835110. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Yamaguchi Y.L., Ishida T., Sawa S. CLE peptides and their signaling pathways in plant development. J. Exp. Bot. 2016;67:4813–4826. doi: 10.1093/jxb/erw208. [DOI] [PubMed] [Google Scholar]
- 10.Jourquin J., Fukaki H., Beeckman T. Peptide-receptor signaling controls lateral root development. Plant Physiol. 2020;182:1645–1656. doi: 10.1104/pp.19.01317. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Pearce G., Moura D.S., Stratmann J., Ryan C.A. RALF, a 5-kDa ubiquitous polypeptide in plants, arrests root growth and development. Proc. Natl. Acad. Sci. USA. 2001;98:12843–12847. doi: 10.1073/pnas.201416998. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Blackburn M.R., Haruta M., Moura D.S. Twenty years of progress in physiological and biochemical investigation of RALF peptides. Plant Physiol. 2020;182:1657–1666. doi: 10.1104/pp.19.01310. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 13.Bergonci T., Ribeiro B., Ceciliato P.H.O., Guerrero-Abad J.C., Silva-Filho M.C., Moura D.S. Arabidopsis thaliana RALF1 opposes brassinosteroid effects on root cell elongation and lateral root formation. J. Exp. Bot. 2014;65:2219–2230. doi: 10.1093/jxb/eru099. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14.Murphy E., Vu L.D., Van den Broeck L., Lin Z., Ramakrishna P., van de Cotte B., Gaudinier A., Goh T., Slane D., Beeckman T., et al. RALFL34 regulates formative cell divisions in Arabidopsis pericycle during lateral root initiation. J. Exp. Bot. 2016;67:4863–4875. doi: 10.1093/jxb/erw281. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Abarca A., Franck C.M., Zipfel C. Family-wide evaluation of RAPID ALKALINIZATION FACTOR peptides. Plant Physiol. 2021;187:996–1010. doi: 10.1093/plphys/kiab308. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16.Combier J.-P., Küster H., Journet E.-P., Hohnjec N., Gamas P., Niebel A. Evidence for the involvement in nodulation of the two small putative regulatory peptide-encoding genes MtRALFL1 and MtDVL1. Mol. Plant-Microbe Interact. 2008;21:1118–1127. doi: 10.1094/MPMI-21-8-1118. [DOI] [PubMed] [Google Scholar]
- 17.Ge Z., Bergonci T., Zhao Y., Zou Y., Du S., Liu M.-C., Luo X., Ruan H., García-Valencia L.E., Zhong S., et al. Arabidopsis pollen tube integrity and sperm release are regulated by RALF-mediated signaling. Science. 2017;358:1596–1600. doi: 10.1126/science.aao3642. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Zhong S., Li L., Wang Z., Ge Z., Li Q., Bleckmann A., Wang J., Song Z., Shi Y., Liu T., et al. RALF peptide signaling controls the polytubey block in Arabidopsis. Science. 2022;375:290–296. doi: 10.1126/science.abl4683. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Germain H., Chevalier É., Caron S., Matton D.P. Characterization of five RALF-like genes from Solanum chacoense provides support for a developmental role in plants. Planta. 2005;220:447–454. doi: 10.1007/s00425-004-1352-0. [DOI] [PubMed] [Google Scholar]
- 20.Negrini F., O’Grady K., Hyvӧnen M., Folta K., Baraldi E. Genomic structure and transcript analysis of the Rapid Alkalinization Factor (RALF) gene family during host-pathogen crosstalk in Fragaria vesca and Fragaria x ananassa strawberry. PLoS ONE. 2020;15:e0226448. doi: 10.1371/journal.pone.0226448. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Zhang X., Peng H., Zhu S., Xing J., Li X., Zhu Z., Zheng J., Wang L., Wang B., Chen J., et al. Nematode-encoded RALF peptide mimics facilitate parasitism of plants through the FERONIA receptor kinase. Mol. Plant. 2020;13:1434–1454. doi: 10.1016/j.molp.2020.08.014. [DOI] [PubMed] [Google Scholar]
- 22.De Rybel B., Vassileva V., Parizot B., Demeulenaere M., Grunewald W., Audenaert D., Van Campenhout J., Overvoorde P., Jansen L., Vanneste S., et al. A novel Aux/IAA28 signaling cascade activates GATA23-dependent specification of lateral root founder cell identity. Curr. Biol. 2010;20:1697–1706. doi: 10.1016/j.cub.2010.09.007. [DOI] [PubMed] [Google Scholar]
- 23.Hirakawa Y. Non-cell-autonomous control of vascular stem cell fate by a CLE peptide/receptor system. Proc. Natl. Acad. Sci. USA. 2008;105:15208–15213. doi: 10.1073/pnas.0808444105. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Chevalier E., Loubert-Hudon A., Matton D.P. ScRALF3, a secreted RALF-like peptide involved in cell-cell communication between the sporophyte and the female gametophyte in a solanaceous species. Plant J. 2013;73:1019–1033. doi: 10.1111/tpj.12096. [DOI] [PubMed] [Google Scholar]
- 25.Kiryushkin A.S., Ilina E.L., Guseva E.D., Pawlowski K., Demchenko K.N. Lateral root initiation in cucumber (Cucumis sativus): What does the expression pattern of Rapid Alkalinization Factor 34 (RALF34) tell us? Int. J. Mol. Sci. 2023;23 doi: 10.3390/ijms24098440. submitted for publication. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26.Ge Z., Dresselhaus T., Qu L.-J. How CrRLK1L receptor complexes perceive RALF signals. Trends Plant Sci. 2019;24:978–981. doi: 10.1016/j.tplants.2019.09.002. [DOI] [PubMed] [Google Scholar]
- 27.Solis-Miranda J., Quinto C. The CrRLK1L subfamily: One of the keys to versatility in plants. Plant Physiol. Biochem. 2021;166:88–102. doi: 10.1016/j.plaphy.2021.05.028. [DOI] [PubMed] [Google Scholar]
- 28.Zhu S., Fu Q., Xu F., Zheng H., Yu F. New paradigms in cell adaptation: Decades of discoveries on the CrRLK1L receptor kinase signalling network. New Phytol. 2021;232:1168–1183. doi: 10.1111/nph.17683. [DOI] [PubMed] [Google Scholar]
- 29.Xie Y., Sun P., Li Z., Zhang F., You C., Zhang Z. FERONIA receptor kinase integrates with hormone signaling to regulate plant growth, development, and responses to environmental stimuli. Int. J. Mol. Sci. 2022;23:3730. doi: 10.3390/ijms23073730. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Baez L.A., Tichá T., Hamann T. Cell wall integrity regulation across plant species. Plant Mol. Biol. 2022;109:483–504. doi: 10.1007/s11103-022-01284-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.Abd Algfoor Z., Shahrizal Sunar M., Abdullah A., Kolivand H. Identification of metabolic pathways using pathfinding approaches: A systematic review. Brief. Funct. Genom. 2016;16:87–98. doi: 10.1093/bfgp/elw002. [DOI] [PubMed] [Google Scholar]
- 32.Gargallo-Garriga A., Sardans J., Pérez-Trujillo M., Rivas-Ubach A., Oravec M., Vecerova K., Urban O., Jentsch A., Kreyling J., Beierkuhnlein C., et al. Opposite metabolic responses of shoots and roots to drought. Sci. Rep. 2014;4:6829. doi: 10.1038/srep06829. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Novák J., Černý M., Pavlů J., Zemánková J., Skalák J., Plačková L., Brzobohatý B. Roles of proteome dynamics and cytokinin signaling in root to hypocotyl ratio changes induced by shading roots of Arabidopsis seedlings. Plant Cell Physiol. 2015;56:1006–1018. doi: 10.1093/pcp/pcv026. [DOI] [PubMed] [Google Scholar]
- 34.Hildreth S.B., Foley E.E., Muday G.K., Helm R.F., Winkel B.S.J. The dynamic response of the Arabidopsis root metabolome to auxin and ethylene is not predicted by changes in the transcriptome. Sci. Rep. 2020;10:679. doi: 10.1038/s41598-019-57161-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 35.Gogolev Y.V., Ahmar S., Akpinar B.A., Budak H., Kiryushkin A.S., Gorshkov V.Y., Hensel G., Demchenko K.N., Kovalchuk I., Mora-Poblete F., et al. OMICs, epigenetics, and genome editing techniques for food and nutritional security. Plants. 2021;10:1423. doi: 10.3390/plants10071423. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 36.Berka M., Luklová M., Dufková H., Berková V., Novák J., Saiz-Fernández I., Rashotte A.M., Brzobohatý B., Černý M. Barley root proteome and metabolome in response to cytokinin and abiotic stimuli. Front. Plant Sci. 2020;11:590337. doi: 10.3389/fpls.2020.590337. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Ludovic C.G., Alexander L., Ruedi A. Mass spectrometry applied to bottom-up proteomics: Entering the high-throughput era for hypothesis testing. Annu. Rev. Anal. Chem. 2016;9:449–472. doi: 10.1146/annurev-anchem-071015-041535. [DOI] [PubMed] [Google Scholar]
- 38.Danko K., Lukasheva E., Zhukov V.A., Zgoda V., Frolov A. Detergent-assisted protein digestion—On the way to avoid the key bottleneck of shotgun bottom-up proteomics. Int. J. Mol. Sci. 2022;23:13903. doi: 10.3390/ijms232213903. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.Mergner J., Frejno M., List M., Papacek M., Chen X., Chaudhary A., Samaras P., Richter S., Shikata H., Messerer M., et al. Mass-spectrometry-based draft of the Arabidopsis proteome. Nature. 2020;579:409–414. doi: 10.1038/s41586-020-2094-2. [DOI] [PubMed] [Google Scholar]
- 40.Frolov A., Mamontova T., Ihling C., Lukasheva E., Bankin M., Chantseva V., Vikhnina M., Soboleva A., Shumilina J., Mavropolo-Stolyarenko G., et al. Mining seed proteome: From protein dynamics to modification profiles. Biol. Commun. 2018;63:43–58. doi: 10.21638/spbu03.2018.106. [DOI] [Google Scholar]
- 41.Wang L., Yang T., Wang B., Lin Q., Zhu S., Li C., Ma Y., Tang J., Xing J., Li X., et al. RALF1-FERONIA complex affects splicing dynamics to modulate stress responses and growth in plants. Sci. Adv. 2020;6:eaaz1622. doi: 10.1126/sciadv.aaz1622. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 42.Yin J., Zhang D., Zhuang J., Huang Y., Mu Y., Lv S. Study on the correlation between gene expression and enzyme activity of seven key enzymes and ginsenoside content in ginseng in over time in Ji’an, China. Int. J. Mol. Sci. 2017;18:2682. doi: 10.3390/ijms18122682. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Cantarello C., Volpe V., Azzolin C., Bertea C. Modulation of enzyme activities and expression of genes related to primary and secondary metabolism in response to UV-B stress in cucumber (Cucumis sativus L.) J. Plant Interact. 2005;1:151–161. doi: 10.1080/17429140600831581. [DOI] [Google Scholar]
- 44.Chen Y., Wang J., Yao L., Li B., Ma X., Si E., Yang K., Li C., Shang X., Meng Y., et al. Combined proteomic and metabolomic analysis of the molecular mechanism underlying the response to salt stress during seed germination in barley. Int. J. Mol. Sci. 2022;23:10515. doi: 10.3390/ijms231810515. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Paudel G., Bilova T., Schmidt R., Greifenhagen U., Berger R., Tarakhovskaya E., Stöckhardt S., Balcke G.U., Humbeck K., Brandt W., et al. Osmotic stress is accompanied by protein glycation in Arab. Thaliana J. Exp. Bot. 2016;67:6283–6295. doi: 10.1093/jxb/erw395. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46.Kiryushkin A.S., Ilina E.L., Puchkova V.A., Guseva E.D., Pawlowski K., Demchenko K.N. Lateral root initiation in the parental root meristem of cucurbits: Old players in a new position. Front. Plant Sci. 2019;10:365. doi: 10.3389/fpls.2019.00365. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 47.Frolov A., Bluher M., Hoffmann R. Glycation sites of human plasma proteins are affected to different extents by hyperglycemic conditions in type 2 diabetes mellitus. Anal. Bioanal. Chem. 2014;406:5755–5763. doi: 10.1007/s00216-014-8018-y. [DOI] [PubMed] [Google Scholar]
- 48.Shimotohno A., Aki S.S., Takahashi N., Umeda M. Regulation of the plant cell cycle in response to hormones and the environment. Annu. Rev. Plant Biol. 2021;72:273–296. doi: 10.1146/annurev-arplant-080720-103739. [DOI] [PubMed] [Google Scholar]
- 49.Dekomah S.D., Bi Z., Dormatey R., Wang Y., Haider F.U., Sun C., Yao P., Bai J. The role of CDPKs in plant development, nutrient and stress signaling. Front. Genet. 2022;13:996203. doi: 10.3389/fgene.2022.996203. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50.Asano T., Hayashi N., Kobayashi M., Aoki N., Miyao A., Mitsuhara I., Ichikawa H., Komatsu S., Hirochika H., Kikuchi S., et al. A rice calcium-dependent protein kinase OsCPK12 oppositely modulates salt-stress tolerance and blast disease resistance. Plant J. 2012;69:26–36. doi: 10.1111/j.1365-313X.2011.04766.x. [DOI] [PubMed] [Google Scholar]
- 51.Nikonorova N., Murphy E., De Lima C.F.F., Zhu S., Van de Cotte B., Vu L.D., Balcerowicz D., Li L., Kong X., De Rop G., et al. The Arabidopsis root tip (phospho)proteomes at growth-promoting versus growth-repressing conditions reveal novel root growth regulators. Cells. 2021;10:1665. doi: 10.3390/cells10071665. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 52.De Veylder L., Beeckman T., Beemster G.T.S., de Almeida Engler J., Ormenese S., Maes S., Naudts M., Van Der Schueren E., Jacqmard A., Engler G., et al. Control of proliferation, endoreduplication and differentiation by the Arabidopsis E2Fa–DPa transcription factor. EMBO J. 2002;21:1360–1368. doi: 10.1093/emboj/21.6.1360. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53.Berckmans B., Vassileva V., Schmid S.P.C., Maes S., Parizot B., Naramoto S., Magyar Z., Kamei C.L.A., Koncz C., Bogre L., et al. Auxin-dependent cell cycle reactivation through transcriptional regulation of Arabidopsis E2Fa by lateral organ boundary proteins. Plant Cell. 2011;23:3671–3683. doi: 10.1105/tpc.111.088377. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54.Shumilina J., Gorbach D., Popova V., Tsarev A., Kuznetsova A., Grashina M., Dorn M., Lukasheva E., Osmolovskaya N., Romanovskaya E., et al. Protein glycation and drought response of pea (Pisum sativum L.) root nodule proteome: A proteomics approach. Biol. Commun. 2021;66:210–224. doi: 10.21638/spbu03.2021.303. [DOI] [Google Scholar]
- 55.Mamontova T., Lukasheva E., Mavropolo-Stolyarenko G., Proksch C., Bilova T., Kim A., Babakov V., Grishina T., Hoehenwarter W., Medvedev S., et al. Proteome map of pea (Pisum sativum L.) embryos containing different amounts of residual chlorophylls. Int. J. Mol. Sci. 2018;19:4066. doi: 10.3390/ijms19124066. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 56.Frolov A., Bilova T., Paudel G., Berger R., Balcke G.U., Birkemeyer C., Wessjohann L.A. Early responses of mature Arabidopsis thaliana plants to reduced water potential in the agar-based polyethylene glycol infusion drought model. J. Plant Physiol. 2017;208:70–83. doi: 10.1016/j.jplph.2016.09.013. [DOI] [PubMed] [Google Scholar]
- 57.Haruta M., Constabel C.P. Rapid alkalinization factors in poplar cell cultures. Peptide isolation, cDNA cloning, and differential expression in leaves and methyl jasmonate-treated cells. Plant Physiol. 2003;131:814–823. doi: 10.1104/pp.014597. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 58.Strzalka W., Ziemienowicz A. Proliferating cell nuclear antigen (PCNA): A key factor in DNA replication and cell cycle regulation. Ann. Bot. 2011;107:1127–1140. doi: 10.1093/aob/mcq243. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 59.Moldovan G.-L., Pfander B., Jentsch S. PCNA, the maestro of the replication fork. Cell. 2007;129:665–679. doi: 10.1016/j.cell.2007.05.003. [DOI] [PubMed] [Google Scholar]
- 60.Stegmann M., Monaghan J., Smakowska-Luzan E., Rovenich H., Lehner A., Holton N., Belkhadir Y., Zipfel C. The receptor kinase FER is a RALF-regulated scaffold controlling plant immune signaling. Science. 2017;355:287–289. doi: 10.1126/science.aal2541. [DOI] [PubMed] [Google Scholar]
- 61.Murphy M.P. How mitochondria produce reactive oxygen species. Biochem. J. 2009;417:1–13. doi: 10.1042/BJ20081386. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 62.Osmolovskaya N., Shumilina J., Kim A., Didio A., Grishina T., Bilova T., Keltsieva O.A., Zhukov V., Tikhonovich I., Tarakhovskaya E., et al. Methodology of drought stress research: Experimental setup and physiological characterization. Int. J. Mol. Sci. 2018;19:4089. doi: 10.3390/ijms19124089. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 63.Muthukumar K., Rajakumar S., Sarkar M.N., Nachiappan V. Glutathione peroxidase3 of Saccharomyces cerevisiae protects phospholipids during cadmium-induced oxidative stress. Antonie Van Leeuwenhoek. 2011;99:761–771. doi: 10.1007/s10482-011-9550-9. [DOI] [PubMed] [Google Scholar]
- 64.Lim J., Lim C.W., Lee S.C. Core components of abscisic acid signaling and their post-translational modification. Front. Plant Sci. 2022;13:895698. doi: 10.3389/fpls.2022.895698. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 65.Song Y., Wilson A.J., Zhang X.C., Thoms D., Sohrabi R., Song S., Geissmann Q., Liu Y., Walgren L., He S.Y., et al. FERONIA restricts Pseudomonas in the rhizosphere microbiome via regulation of reactive oxygen species. Nat. Plants. 2021;7:644–654. doi: 10.1038/s41477-021-00914-0. [DOI] [PubMed] [Google Scholar]
- 66.Shi S., Li S., Asim M., Mao J., Xu D., Ullah Z., Liu G., Wang Q., Liu H. The Arabidopsis calcium-dependent protein kinases (CDPKs) and their roles in plant growth regulation and abiotic stress responses. Int. J. Mol. Sci. 2018;19:1900. doi: 10.3390/ijms19071900. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 67.Haruta M., Sabat G., Stecker K., Minkoff B.B., Sussman M.R. A peptide hormone and its receptor protein kinase regulate plant cell expansion. Science. 2014;343:408–411. doi: 10.1126/science.1244454. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 68.Chen J., Yu F., Liu Y., Du C., Li X., Zhu S., Wang X., Lan W., Rodriguez P.L., Liu X., et al. FERONIA interacts with ABI2-type phosphatases to facilitate signaling cross-talk between abscisic acid and RALF peptide in Arabidopsis. Proc. Natl. Acad. Sci. USA. 2016;113:E5519–E5527. doi: 10.1073/pnas.1608449113. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 69.Pirrung M.C. Ethylene biosynthesis from 1-aminocyclopropanecarboxylic acid. Acc. Chem. Res. 1999;32:711–718. doi: 10.1021/ar960003. [DOI] [Google Scholar]
- 70.Mao D., Yu F., Li J., Van de poel B., Tan D., Li J., Liu Y., Li X., Dong M., Chen L., et al. FERONIA receptor kinase interacts with S-adenosylmethionine synthetase and suppresses S-adenosylmethionine production and ethylene biosynthesis in Arabidopsis. Plant Cell Environ. 2015;38:2566–2574. doi: 10.1111/pce.12570. [DOI] [PubMed] [Google Scholar]
- 71.Deslauriers S.D., Larsen P.B. FERONIA is a key modulator of brassinosteroid and ethylene responsiveness in Arabidopsis hypocotyls. Mol. Plant. 2010;3:626–640. doi: 10.1093/mp/ssq015. [DOI] [PubMed] [Google Scholar]
- 72.Mariconti L., Pellegrini B., Cantoni R., Stevens R., Bergounioux C., Cella R., Albani D. The E2F family of transcription factors from Arabidopsis thaliana: Novel and conserved components of the RETINOBLASTOMA/E2F pathway in plants. J. Biol. Chem. 2002;277:9911–9919. doi: 10.1074/jbc.M110616200. [DOI] [PubMed] [Google Scholar]
- 73.Magyar Z., Atanassova A., De Veylder L., Rombauts S., Inzé D. Characterization of two distinct DP-related genes from Arabidopsis thaliana. FEBS Lett. 2000;486:79–87. doi: 10.1016/S0014-5793(00)02238-9. [DOI] [PubMed] [Google Scholar]
- 74.Berardini T.Z., Reiser L., Li D., Mezheritsky Y., Muller R., Strait E., Huala E. The arabidopsis information resource: Making and mining the “gold standard” annotated reference plant genome. Genesis. 2015;53:474–485. doi: 10.1002/dvg.22877. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 75.Li Z., Zhang Z., Yan P., Huang S., Fei Z., Lin K. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genom. 2011;12:540. doi: 10.1186/1471-2164-12-540. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 76.Zheng Y., Wu S., Bai Y., Sun H., Jiao C., Guo S., Zhao K., Blanca J., Zhang Z., Huang S., et al. Cucurbit Genomics Database (CuGenDB): A central portal for comparative and functional genomics of cucurbit crops. Nucleic Acids Res. 2019;47:D1128–D1136. doi: 10.1093/nar/gky944. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 77.Sievers F., Wilm A., Dineen D., Gibson T.J., Karplus K., Li W., Lopez R., McWilliam H., Remmert M., Söding J., et al. Fast, scalable generation of high-quality protein multiple sequence alignments using Clustal Omega. Mol. Syst. Biol. 2011;7:539. doi: 10.1038/msb.2011.75. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 78.Kumar S., Stecher G., Tamura K. MEGA7: Molecular evolutionary genetics analysis version 7.0 for bigger datasets. Mol. Biol. Evol. 2016;33:1870–1874. doi: 10.1093/molbev/msw054. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 79.Yang Z. Maximum likelihood phylogenetic estimation from DNA sequences with variable rates over sites: Approximate methods. J. Mol. Evol. 1994;39:306–314. doi: 10.1007/BF00160154. [DOI] [PubMed] [Google Scholar]
- 80.Jones D.T., Taylor W.R., Thornton J.M. The rapid generation of mutation data matrices from protein sequences. Comput. Appl. Biosci. 1992;8:275–282. doi: 10.1093/bioinformatics/8.3.275. [DOI] [PubMed] [Google Scholar]
- 81.Wan H., Zhao Z., Qian C., Sui Y., Malik A.A., Chen J. Selection of appropriate reference genes for gene expression studies by quantitative real-time polymerase chain reaction in cucumber. Anal. Biochem. 2010;399:257–261. doi: 10.1016/j.ab.2009.12.008. [DOI] [PubMed] [Google Scholar]
- 82.Dubrovsky J.G., Soukup A., Napsucialy-Mendivil S., Jeknic Z., Ivanchenko M.G. The lateral root initiation index: An integrative measure of primordium formation. Ann. Bot. 2009;103:807–817. doi: 10.1093/aob/mcn267. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 83.Ilina E.L., Kiryushkin A.S., Semenova V.A., Demchenko N.P., Pawlowski K., Demchenko K.N. Lateral root initiation and formation within the parental root meristem of Cucurbita pepo: Is auxin a key player? Ann. Bot. 2018;122:873–888. doi: 10.1093/aob/mcy052. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 84.Demchenko K.N., Demchenko N.P. Changes of root structure in connection with the development of lateral root primordia in wheat and pumpkins. In: Gašparíková O., Čiamporová M., Mistrík I., Baluška F., editors. Recent Advances of Plant Root Structure and Function. Volume 90. Springer; Dordrecht, The Netherlands: 2001. pp. 39–47. Developments in Plant and Soil Sciences. [DOI] [Google Scholar]
- 85.Hoagland D.R., Arnon D.T. California Agriculture Experiment Station. Circular 347. University of California; Berkeley, CA, USA: 1938. The water-culture method for growing plants without soil; pp. 1–39. [Google Scholar]
- 86.Gancheva M.S., Dodueva I.E., Lebedeva M.A., Tvorogova V.E., Tkachenko A.A., Lutova L.A. Identification, expression, and functional analysis of CLE genes in radish (Raphanus sativus L.) storage root. BMC Plant Biol. 2016;16:23–33. doi: 10.1186/s12870-015-0687-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 87.Morato do Canto A., Ceciliato P.H.O., Ribeiro B., Ortiz Morea F.A., Franco Garcia A.A., Silva-Filho M.C., Moura D.S. Biological activity of nine recombinant AtRALF peptides: Implications for their perception and function in Arabidopsis. Plant Physiol. Biochem. 2014;75:45–54. doi: 10.1016/j.plaphy.2013.12.005. [DOI] [PubMed] [Google Scholar]
- 88.Limpens E., Ramos J., Franken C., Raz V., Compaan B., Franssen H., Bisseling T., Geurts R. RNA interference in Agrobacterium rhizogenes-transformed roots of Arabidopsis and Medicago truncatula. J. Exp. Bot. 2004;55:983–992. doi: 10.1093/jxb/erh122. [DOI] [PubMed] [Google Scholar]
- 89.Hornung E., Krueger C., Pernstich C., Gipmans M., Porzel A., Feussner I. Production of (10E,12Z)-conjugated linoleic acid in yeast and tobacco seeds. Biochim. Biophys. Acta-Mol. Cell Biol. Lipids. 2005;1738:105–114. doi: 10.1016/j.bbalip.2005.11.004. [DOI] [PubMed] [Google Scholar]
- 90.Ilina E.L., Logachov A.A., Laplaze L., Demchenko N.P., Pawlowski K., Demchenko K.N. Composite Cucurbita pepo plants with transgenic roots as a tool to study root development. Ann. Bot. 2012;110:479–489. doi: 10.1093/aob/mcs086. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 91.Chantseva V., Bilova T., Smolikova G., Frolov A., Medvedev S. 3D-clinorotation induces specific alterations in metabolite profiles of germinating Brassica napus L. seeds. Biol. Commun. 2019;64:55–74. doi: 10.21638/spbu03.2019.107. [DOI] [Google Scholar]
- 92.Soboleva A., Frolova N., Bureiko K., Shumilina J., Balcke G.U., Zhukov V.A., Tikhonovich I.A., Frolov A. Dynamics of reactive carbonyl species in pea root nodules in response to polyethylene glycol (PEG)-induced osmotic stress. Int. J. Mol. Sci. 2022;23:2726. doi: 10.3390/ijms23052726. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 93.Leonova T., Popova V., Tsarev A., Henning C., Antonova K., Rogovskaya N., Vikhnina M., Baldensperger T., Soboleva A., Dinastia E., et al. Does protein glycation impact on the drought-related changes in metabolism and nutritional properties of mature pea (Pisum sativum L.) seeds? Int. J. Mol. Sci. 2020;21:567. doi: 10.3390/ijms21020567. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 94.Pang Z., Chong J., Zhou G., de Lima Morais D.A., Chang L., Barrette M., Gauthier C., Jacques P.-É., Li S., Xia J. MetaboAnalyst 5.0: Narrowing the gap between raw spectra and functional insights. Nucleic Acids Res. 2021;49:W388–W396. doi: 10.1093/nar/gkab382. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 95.Frolov A., Didio A., Ihling C., Chantzeva V., Grishina T., Hoehenwarter W., Sinz A., Smolikova G., Bilova T., Medvedev S. The effect of simulated microgravity on the Brassica napus seedling proteome. Funct. Plant Biol. 2018;45:440–452. doi: 10.1071/FP16378. [DOI] [PubMed] [Google Scholar]
- 96.Greifenhagen U., Frolov A., Bluher M., Hoffmann R. Plasma proteins modified by advanced glycation end products (AGEs) reveal site-specific susceptibilities to glycemic control in patients with type 2 diabetes. J. Biol. Chem. 2016;291:9610–9616. doi: 10.1074/jbc.M115.702860. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 97.Schneider C.A., Rasband W.S., Eliceiri K.W. NIH Image to ImageJ: 25 years of image analysis. Nat. Methods. 2012;9:671–675. doi: 10.1038/nmeth.2089. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 98.Spiller S., Frolov A., Hoffmann R. Quantification of specific glycation sites in human serum albumin as prospective type 2 diabetes mellitus biomarkers. Protein Peptide Lett. 2017;24:887–896. doi: 10.2174/0929866524666170202124120. [DOI] [PubMed] [Google Scholar]
- 99.Eng J.K., McCormack A.L., Yates J.R. An approach to correlate tandem mass spectral data of peptides with amino acid sequences in a protein database. J. Am. Soc. Mass Spectrom. 1994;5:976–989. doi: 10.1016/1044-0305(94)80016-2. [DOI] [PubMed] [Google Scholar]
- 100.Eng J.K., Fischer B., Grossmann J., MacCoss M.J. A fast SEQUEST cross correlation algorithm. J. Proteome Res. 2008;7:4598–4602. doi: 10.1021/pr800420s. [DOI] [PubMed] [Google Scholar]
- 101.R Core Team R: A Language and Environment for Statistical Computing. [(accessed on 28 March 2023)]. Available online: https://www.R-project.org.
- 102.Ritchie M.E., Phipson B., Wu D., Hu Y., Law C.W., Shi W., Smyth G.K. limma powers differential expression analyses for RNA-sequencing and microarray studies. Nucleic Acids Res. 2015;43:e47. doi: 10.1093/nar/gkv007. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 103.Schwacke R., Ponce-Soto G.Y., Krause K., Bolger A.M., Arsova B., Hallab A., Gruden K., Stitt M., Bolger M.E., Usadel B. MapMan4: A refined protein classification and annotation framework applicable to multi-omics data analysis. Mol. Plant. 2019;12:879–892. doi: 10.1016/j.molp.2019.01.003. [DOI] [PubMed] [Google Scholar]
- 104.Lohse M., Nagel A., Herter T., MAY P., Schroda M., Zrenner R., Tohge T., Fernie A.R., Stitt M., Usadel B. Mercator: A fast and simple web server for genome scale functional annotation of plant sequence data. Plant Cell Environ. 2014;37:1250–1258. doi: 10.1111/pce.12231. [DOI] [PubMed] [Google Scholar]
- 105.Horton P., Park K.-J., Obayashi T., Fujita N., Harada H., Adams-Collier C.J., Nakai K. WoLF PSORT: Protein localization predictor. Nucleic Acids Res. 2007;35:W585–W587. doi: 10.1093/nar/gkm259. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 106.Bu D., Luo H., Huo P., Wang Z., Zhang S., He Z., Wu Y., Zhao L., Liu J., Guo J., et al. KOBAS-i: Intelligent prioritization and exploratory visualization of biological functions for gene enrichment analysis. Nucleic Acids Res. 2021;49:W317–W325. doi: 10.1093/nar/gkab447. [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Supplementary Materials
Data Availability Statement
All relevant data are available within the paper and its Supplementary Materials files.












