Abstract
The creation of mutant mice has been invaluable for advancing biomedical science, but is too time- and resource-intensive for investigating the full range of mutations and polymorphisms. Cell culture models are therefore an invaluable complement to mouse models, especially for cell-autonomous pathways like the circadian clock. In this study, we quantitatively assessed the use of CRISPR to create cell models in mouse embryonic fibroblasts (MEFs) as compared to mouse models. We generated two point mutations in the clock genes Per1 and Per2 in mice and in MEFs using the same sgRNAs and repair templates for HDR and quantified the frequency of the mutations by digital PCR. The frequency was about an order of magnitude higher in mouse zygotes compared to that in MEFs. However, the mutation frequency in MEFs was still high enough for clonal isolation by simple screening of a few dozen individual cells. The Per mutant cells that we generated provide important new insights into the role of the PAS domain in regulating PER phosphorylation, a key aspect of the circadian clock mechanism. Quantification of the mutation frequency in bulk MEF populations provides a valuable basis for optimizing CRISPR protocols and time/resource planning for generating cell models for further studies.
Subject terms: Circadian mechanisms, CRISPR-Cas9 genome editing
Introduction
The prokaryotic defense system CRISPR-Cas provides adaptive immunity against foreign DNA molecules and has been converted to a revolutionary genome editing tool1–3. The CRISPR-Cas9 system from Streptococcus pyogenes is the most widely used because of its efficiency and simplicity4. The system requires two components: the Cas9 nuclease and a single guide RNA (sgRNA) which targets the nuclease to a specific genomic locus based on base pairing at a 20-nt target sequence. The sgRNA-guided Cas9 generates a double strand break (DSB) in the target site, which may be repaired in one of two different ways. The first is random insertion/deletion (indel) mutagenesis which occurs when the DSB is repaired by the error-prone non-homologous end-joining (NHEJ) pathway, resulting in a knockout allele due to frameshifting or indels of amino acids (AAs) due to in-frame nucleotide indels4. The second is precise allele editing through the high-fidelity homology-directed repair (HDR) pathway based on a donor or repair template, which usually occurs less frequently than NHEJ5,6. More versatile than other genetic approaches such as siRNA and transgene expression, and more efficient than older homologous recombination methods7,8, CRISPR is becoming a more and more common method to modulate a gene to interrogate its function or for medical applications9,10.
CRISPR technology is rapidly evolving but still has many limitations. If target cells do not proliferate or are not easily transfected or electroporated with plasmids, clonal selection and expansion from the treated heterogenic population may not be possible or practical. CRISPR viral vectors have been employed to try to overcome these problems11–16. Clonal selection and expansion may not be required if the transduction efficiency and expression of the viral vectors are close to 100% and sgRNA efficiency is very high17. Several strategies have been developed to enhance HDR efficiency by activating HDR-related proteins or inhibiting NHEJ-related proteins18–20. HDR donor templates also affect the efficiency significantly. Various lengths, chemical modifications, donor strand preference and symmetry of homologous arms have been tested4,21–23. Although results vary significantly in these studies, it seems that asymmetric single stranded oligodeoxynucleotides (ssODNs) with phosphorothioate bonds from the non-targeting strand are most effective as HDR donor templates.
The circadian clock drives daily rhythms in behavior and physiology24–28, and dysfunction or disruption of the clock has been implicated in diverse disease states including sleep disorders29–33. Decades of prior work have revealed that the clock is built on a core feedback loop that is cell autonomous, involving transcriptional and post-translational regulation of the redundant pacemaker Period (Per) genes Per1 and Per234,35. Because the circadian clock is cell autonomous, genetic disruptions of the clock manifest similar phenotypes at the behavioral and cellular levels, and cell culture has proven to be a valuable and valid platform for characterizing the molecular biology of circadian rhythms36–38. The endogenous clocks of cultured cells—including mouse embryonic fibroblasts (MEFs) and human U2OS cells—can be precisely measured in real time by introducing a luciferase (Luc) reporter gene under control of a clock promoter36,38–40. Across numerous studies, such cells have served as functional models for in vivo circadian clocks, and results have been consistently validated in live animal models. Cell culture models are not only less resource-consuming, but also more easily manipulated by chemicals and transgenes, which makes the cell models more suitable for mechanistic studies.
Historically, manipulation of endogenous clock genes in cell culture models suffered from technical limitations. Many genetic cell models required first developing mutant mouse models from which cells were then harvested. For example, mice with the mPer2-Luc knockin gene were crossed with mice with other mutations, backcrossed as needed, and MEFs were obtained from the resulting transgenic/mutant offspring41–43. Recent developments in genome editing have created new opportunities for generating cell culture models without first generating mutant mice. Several studies including ours demonstrated that clock genes can be knocked out efficiently in culture using CRISPR17,44–47. To our knowledge, however, there are no HDR-mediated mutations made in clock genes in MEFs by CRISPR. Because many mutant and transgenic mouse models including mPer2-Luc knockin are already available, it would be advantageous to implement direct genome editing in MEFs derived from these existing genetic mouse models.
In this current study we generated two CRISPR-mediated SNP mutations in mice and MEFs and quantified and compared the efficiency between mice and MEFs. Digital PCR can be a powerful tool for genotyping of CRISPR mutant mice when indels are too large to be detected by conventional PCR-based genotyping. When HDR-mediated mutations are generated in cells, we show that digital PCR is a simple yet powerful tool to accurately quantify the frequency of the mutations in the heterogenous cell population. Measuring the frequency of the mutations would directly inform optimization of CRISPR procedures and amounts of effort necessary for downstream clonal isolation.
Results
SNP mutations in mPer genes are generated efficiently in mice by CRISPR-Cas9
Although key circadian parameters of the clock seem to be encoded in the PERIOD (PER) protein, it is little understood how 24 h time cues are generated by the regulation of PER. As with most other proteins, PER has a modular structure with multiple domains, including the PAS domain, CRY-binding domain (CBD), and CK1-binding domain (CKBD) (Fig. S1). Although PAS is known as a homo or hetero-dimerization domain and conserved from plants to animals as an essential timing device48,49, its role in mammalian clocks is little studied. To understand how the PAS domain contributes to rhythm generation of PER at posttranslational levels, we decided to disrupt the main function of PAS, homodimerization, in MEFs and mice.
Because the dimer structure of PER and PER PAS domains has been solved at high resolution by X-ray crystallography50,51, we targeted critical motifs and amino acid (AA) residues for dimerization based on these available data. According to the structural studies, motifs containing PER1-W448 and PER2-W419 AA are most critical for dimerization (Fig. S1). Tryptophan to glutamate mutations (PER1 W448E and PER2 W419E) have been suggested to be most disruptive to the hydrophobic interaction-mediated dimerization; we therefore planned to generate these mutations using CRISPR for functional studies.
Before we initiated the project in mouse models, feasibility of the project was tested in a clock cell model U2OS which has been proven to have a functional clock and to be amenable to CRISPR genome editing17,47,52. When the motifs harboring W448 in PER1 and W421 in PER2 (conserved residues in human PER proteins) were targeted by CRISPR, diverse indel mutations were generated including in-frame mutations leading to deletion of several AAs (Fig. S2). Interestingly, all of the in-frame AA deletion mutants exhibited defective phosphorylation: largely truncated or hypo-phosphorylation of both PER proteins compared to wt PER. A subset of these PER deletion mutations as well as PAS domain point mutations W448E in mPer1 and W419E in mPer2 were tested in a different human cell line (HEK293) through transient transfection using mammalian expression plasmids; transient co-expression of CK1δ produced much less phosphorylation of these mutant PERs than wt PER (Fig. S2). This is exciting but counterintuitive because PAS has not previously been directly implicated in PER phosphorylation or interaction with CK1.
All the data above strongly indicate that the PAS domain should be critical in circadian timing because PER phosphorylation is the basis of the mammalian circadian timer; thus mutations in and around the critical tryptophan residue and disrupting its phosphorylation should impair circadian rhythms. As discussed above, we aimed to generate tryptophan-to-glutamate mutations in mPer1 and mPer2, respectively. We selected an efficient sgRNA sequence close to the residues by testing several sgRNA sequences around the residues. MEFs were transfected with all-in-one pAdTrack-Cas9-sgRNA plasmid followed by FACS sorting for positive cells (GFP from the all-in-one plasmid)17. These cells were subjected to T7E1 assays and the most effective ones were selected (Fig. 1a). When ssODNs were designed for homology-directed repair (HDR) to mutate W448E in mPer1 and W419E in mPer2, novel restriction enzyme sites were added in the template to facilitate genotyping without sequencing PCR amplicons (Fig. 1b). These additional mutations are also necessary when digital PCR is designed to distinguish between wt and mutant alleles. Although annealing temperature is altered by single nucleotide polymorphisms, it is very challenging to develop an all-or-none annealing condition based on a single nucleotide mutation53. Cas9 protein along with sgRNA and ssODN were injected or electroporated into one-celled fertilized eggs to produce the two knockin mutant mice. A total of 990 embryo injections/electroporations (see “Materials and methods” section for a detailed breakdown) generated 79 and 91 live pups for mPer1 and mPer2 mutant mice, respectively. As summarized in Fig. 2a, we obtained 34 apparent heterozygous (het) and 9 apparent homozygous (ho) mutant mice for mPer1W448E based on genotyping of tail tissues of founder mice (F0). Based on the total number of mice we examined and the number of mice harboring the mutant allele, KI efficiency was 54%. In addition, we obtained mice with 13 useful in-frame AA indel mutations which we expect to produce a more severe phenotype than the point mutations. For mPer2W419E, 24 apparent heterozygotes and no apparent homozygotes were produced (Fig. 2b). Although enzyme digestion of PCR amplicons suggested several homozygotes (see clones with red asterisk in Fig. 2b), they turned out to be all heterozygotes when assayed by digital PCR (see below). One of the two alleles had large deletions in these mice, which could not be amplified with the primer set and thus produced an unmixed sequencing chromatogram. It should be noted that low frequency of minor alleles due to mosaicism could be present in tail samples but not detected using conventional PCR-based genotyping method in F0 mice. When the mutant mice were genotyped by PCR, amplicon samples were run on both polyacrylamide gel (PAGE) and agarose gel to detect heteroduplex DNA and multiple on-target insertions (concatemers), respectively. It is known that heteroduplex DNA runs much larger than expected on PAGE in a sequence specific manner, and this heteroduplex mobility assay is widely used for genotyping54,55. We used this property for initial screening, but final genotype was confirmed by enzyme digestion and Sanger sequencing. As shown in Fig. 2 and Fig. S6, amplicons of larger than expected size are only visible in PAGE, but they are not detected on agarose gels, indicating that there are no multiple on-target insertions. This was subsequently confirmed by ddPCR (see “Genotyping for CRISPR-mutant mice can be streamlined by digital PCR” section results below).
Figure 1.
Strategy to knock-in mutations into mPer1 and mPer2 genes. (a) Efficient sgRNAs targeting mPer1 W448 and mPer2 W419 residues were selected by T7E1 assays in MEFs. Positive and negative transfected cells were selected by GFP expression and subjected to T7E1 assays. T7E1 results for less efficient sgRNAs are not shown. The original gel is presented in Fig. S8. (b) ssODNs for HDR are designed based on location of sgRNA. Note the asymmetric homologous arms.
Figure 2.
Knockin mutant mice are efficiently made by CRISPR-Cas9. (a,b) Genotyping by PCR and enzyme digestion showed efficient genome editing for two knockin mutations. Note that PCR amplicons indicated by a red asterisk in (b) were completely digested by AvaI. Some of the indel mutants along with the specific knockin mutants are shown by Sanger sequencing. The original gels are presented in Fig. S8.
Mosaicism can occur if Cas9-sgRNA continues to edit the genome after the one cell stage, and mosaicism in germline cells may be different from that in tail tissue. To confirm transmission of the mutations into the next generation and test mosaicism in the germline, we measured the genotypes of F1 mice using genomic DNA samples from ear tissue. After generating 2–3 F1 litters per founder, F1 genotypes were not different from those in tail tissue of F0 except in one instance. One of the mPer1 mutant mouse lineages had a third allele in the F1 mice not seen in tail DNA from F0 mice. We did not detect third alleles in any of the F0 tail DNA samples, suggesting that any third alleles were not present or present at very low frequencies in the tail tissue. It thus appears that the rate of mosaicism in our procedures is very low overall, but not zero, warranting continued monitoring.
Genotyping for CRISPR-mutant mice can be streamlined by digital PCR
From the conventional genotyping by PCR and enzyme digestion (Fig. 2), we believed 5 homozygotes for mPer2W419E mutant mice were made because PCR amplicons from these mice were completely digested by AvaI. However, we did get only 50% instead of 100% heterozygous pups from breeding between these mutant and wt mice suggesting that one allele in these mice had large indels and thus the small PCR amplicon using the primer set could not be generated from these alleles. Indeed, PCR producing a large amplicon, ~ 1.2 kb revealed large deletion alleles in three of the mice (Fig. S3a). Despite several attempts using primers generating ~ 3 kb amplicons, we were not able to produce mutant PCR amplicons from the remaining two mice. Since large indels are not rare events and correct genotyping is critical when selecting founder mice, we developed a droplet digital PCR (ddPCR) assay for genotyping, which can quantify the number of the mutant copy over the copy number for a reference gene in the same sample in a PCR reaction and thus reveal correct genotypes regardless of indel size and digestion pattern. If a mutant probe is used, the ratio would be 1, 0.5 and 0 for homozygotes, heterozygotes and wt mice, respectively (Fig. S3b). For F0 mice, this genotyping approach would still not be definitive because of the possibility of mosaicism.
Sensitivity and accuracy of ddPCR were assessed by generating standard curves for low copy numbers of the mutant genomic alleles spiked into 5,000 copies of the wt genomic allele (Fig. 3a,b, Suppl Fig. S4). When 20, 100 and 500 copies of the mutant alleles were spiked into 5,000 copies of the wt allele, the ddPCR produced a strong linear correlation between added and detected copies (Fig. 3a,b) (R2 > 0.98). The reference probe for RPP30 gene also consistently detected ~ 5000 copies in these samples. Genotyping of both mPer mutant mice using this ddPCR protocol produced reliable results which were consistent with those obtained by enzyme digestion of PCR amplicons, except for five mPer2W419E mutant mice (Fig. 3c–f). Three of the mPer2 mutant mice were compound heterozygotes, which matches the results of PCR genotyping producing a larger amplicon (Fig. S3a). The other two compound heterozygous mPer2W419E mutant mice with putative large deletions could be also confirmed by ddPCR (Fig. 3d,f). ddPCR with the mutant probe on these samples produced ½ signals relative to those of the RPP30 probe whereas the wt probe did not produce any signal. These results demonstrate that the conventional PCR-based genotyping may not be suitable for all CRISPR mutant mice, especially ones with large indels, for which ddPCR is a much more tractable approach.
Figure 3.
Digital PCR can be used to genotype CRISPR mutant mice that cannot be genotyped by PCR analysis. (a,b) ddPCR was optimized using genomic DNA obtained from the mutant mice in Fig. 2. Our ddPCR conditions can reliably detect as low as 8 mutant copies in a reaction when they are mixed with 5000 copies of wt allele (Fig. S4). N = 4 each. (c,d) ddPCR produced reliable genotyping results even in compound heterozygotes which could not be genotyped by conventional PCR and enzyme digestion. PCR amplicons could not be generated from one of two alleles in two compound heterozygotes in (d) because they presumably had very large deletions. Note that the wt probe could not detect wt allele in these heterozygotes. N = 5 each. (e) The wt probe can detect wt allele. (f) Digital PCR can be a streamlined procedure for rapid genotyping of CRISPR mutant mice even for mutant mice with large indels.
Because off-target insertions of the repair templates may affect expression of the inserted genes or produce small pieces of PER proteins, they could affect circadian mechanisms. To detect off-target insertions, ddPCR was performed using primers binding inside of the repair template. When copy numbers were compared between in-in and in–out primers, both ddPCR pairs produced similar copy numbers (Fig. S5) indicating that there were no off-target insertions in these mice.
Targeted mutations by CRISPR-Cas9 are significantly less efficient in MEFs compared to mice
Although CRISPR genome editing can be done in vivo in a much more efficient manner compared to the conventional knockin methods, it still requires a lot more resources including space for animals compared to cell-based systems. As with many biological fields, circadian mechanisms can be studied in cells because the circadian clock is cell autonomous. Although demand for genome editing in cells in the circadian field is increasing because molecular mechanisms can be better studied in cell models such as MEFs and U2OS, there are only few cases where specific mutations other than knockouts in clock genes have been made in these cells. Many clock mutant mice are readily available, but the polymorphisms in clock genes in the human gene pool are orders of magnitude larger. Implementing a streamlined workflow for specific genome editing such as introducing SNPs or short mutations in MEFs derived from existing mutant mice would greatly facilitate mechanistic studies of diverse genetic conditions. The approach will be also valuable in other fields where non-transformed cell models such as MEFs are required.
To streamline specific genome editing in MEFs, we assessed the efficiency of generating the mPer1W448E and mPer2W19E mutations using the same sgRNA and repair templates in MEFs that we had used for CRISPR editing of mouse zygotes. To compare the efficiency in a quantitative manner and assess the downstream clonal isolation workload, ddPCR was performed on FACS-sorted positive cells after transfection of the reagents as described in Fig. 1a. In bulk MEFs transfected with the same sgRNA and ssODN for mPer1W448E mutation, ~ 3% of wt mPer1 were converted into the mutant allele (Fig. 4a). The efficiency was 5–6% for mPer2W419E (Fig. 4b). Although these numbers are significantly lower than those in mice, it is still very reasonable for researchers to successfully isolate desirable mutant clones by screening only a few dozen random clones using simple molecular techniques such as enzyme digestion of PCR amplicons as described above. To verify this efficiency in isolated MEF clones, some of the bulk positive cells above were singly sorted into 96 well plates and expanded for the PCR analysis followed by enzyme digestion. When we screened 15 clones each, 1 heterozygote clone for mPer1W448E and 1 heterozygote clone and 1 homozygote clone for mPer2W419E were isolated, roughly matching the ddPCR numbers (Fig. 4c,d). The ddPCR assay is also a powerful tool when CRISPR-HDR protocols are being optimized. Efficiency of HDR was greatly affected by the ratio of CRISPR plasmid to donor template in co-transfection (Fig. 4e).
Figure 4.
Digital PCR can be used for accurate quantification of specific genome editing in MEFs. (a,b) Frequency of two mPer mutations were quantified by ddPCR in MEFs transfected with the CRISPR reagents. ddPCR was performed on three independent samples each. (c,d) mPer mutant clones were successfully isolated from screening of 15 random clones each. Genomic DNA from these clones were amplified by PCR and digested with PleI (mPer1) and AvaI (mPer2). The original gels are presented in Fig. S8. (e) Digital PCR can be a powerful tool to optimize CRISPR-HDR protocols. Varying amounts of mPer1-HDR template and all-in-one Cas9-sgRNA plasmid were co-transfected into MEFs followed by FACS sorting. Genomic DNA from a homozygous mPer1 mutant mouse was used as a positive control. (f) PAS mutant mPER proteins show defective phosphorylation. Although both PER1 and PER2 mutants showed defective phosphorylation, mPer2W419E mutant is apparently more defective in phosphorylation. The original blots are presented in Fig. S7.
When PER proteins were probed in these mutant MEF clones, both PER proteins were dramatically less phosphorylated compared to control MEFs (Fig. 4f). Existing PER proteins are progressively phosphorylated when do novo translation is inhibited by cycloheximide (CHX). These data along with the data in Fig. S2 strongly suggest that PAS dimerization is critical for PER phosphorylation and probably for the clockwork as well. Because MEFs are not transformed cancer cells and thus are frequently used as an in vivo model, our data strongly support that MEFs can be an effective platform to study in vivo cell physiology, and this is even more compelling by already available numerous genetic mouse models.
Discussion
As with most biological fields, our current understanding of the circadian clock in mammals has been largely established by reverse genetics in mice that have led to identification of a dozen essential clock genes to date56. Although the mechanistic insights from these mutant mouse models cannot be overstated, the traditional mutant mouse models based on gene targeting by homologous recombination required tremendous resources and a long time (18–24 months) even to assess if desired mutant models were made. In that sense, CRISPR revolutionized how mutant animal models are generated. It is faster (~ 9 months) and much more affordable and efficient (Fig. 5). In addition, as in our work reported here, specific genome editing by CRISPR generated useful by-products such as knockouts and AA indels. Because these AA indels would disrupt the function of the motif more severely than the single AA mutation in the motif—and the larger the indel, the more severe the phenotype may be—these indel mutants along with the specific mutant animals would provide more complete or novel insights into the function of the motif and the whole protein. As in our study, compound heterozygotes would be the most predominant genotype with successful injection of CRISPR reagents and sgRNA efficiency. ddPCR assays are very useful for accurate genotyping of these compound heterozygotes, especially alleles with large indels. Although our ddPCR results suggest that there are no off-target KIs, there could be off-target indel mutations in our mice and MEFs, and this could affect circadian mechanisms. However, since homologous mutations were generated in two redundant genes using different gRNA, and phenotypes can be compared between the two mutants, off-target effects could be detected if there are any. New genome editing techniques such as Prime editing with pegRNA can dramatically decrease the likelihood of off-target mutations57.
Figure 5.
Timeline comparison in CRISPR-knockin mutation between mice and MEFs. Reasonable amounts of time for troubleshooting and optimization typical for a small laboratory are included in this timeline. Steps from injection of CRISPR reagents into fertilized eggs to producing pups are usually done by a dedicated animal facility. The rest of the animal work and all the work in MEFs can be done by an individual laboratory.
Cell culture models will continue to be an effective platform for studying molecular mechanisms in many biological pathways including circadian biology, given their time- and cost-efficiencies. Although the genome in cell culture models can be precisely edited using CRISPR-Cas9, it is also important to recognize such genome edited cell models are very rare in general. This may reflect that precise genome editing is still not practical in many small laboratories because HDR frequency is significantly lower than that of NHEJ, and thus it is challenging to isolate HDR clones out of much more abundant NHEJ mutant clones. Frequency of the specific mutation could be easily estimated by enzyme digestion followed by gel electrophoresis if a novel digestion site is added into the repair template, and the HDR frequency is high enough. However, we could not detect digested fragments from PCR amplicons prepared from genomic DNA of our bulk sorted MEFs on agarose gels. When HDR efficiency is 3–6% as in our bulk sorted cells, we believe the densitometric method is not sensitive enough to detect digested fragments on agarose gels. Next-generation sequencing (NGS) would be the gold standard for accurate quantification of HDR, but it is not practical especially when many mutant cell lines are generated, or HDR conditions are not yet optimized. Downstream work flow and effort would be greatly affected by the efficiency of HDR. For example, if the efficiency is ~ 0.1%, at least several hundreds of random clones need to be expanded and interrogated by PCR analysis and sequencing, which would not be practical. Digital PCR assays can be a powerful tool when a specific mutant cell clone needs to be isolated, because frequency of the mutation can be accurately measured from a heterogenous population of mutant clones, which will allow researchers to estimate the number of single clones to be analyzed to isolate a few desirable mutant clones or to optimize the conditions to increase HDR efficiency (Fig. 5).
As our understanding of many important biological pathways is becoming mature by identification of most of the essential genes, a next frontier in biology would be to learn how polymorphisms in these genes affect the pathways and physiology. For circadian biology, it has been already demonstrated that some of these polymorphisms are associated with circadian disorders such as Familial Advanced Sleep Phase Syndrome58,59. We believe our CRISPR method combined with ddPCR can be a streamlined process to generate any simple mutant KIs in MEFs to study human genetics, if relevant human physiology can be studied in MEFs like circadian biology.
Although we cannot generalize CRISPR efficiency for HDR in mice, available data suggest it is close to 100% if the sgRNA is properly selected, and reagents are successfully delivered. Considering this high efficiency, the short time frame from CRISPR design to obtaining founder mice, and the potential to generate combined mutations by breeding, it may be more practical to generate mutant mice rather than individual mutant cell clones in some cases. Mouse models are obviously more versatile since whole animal physiology can be studied in single and combined mutant mice as well as molecular mechanisms in diverse cells or tissues isolated from these mutant mice.
In summary, when the same sgRNA and HDR-template are used, HDR efficiency is dramatically higher in fertilized eggs compared to MEFs, and digital PCR is an extremely powerful tool for genotyping of these CRISPR mutant mice and for quantitative analysis of the mutation frequency if the genome editing is done in cells. Using our protocols, we believe that any simple mutant model can be efficiently generated in MEFs or other CRISPR-compatible cell lines, even in small laboratories, because implementation of ddPCR is fairly straightforward. The cost of the ddPCR equipment is nontrivial, but such instruments are becoming increasingly available. Thus, our cell-based methodology may facilitate faster and higher throughput studies of genetic polymorphisms in the circadian system and in other areas of biology.
Materials and methods
Experiments in U2OS and HEK293 cell lines
Isolation of mutant Per1 and Per2 clones in U2OS cells
~ 30 clones from the above FACS-sorted cells were expanded and subjected to immunoblotting for PER to select in-frame mutant clones. Positive clones were identified by aberrant mobility of PER and confirmed by TA cloning followed by Sanger sequencing. The results are shown below.
| wtPER1: GEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAPSLDTD |
|
#7 Allele1: GEYVTMDTSWAGFVHP-----------------------------SPAPSLDTD Allele2: frameshift mutation |
|
#16 Allele1: GEYVTMDTSWAGFV----------LGRHKVRTAPLNEDVFTPPAPSPAPSLDTD Allele2: frameshift mutation |
| wtPER2: RARNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVF |
|
#2 Allele1: RARNGEYITLD--------------SFIIGRHKVRVGPLNEDVF Allele2: frameshift mutation |
|
#5 Allele1: RARNGEYITLDTSWSSF--PWSRKISFIIGRHKVRVGPLNEDVF Allele2: frameshift mutation |
|
#8 Allele1: RARNGEYITLDTSWSSFIN---RKISFIIGRHKVRVGPLNEDVF Allele2: frameshift mutation |
Experiments in mice and MEFs
Generation of mutant mice and genotyping
All mice were maintained in a climate-controlled room and used according to the Florida State University Animal Use Committee’s guidelines. All experiments involving animals were performed according to approved protocols by FSU ACUC, protocol number: 202200000021. All methods are reported in accordance with ARRIVE guidelines. We used about equal numbers of male and female mice.
Injection of ribonucleoprotein complex and ssODNs into one-day fertilized eggs, and generation of pups from pseudopregnant mice were done in the C57BL/6J strain at the UT Southwestern Medical Center core facility according to approved protocols by UTSW ACUC. Briefly, crRNA (IDT, Inc.) and tracrRNA were annealed and mixed with Cas9 protein to form a ribonucleotide protein complex. The ssODN (IDT, Inc.) was added to the mix and the cocktail was microinjected into the cytoplasm of fertilized one-cell eggs isolated from superovulated females. The eggs were incubated in media containing cytochalasin-B immediately before and during microinjection to improve egg survival. Alternatively, CRISPR reagents were delivered to the cytoplasm via electroporation using the Gene Pulser (BioRad, Hercules, CA, USA). The surviving eggs were transferred into the oviducts of day 0.5 pseudopregnant recipient ICR females (Envigo, Inc.) to produce putative founder mice. See below for breakdowns of CRISPR delivery methods and results.
Founder mice (F0) were identified via PCR using the primers described below. Tail tissues from F0 mice were obtained when these mice were weaned at 3 weeks old. PCR amplicons were run on both polyacrylamide gels (PAGE) and agarose gels, digested with PleI (NEB Inc.) for mPer1genotyping and AvaI (NEB Inc.) for mPer2 genotyping and sequenced. In the majority of the clones, two different Sanger sequencing traces were mixed due to different indels and/or the HDR mutation in two alleles. These results were deconvoluted by a computer algorithm called DECODR v3 (https://decodr.org/) into two separate traces. Accuracy of the deconvolution was confirmed by TA cloning if the decoding results were ambiguous (see DECODR vs TA cloning in Supplementary uncropped images and raw data). TA cloning was performed according to the manufacturer’s protocol (ThermoFisher K4575) and more than 8 clones per sample were sequenced.
Guide RNA
gRNA for mPer1: aaagccaccttgcggctccagRNA for mPer2: ggtccagcttcatcaacccg.
PCR primers for T7E1 and genotyping
| Assay | Gene | Primers | Size of amplicon | |
|---|---|---|---|---|
| Genotyping | mPer1 | CCCATTCACTGATACCCACTTT | AAGGAGAACTCAGTCCTTTCCC | 275 |
| Genotyping | mPer2 | TTCGATTATTCTCCCATTCGAT | GAGAGGTGAGAATAGGCCAAAA | 193 |
| Genotyping-large | mPer2 | GATCTGATCGAGACGCCTGTG | ATGGCTGCAACACAGACGAT | 1156 |
| T7E1 | mPer1 | CCCATTCACTGATACCCACTTT | AAGGAGAACTCAGTCCTTTCCC | 275 |
| T7E1 | mPer2 | TTCGATTATTCTCCCATTCGAT | GAGAGGTGAGAATAGGCCAAAA | 193 |
For Fig. S3a, the genotyping-large primers were used to generate a large amplicon, ~ 1.2 kb.
ssODN sequence
mPer1: CctgcgcccacagTACTGCAGCTGGCAGGCCAGCCCTTTGACCATTCCCCTATTCGCTTCTGTGCTCGGAACGGGGAATATGTCACCATGGACACCAGCTGGGCCGGTTTTGTGCACCCC gaGAGtCGgAAGGTGGCTTT CGTGTTGGGTCGCCATAAAGTGCGCACgtaagggaactgtg.mPer2: ttgccccctgctgtgagaggtgagaataggccaaaatcccccaaaacccacagagtggaaccctgggagcactcacACCCTGACTTTGTGCCTCCCAATGATGAAAGATATCTTCCTGCTCtcgGGGTTGATGAAGCTGGACCAGCTAGTGTCCAGTGTGATGTACTCCCCGTTGCGGGTGCGG.
Methods for delivery of CRISPR reagents and outcomes
| Construct | Embryos electroporated | Embryos transferred | Females transferred | Females pregnant | Litter at birth | Pups surviving |
|---|---|---|---|---|---|---|
| BioRad electroporations | ||||||
| Per1 | 369 | 369 | 11 | 11 | 72 | 62 |
| Per2 | 184 | 170 | 5 | 4 | 33 | 28 |
| Cytoplasm injections | ||||||
| Per1 | 102 | 93 | 3 | 2 | 18 | 17 |
| Per2 | 335 | 304 | 9 | 8 | 78 | 63 |
| Method | Cas9 Protein (IDT) (ng/ul) | sgRNA (ng/ul) | Repair template (ng/ul) | |||
|---|---|---|---|---|---|---|
| Reagent concentrations | ||||||
| Electroporations | 400 | 300 | 400 | |||
| Cytoplasm Injections | 50 | 50 | 50 | |||
Founder mice were tested for mosaicism and germline transmission by measuring and comparing alleles between F0 and F1 born from mating between F0 and wt mice. For all F0 mice used for breeding, there was 100% germline transmission and one identified mosaic mouse.
| mPer1 | F0 x wt | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| F0-tail | F1-I | F1-II | |||||||||
| ID | Allele 1 | Allele 2 | Allele 1 | Allele 2 | n | Allele 1 | Allele 2 | n | |||
| 6 | W448E | W448E | W448E | WT | 4 | ||||||
| 7 | W448E | W448E | W448E | WT | 8 | ||||||
| 12 | W448E | W448E | W448E | WT | 2 | ||||||
| 13 | W448E | 60 del | W448E | WT | 2 | 60 del | WT | 3 | |||
| 16 | 14 del | 72 del | 14 del | WT | 4 | 72 del | WT | 5 | |||
| 27 | W448E | W448E | W448E | WT | 7 | ||||||
| 34 | W448E | 14 del | W448E | WT | 4 | 14 del | WT | 4 | |||
| 41 | 3 del | Large del | 3 del | WT | 5 | Large del | WT | 2 | |||
| 35 | 9 del | 1 del | 9 del | WT | 4 | 1 del | WT | 2 | |||
| 71 | W448E | W448E | W448E | WT | 5 | ||||||
| Mosaic mouse | F1-I | F1-II | F1-III | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| 53 | 3 del | WT | 3 del | WT | 5 | WT | WT | 4 | W448E | WT | 3 |
| mPer2 | F0 x wt | |||||||
|---|---|---|---|---|---|---|---|---|
| F0-tail | F1-I | F1-II | ||||||
| ID | Allele 1 | Allele 2 | Allele 1 | Allele 2 | n | Allele 1 | Allele 2 | n |
| 94 | 190 del | 18 del | 190 del | WT | 4 | 18 del | WT | 2 |
| 98 | 6 del | Large del | 6 del | WT | 2 | Large del | WT | 6 |
| 97 | W419E | WT | W419E | WT | 5 | WT | WT | 3 |
| 100 | W419E | 21del (413–419) | W419E | WT | 6 | 21del (413–419) | WT | 2 |
| 103 | W419E | Large del | W419E | WT | 4 | Large del | WT | 4 |
| 106 | W419E | Large del | W419E | WT | 2 | Large del | WT | 6 |
| 136 | W419E | WT | W419E | WT | 4 | WT | WT | 1 |
| 162 | W419E | 30 del | W419E | WT | 1 | |||
T7E1 assays and isolation of HDR mutant clones in mPer2Luc MEFs
For transfection in MEFs, cells were prepared as described above. 900 ng of all-in-one plasmids were used for Fig. 1, and 900 ng all-in-one plasmids + 300 ng repair templates were used for HDR mutations. For Fig. 4e, 300 + 900 (1), 600 + 600 (2) and 900 + 300 (3) ng DNA were used for varying amounts of all-in-one plasmid to repair template, respectively. Single clones were identified by immunoblotting and sequencing as described above.
Experiments in droplet digital PCR (ddPCR)
Droplet digital PCR reagents were purchased from Bio-Rad and reactions were set up as follows. Relevant info according to the 2020 Minimum Information for Publication of Quantitative Digital PCR Experiments (MIQE) guidelines60 is reported in the manuscript and summarized in Table 7 in Supplementary uncropped images and raw data.
| Component | Volume per reaction, μl | Final concentration |
|---|---|---|
| 2× ddPCR Supermix for Probes (No dUTP) 186–3023 | 12.5 | 1× |
| 20× Per HDR Assay (FAM) | 1.5 | 900 nM (primer)/250 nM(probe) |
| 20× RPP30 Assay (HEX) | 1.5 | 900 nM (primer)/250 nM (probe) |
| HindIII | 0.6 | – |
| Genomic DNA | 1 (14.25 ng)* | 5000 copies/μl |
| RNase/DNASE-free water | 7.9 | – |
| Total volume | 25 | – |
*14.25 ng is equal to ~ 5000 copies of a mouse allele. gDNA was dissolved in deionized water and aliquoted and stored at − 80 °C after concentration was measured by Nanodrop.
The following primers and probes were used.ddPCR assay primers:
| Genes | Forward primers | Reverse primers | Products (bp) |
|---|---|---|---|
| mPer1 (in–out) | TGACCATTCCCCTATTCGCTT | CCATGCCATGTCCATACCAC | 186 |
| mPer1 (in-in) | CCCCTATTCGCTTCTGTGCT | TTACGTGCGCACTTTATGGC | 125 |
| mPer2 (in–out) | TTCGATTATTCTCCCATTCGAT | GAGAGGTGAGAATAGGCCAAAA | 193 |
| mPer2 (in-in) | CTCCCATTCGATTCCGCACC | GAGCACTCACACCCTGACTT | 131 |
| mRPP30 | AAGAAACCACGGCCATCAGAAG | GGGTTTTATTTGCTGTTTTAATGGTC | 231 |
Before selecting final probes, specificity and efficiency of several candidate probes were tested.ddPCR probes:
mPer1_W448 ddPCR wild-type probe: ACCCCTGGAGCCGCAAGGT (/56-FAM/ACCCCTGGA/ZEN/GCCGCAAGGT/3IABkFQ/).
mPer1_W448E ddPCR mutant probe: ACCCCGAGAGTCGGAAGGT (/56-FAM/ACCCCGAGA/ZEN/GTCGGAAGGT/3IABkFQ/).
mPer2_W419 ddPCR wild-type probe: TTCCTGCTCCACGGGTTGA (/56-FAM/TTCCTGCTC/ZEN/CACGGGTTGA/3IABkFQ/).
mPer2_W419E ddPCR mutant probe: AGCTTCATCAACCCCGAGAG (/56-FAM/AGCTTCATC/ZEN/AACCCCGAGAG/3IABkFQ/).
mRpp30 reference probe: CTGCCTCCTCCCCTTCGTAG (/5HEX/CTGCCTCCT/ZEN/CCCCTTCGTAG/3IABkFQ/).
Droplets were generated from 20 μl of the samples and subjected to thermal cycles as follows. Annealing temperature was tested at 55–65 °C to optimize clear droplet separation.
| Cycling Step | Temperature °C | Time | Ramp Rate | # of cycles |
|---|---|---|---|---|
| Enzyme Activation | 95 | 10 min | 2 °C/s | 1 |
| Denaturation | 94 | 30 s | 40 | |
| Annealing/Extension | 55 | 1 min | 40 | |
| Enzyme Deactivation | 98 | 10 min | 1 | |
| Hold (optional) | 4 | Infinite | 1 |
After the PCR amplification, the plate was transferred into the Bio-Rad QX-100 Droplet Reader. All assays were analyzed using the QX200 droplet reader and Quantasoft analysis pro (Bio-Rad).
Average number of droplets was about 16,000 partitions in a total volume of 20 μl. It corresponds to a droplet volume of 1.25 nl.
LoB and LoD of ddPCR assays
An average false positive rate (AFP) was measured from 38 negative samples. A total of 24 false-positive droplets were detected in 38 reactions (AFP = 0.71). 97.4% of the reactions (37/38) contained < 4 false positive droplets, while 89.5% of the reactions (33/37) contained < 3 false positive droplets. The LoB was calculated and set at 3 to maintain an α error lower than 5%. α error indicates that the chance of detected false positive droplet counts in a negative control sample is greater than LoB. The LoD was calculated and set at 8 to maintain a β error lower than 5%. β error indicates that the probability of detected droplet counts is lower than LoB when a sample is prepared at the LoD61.
Supplementary Information
Acknowledgements
The authors thank Dennis Chang for assistance with manuscript preparation. They thank Dr. Joseph Takahashi for arranging to use the transgenic core facility at UT Southwestern Medical Center. This work was supported by NIH R01 GM131283 (C.L.).
Author contributions
K.L and C.L. planned and performed the experiments. K.L. and C.L. wrote the manuscript.
Data availability
All data generated or analysed during this study are included in this published article and its Supplementary Information files.
Competing interests
The authors declare no competing interests.
Footnotes
Publisher's note
Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Supplementary Information
The online version contains supplementary material available at 10.1038/s41598-023-35203-7.
References
- 1.Garneau JE, et al. The CRISPR/Cas bacterial immune system cleaves bacteriophage and plasmid DNA. Nature. 2010;468:67–71. doi: 10.1038/nature09523. [DOI] [PubMed] [Google Scholar]
- 2.Jinek M, et al. A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science. 2012;337:816–821. doi: 10.1126/science.1225829. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Gasiunas G, Barrangou R, Horvath P, Siksnys V. Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria. Proc. Natl. Acad. Sci. U.S.A. 2012;109:E2579–E2586. doi: 10.1073/pnas.1208507109. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Ran FA, et al. Genome engineering using the CRISPR-Cas9 system. Nat. Protoc. 2013;8:2281–2308. doi: 10.1038/nprot.2013.143. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Cong L, et al. Multiplex genome engineering using CRISPR/Cas systems. Science. 2013;339:819–823. doi: 10.1126/science.1231143. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Komor AC, Badran AH, Liu DR. CRISPR-based technologies for the manipulation of eukaryotic genomes. Cell. 2017;169:559. doi: 10.1016/j.cell.2017.04.005. [DOI] [PubMed] [Google Scholar]
- 7.Cermak T, et al. Efficient design and assembly of custom TALEN and other TAL effector-based constructs for DNA targeting. Nucleic Acids Res. 2011;39:e82. doi: 10.1093/nar/gkr218. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Wood AJ, et al. Targeted genome editing across species using ZFNs and TALENs. Science. 2011;333:307. doi: 10.1126/science.1207773. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Hille F, et al. The biology of CRISPR-Cas: Backward and forward. Cell. 2018;172:1239–1259. doi: 10.1016/j.cell.2017.11.032. [DOI] [PubMed] [Google Scholar]
- 10.Wang H, La Russa M, Qi LS. CRISPR/Cas9 in genome editing and beyond. Annu. Rev. Biochem. 2016;85:227–264. doi: 10.1146/annurev-biochem-060815-014607. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Senis E, et al. CRISPR/Cas9-mediated genome engineering: An adeno-associated viral (AAV) vector toolbox. Biotechnol. J. 2014;9:1402–1412. doi: 10.1002/biot.201400046. [DOI] [PubMed] [Google Scholar]
- 12.Schmidt F, Grimm D. CRISPR genome engineering and viral gene delivery: A case of mutual attraction. Biotechnol. J. 2015;10:258–272. doi: 10.1002/biot.201400529. [DOI] [PubMed] [Google Scholar]
- 13.Kabadi AM, Ousterout DG, Hilton IB, Gersbach CA. Multiplex CRISPR/Cas9-based genome engineering from a single lentiviral vector. Nucleic Acids Res. 2014;42:e147. doi: 10.1093/nar/gku749. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14.Ehrke-Schulz E, et al. CRISPR/Cas9 delivery with one single adenoviral vector devoid of all viral genes. Sci. Rep. 2017;7:17113. doi: 10.1038/s41598-017-17180-w. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Voets O, et al. Highly efficient gene inactivation by adenoviral CRISPR/Cas9 in human primary cells. PLoS ONE. 2017;12:e0182974. doi: 10.1371/journal.pone.0182974. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16.Maggio I, et al. Adenoviral vector delivery of RNA-guided CRISPR/Cas9 nuclease complexes induces targeted mutagenesis in a diverse array of human cells. Sci. Rep. 2014;4:5105. doi: 10.1038/srep05105. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Jin YH, et al. Streamlined procedure for gene knockouts using all-in-one adenoviral CRISPR-Cas9. Sci. Rep. 2019;9:277. doi: 10.1038/s41598-018-36736-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Maruyama T, et al. Increasing the efficiency of precise genome editing with CRISPR-Cas9 by inhibition of nonhomologous end joining. Nat. Biotechnol. 2015;33:538–542. doi: 10.1038/nbt.3190. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Wang L, et al. Enhancing targeted genomic DNA editing in chicken cells using the CRISPR/Cas9 system. PLoS ONE. 2017;12:e0169768. doi: 10.1371/journal.pone.0169768. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Gutschner T, Haemmerle M, Genovese G, Draetta GF, Chin L. Post-translational regulation of Cas9 during G1 enhances homology-directed repair. Cell Rep. 2016;14:1555–1566. doi: 10.1016/j.celrep.2016.01.019. [DOI] [PubMed] [Google Scholar]
- 21.Richardson CD, Ray GJ, DeWitt MA, Curie GL, Corn JE. Enhancing homology-directed genome editing by catalytically active and inactive CRISPR-Cas9 using asymmetric donor DNA. Nat. Biotechnol. 2016;34:339–344. doi: 10.1038/nbt.3481. [DOI] [PubMed] [Google Scholar]
- 22.Chen F, et al. High-frequency genome editing using ssDNA oligonucleotides with zinc-finger nucleases. Nat. Methods. 2011;8:753–755. doi: 10.1038/nmeth.1653. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23.Schubert MS, et al. Optimized design parameters for CRISPR Cas9 and Cas12a homology-directed repair. Sci. Rep. 2021;11:19482. doi: 10.1038/s41598-021-98965-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Reppert SM, Weaver DR. Coordination of circadian timing in mammals. Nature. 2002;418:935–941. doi: 10.1038/nature00965. [DOI] [PubMed] [Google Scholar]
- 25.Schibler U. The daily rhythms of genes, cells and organs. Biological clocks and circadian timing in cells. EMBO Rep. 2005;6:S9–S13. doi: 10.1038/sj.embor.7400424. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26.Bell-Pedersen D, et al. Circadian rhythms from multiple oscillators: Lessons from diverse organisms. Nat. Rev. Genet. 2005;6:544–556. doi: 10.1038/nrg1633. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27.Mohawk JA, Green CB, Takahashi JS. Central and peripheral circadian clocks in mammals. Annu. Rev. Neurosci. 2012;35:445–462. doi: 10.1146/annurev-neuro-060909-153128. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Harmer SL, Panda S, Kay SA. Molecular bases of circadian rhythms. Annu. Rev. Cell Dev. Biol. 2001;17:215–253. doi: 10.1146/annurev.cellbio.17.1.215. [DOI] [PubMed] [Google Scholar]
- 29.Green CB, Takahashi JS, Bass J. The meter of metabolism. Cell. 2008;134:728–742. doi: 10.1016/j.cell.2008.08.022. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Drake CL, Roehrs T, Richardson G, Walsh JK, Roth T. Shift work sleep disorder: Prevalence and consequences beyond that of symptomatic day workers. Sleep. 2004;27:1453–1462. doi: 10.1093/sleep/27.8.1453. [DOI] [PubMed] [Google Scholar]
- 31.Bass J, Takahashi JS. Circadian integration of metabolism and energetics. Science. 2010;330:1349–1354. doi: 10.1126/science.1195027. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.Zhu L, Zee PC. Circadian rhythm sleep disorders. Neurol. Clin. 2012;30:1167–1191. doi: 10.1016/j.ncl.2012.08.011. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Musiek ES, et al. Circadian clock proteins regulate neuronal redox homeostasis and neurodegeneration. J. Clin. Investig. 2013;123:5389–5400. doi: 10.1172/JCI70317. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 34.Patke A, Young MW, Axelrod S. Molecular mechanisms and physiological importance of circadian rhythms. Nat. Rev. Mol. Cell Biol. 2020;21:67–84. doi: 10.1038/s41580-019-0179-2. [DOI] [PubMed] [Google Scholar]
- 35.Potter GD, et al. Circadian rhythm and sleep disruption: Causes, metabolic consequences, and countermeasures. Endocr. Rev. 2016;37:584–608. doi: 10.1210/er.2016-1083. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 36.Yoo SH, et al. PERIOD2::LUCIFERASE real-time reporting of circadian dynamics reveals persistent circadian oscillations in mouse peripheral tissues. Proc. Natl. Acad. Sci. U.S.A. 2004;101:5339–5346. doi: 10.1073/pnas.0308709101. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Chen R, et al. Rhythmic PER abundance defines a critical nodal point for negative feedback within the circadian clock mechanism. Mol. Cell. 2009;36:417–430. doi: 10.1016/j.molcel.2009.10.012. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38.Liu AC, Lewis WG, Kay SA. Mammalian circadian signaling networks and therapeutic targets. Nat. Chem. Biol. 2007;3:630–639. doi: 10.1038/nchembio.2007.37. [DOI] [PubMed] [Google Scholar]
- 39.Maier B, et al. A large-scale functional RNAi screen reveals a role for CK2 in the mammalian circadian clock. Genes Dev. 2009;23:708–718. doi: 10.1101/gad.512209. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40.Yamazaki S, et al. Resetting central and peripheral circadian oscillators in transgenic rats. Science. 2000;288:682–685. doi: 10.1126/science.288.5466.682. [DOI] [PubMed] [Google Scholar]
- 41.D'Alessandro M, et al. Stability of wake-sleep cycles requires robust degradation of the PERIOD protein. Curr. Biol. 2017;27:3454–3467. doi: 10.1016/j.cub.2017.10.014. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 42.Xu H, et al. Cryptochrome 1 regulates the circadian clock through dynamic interactions with the BMAL1 C terminus. Nat. Struct. Mol. Biol. 2015;22:476–484. doi: 10.1038/nsmb.3018. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Park N, et al. A Novel Bmal1 mutant mouse reveals essential roles of the C-terminal domain on circadian rhythms. PLoS ONE. 2015;10:e0138661. doi: 10.1371/journal.pone.0138661. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44.Korge S, Grudziecki A, Kramer A. Highly efficient genome editing via CRISPR/Cas9 to create clock gene knockout cells. J. Biol. Rhythms. 2015;30:389–395. doi: 10.1177/0748730415597519. [DOI] [PubMed] [Google Scholar]
- 45.Lu C, et al. Role of circadian gene clock during differentiation of mouse pluripotent stem cells. Protein Cell. 2016;7:820–832. doi: 10.1007/s13238-016-0319-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46.Matsu-Ura T, Baek M, Kwon J, Hong C. Efficient gene editing in Neurospora crassa with CRISPR technology. Fungal Biol. Biotechnol. 2015;2:4. doi: 10.1186/s40694-015-0015-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 47.Kim B, et al. Multiplexed CRISPR-Cas9 system in a single adeno-associated virus to simultaneously knock out redundant clock genes. Sci. Rep. 2021;11:2575. doi: 10.1038/s41598-021-82287-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 48.Vogt JH, Schippers JH. Setting the PAS, the role of circadian PAS domain proteins during environmental adaptation in plants. Front. Plant Sci. 2015;6:513. doi: 10.3389/fpls.2015.00513. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 49.Pudasaini A, Zoltowski BD. Zeitlupe senses blue-light fluence to mediate circadian timing in Arabidopsis thaliana. Biochemistry. 2013;52:7150–7158. doi: 10.1021/bi401027n. [DOI] [PubMed] [Google Scholar]
- 50.Kucera N, et al. Unwinding the differences of the mammalian PERIOD clock proteins from crystal structure to cellular function. Proc. Natl. Acad. Sci. U.S.A. 2012;109:3311–3316. doi: 10.1073/pnas.1113280109. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 51.Hennig S, et al. Structural and functional analyses of PAS domain interactions of the clock proteins Drosophila PERIOD and mouse PERIOD2. PLoS Biol. 2009;7:e94. doi: 10.1371/journal.pbio.1000094. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 52.Gabriel CH, et al. Live-cell imaging of circadian clock protein dynamics in CRISPR-generated knock-in cells. Nat. Commun. 2021;12:3796. doi: 10.1038/s41467-021-24086-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53.Suchy FP, et al. Streamlined and quantitative detection of chimerism using digital PCR. Sci. Rep. 2022;12:10223. doi: 10.1038/s41598-022-14467-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54.Ota S, et al. Efficient identification of TALEN-mediated genome modifications using heteroduplex mobility assays. Genes Cells. 2013;18:450–458. doi: 10.1111/gtc.12050. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 55.Barros P, Blanco MG, Boan F, Gomez-Marquez J. Heteroduplex analysis of minisatellite variability. Electrophoresis. 2005;26:4304–4309. doi: 10.1002/elps.200500296. [DOI] [PubMed] [Google Scholar]
- 56.Partch CL, Green CB, Takahashi JS. Molecular architecture of the mammalian circadian clock. Trends Cell Biol. 2014;24:90–99. doi: 10.1016/j.tcb.2013.07.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 57.Anzalone AV, et al. Search-and-replace genome editing without double-strand breaks or donor DNA. Nature. 2019;576:149–157. doi: 10.1038/s41586-019-1711-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 58.Toh KL, et al. An hPer2 phosphorylation site mutation in familial advanced sleep phase syndrome. Science. 2001;291:1040–1043. doi: 10.1126/science.1057499. [DOI] [PubMed] [Google Scholar]
- 59.Xu Y, et al. Functional consequences of a CKIdelta mutation causing familial advanced sleep phase syndrome. Nature. 2005;434:640–644. doi: 10.1038/nature03453. [DOI] [PubMed] [Google Scholar]
- 60.Huggett JF. The digital MIQE guidelines update: Minimum information for publication of quantitative digital PCR experiments for 2020. Clin. Chem. 2020;66:1012–1029. doi: 10.1093/clinchem/hvaa125. [DOI] [PubMed] [Google Scholar]
- 61.Milbury CA, et al. Determining lower limits of detection of digital PCR assays for cancer-related gene mutations. Biomol. Detect. Quant. 2014;1:8–22. doi: 10.1016/j.bdq.2014.08.001. [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Supplementary Materials
Data Availability Statement
All data generated or analysed during this study are included in this published article and its Supplementary Information files.





