Skip to main content
Plants logoLink to Plants
. 2023 Jun 2;12(11):2202. doi: 10.3390/plants12112202

Identification of Potential Phytochemical/Antimicrobial Agents against Pseudoperonospora cubensis Causing Downy Mildew in Cucumber through In-Silico Docking

Nagaraju Jhansirani 1, Venkatappa Devappa 1,*, Chittarada Gopal Sangeetha 1, Shankarappa Sridhara 2, Kodegandlu Subbanna Shankarappa 1, Mooventhiran Mohanraj 1
Editors: Bianca Furdui, Rodica-Mihaela Dinicǎ
PMCID: PMC10255482  PMID: 37299181

Abstract

Compatibility interactions between the host and the fungal proteins are necessary to successfully establish a disease in plants by fungi or other diseases. Photochemical and antimicrobial substances are generally known to increase plant resilience, which is essential for eradicating fungus infections. Through homology modeling and in silico docking analysis, we assessed 50 phytochemicals from cucumber (Cucumis sativus), 15 antimicrobial compounds from botanical sources, and six compounds from chemical sources against two proteins of Pseudoperonospora cubensis linked to cucumber downy mildew. Alpha and beta sheets made up the 3D structures of the two protein models. According to Ramachandran plot analysis, the QNE 4 effector protein model was considered high quality because it had 86.8% of its residues in the preferred region. The results of the molecular docking analysis showed that the QNE4 and cytochrome oxidase subunit 1 proteins of P. cubensis showed good binding affinities with glucosyl flavones, terpenoids and flavonoids from phytochemicals, antimicrobial compounds from botanicals (garlic and clove), and chemically synthesized compounds, indicating the potential for antifungal activity.

Keywords: phytochemicals, antimicrobial compounds, homology modeling, molecular docking

1. Introduction

The cucumber crop is widely grown in temperate and tropical regions of the world. It stands in fourth position after tomato (Lycopersicon esculentum Mill.), cabbage (Brassica oleracea var. capitata L.) and onion (Allium cepa L.). Cucumber has been considered an essential food source for over 5000 years and is used in culinary and non-culinary products. Fresh fruits are used in salads, pickles, cakes, and cooking. At the same time, processed cucumbers are used in sandwiches. Based on usage, cucumber fruits are divided into two types. “Pickling cucumbers” are mainly used in processing foods such as pickles. “Slicing cucumbers” are used for fresh consumption. Cucumbers are widely used as edible fruits because fruits are crispy, delicious, low in calories, rich in nutrients, and an excellent source of fiber needed for a healthy digestive system. The fruits of cucumbers possess several medicinal properties, namely, preventing constipation, having a cooling effect, and checking jaundice and indigestion [1,2,3,4]. Along with these, the consumption of cucumbers also provides good nutritional benefits to human beings. Every 100 g of cucumber fruit contributes 5 g of carbohydrates, 0.4 g of protein, 0.1 g of fat, 0.3 g of minerals, 10 mg of calcium, 0.4 g of fiber, and traces of vitamin C and iron. Cucumbers are a boon to the cosmetic industry. Many cosmetic products contain cucumber extracts, such as soaps, lotions, creams, and perfumes. In addition, the seeds of cucumbers are used in Ayurvedic preparations [5].

At the global level, about 397 million tons of cucumber were produced from 2,261,318 hectares of land, with average productivity of approximately 19.58 t/ha [6]. In India, 105 metric tons of cucumber was produced from an area of 1673 hectares [7]. Cucumbers are cultivated in several parts of India (Uttar Pradesh, Punjab, Rajasthan, Karnataka, and Andhra Pradesh). Cucumber is prone to several diseases like downy mildew, powdery mildew, fungal and bacterial wilts, and viral infections (cucumber mosaic virus, watermelon bud necrosis virus). It causes more economic losses with regard to production and export. Among these, downy mildew is a primary foliar disease that causes more damage and devastating losses to cucumber production [8].

Fungal diseases affect the quality and yield of crops. As one of the agricultural-limiting diseases, downy mildew on cucumber caused by P. cubensis significantly affects cucumber production. Cucumber downy mildew is reported to be found in more than 70 countries around the world. Cucumber downy mildew reduces cucumber yield by 10–20%, or even as much as 40%, without adequate control [9]. Management of P. cubensis is challenging because it can overcome the control measures (resistance and fungicide application) very quickly and has long-distance dispersal capacity. More usage of fungicides creates environmental pollution and health hazards. Usually, plants produce primary (proteins and polysaccharides) and secondary metabolites (alkaloids and flavonoids) that play an essential role in defense mechanisms. Phytochemical and antimicrobial compounds are known to boost resistance in plants [10]. Antimicrobial compounds and phytochemicals boost plant defenses by neutralizing fungal effector proteins [11]. Nowadays, researchers are focusing on finding potential phytochemicals or antimicrobial compounds against many plant diseases.

The effector proteins manipulate the structure, signaling, and metabolism of the host plant. Oomycetes produce effector proteins and virulence genes for pathogenesis [9]. Recent studies on the genome sequencing of P. cubensis and in silico analysis identified the effector proteins which play a role in the pathogenicity or virulence of P. cubensis infection. The genome sequencing of P. cubensis revealed the presence of 61 effector proteins with sequence similarity to the RXLR motif. The RXLR motif is an effector identified in the oomycetes of P. cubensis, the QXLR motif contains an effector designated as QNE. This effector protein plays a major role in the pathogenicity of P. cubensis. Genome sequencing of Pythium insidiosum revealed the involvement of four genes in pathogenesis viz., Exo-1, 3-beta glucanase, chitin synthase, and cytochrome oxidase subunit 1 [12].

Botanicals have anti-microbial properties and are used against many pathogens, including plant-pathogenic fungi and bacteria. The active compounds or chemical constituents of the botanicals act against pathogens. The botanicals used in this study, i.e., neem, tulsi, pudina, clove, and garlic are good sources of anti-microbial compounds and are used against many fungal pathogens, especially the oomycetes of fungi [13,14,15,16,17]. Binding interactions between two proteins of P. cubensis and ligands derived from C. sativus (L.), Syzygium aromaticum (L.) Merr. and L.M. Perry, Ocimum tenuiflorum (L.), Allium cepa (L.), Mentha arvensis (L.), and Azadirachta indica Juss, and fungicides viz., azoxystrobin, ridomil, kresoxim methyl, curzate and SAR inducers oxalic acid and salicylic acid were studied. Afterwards, molecular docking was carried out using 71 ligands (50 compounds from phytochemicals, 15 antimicrobial compounds, four fungicides, and two SAR inducers) with proteins as receptor targets.

The present study focused on the potentiality of phytochemicals present in C. sativus and antimicrobial compounds present in different botanicals which are easily available in the area of research conducted, namely garlic, clove, tulsi, mentha and neem, and chemically synthesized compounds against two proteins of P. cubensis associated with downy mildew of cucumber through homology modeling, in silico docking, and in vitro evaluation of botanicals against P. cubensis.

2. Material and Methods

2.1. Homology Modeling

The protein sequences of P. cubensis were downloaded from NCBI using accession numbers (Table 1). The protein modeling for protein sequences was carried out by using SWISS-MODEL (https://swissmodel.expasy.org) (accessed on 25 March 2021) [18] and the I-TASSER server. The templates were selected from the template identification wizard of SWISS-MODEL and later models were built. The output file was obtained in a PDB format that was used to visualize the model in PyMOL version 2.3 [19].

The SAVES-Procheck server (https://servicesn.mbi.ucla.edu/SAVES) (accessed on 28 March 2021) [20] was used to evaluate model quality with Procheck, errat, and verified by 3D Qmean plot. Then, the Ramachandran plot was obtained by Procheck in order to evaluate the model. ProtParam from the EXPASY server (www.expasy.ch/tools) (accessed on 28 March 2021) was [21] used to obtain the physicochemical properties of proteins like theoretical Isoelectric Point (PI), molecular mass, amino acid composition, atomic composition, extinction coefficient, instability index, estimated half-life and aliphatic index.

Table 1.

Protein sequences retrieved from National Centre for Biotechnology Information (NCBI).

Sl. No. Sequence Description Length of Proteins Sequence of Amino Acids
1 Cytochrome oxidase subunit 1
of P. cubensis
(Accession No. AEA38564.1)
412 MNFQNIKNWSTRWLFSTNHKDIGTXYLIFSAFAGIVGTTLSILIRIELAQPGNQIFMGNHQLYNVVVTAHAFVMVFFLVMPALIGGFGNWFVPLMIGAPDMAFPRMNNISFWLLPPALLLLISSAIVESGAGTGWAVYPPLSSVQAHSGPSVDLAIFSLHLTGISSLLGAINFISTIYNMRAPGLSFHRLPLFVWSILITAFLLLLTLPVLAGAITMLLTDRNLNTSFYDPSGGGDPVLYQHLFWFFGHPEVYVLILPAFGIISQVSAYFAKKNVFGYLGMVYAMLSIGLLGSIVWAHHMFTVGLDVDTRAYFSAATMIIAVPTGIKIFSWLATLWGGSLKFETPLLFTLGFILLFVMGGVTGVVMSNSGLDIALHDTYYIVGHFHYVLSMGAIFGIFTGFYFWIGKISGRR
2 QNE 4 effector protein P. cubensis
(Accession No. ADW27474.1)
517 MMPPAKLVAYIAVASSIVLARYEASTDITSTSDANKLSISAPSDPVQHDTKQLLRTSDTAVTKDNEERMFNAAGLKRASTMSHFADVHGLPHEPLAPHLHDTYDPAGASHPPVLPYTGEAKAHEDLQHAASTSNPLKKISPADTQLTEGENNEAEILKRIMTLMQPVAPRALKRKRKLPDGTETQLQWNESDILDIYEKHKDKFLNIMNEWWLNGLGPQAFERMILENQLPTSIYEDYVMFHAAKDEEMYEHFAKWQNEGILPKEIEEKINAVLPKARKAPLVVRLENKYEVFYKKKQPFEAYRTKLLDEDTEPEEAERLKSKKWDRLRVVLKVRSSQRKTKFTLQWFRKHPNEFLLKSIQEGTPPEDIRSVLGLARLEGLKLFKHPNYEYYLKYLKLWFQTHSTEHWQERVPKGMPPEDVRFILGLGQLKGSEFSQHPNFPEYIKFFELWHEAYTRKKMKEWMQLNTPLDEAFAKLAIRDHNDVEFIVDKSDLYMKQYENEWKKKHPTLRTPAVST

2.2. Molecular Docking

2.2.1. Ligands’ Source and Fungal Receptor Proteins

The phytochemicals present in C. sativus, antimicrobial compounds from botanicals viz., Ocimum tenuiflorum, Allium cepa, Syzygium aromaticum, Azadirachta indica, and Mentha arvensis, and fungicides were obtained from the published literature [22,23,24,25,26,27,28]. A total of 71 compounds were selected for molecular docking, details of these compounds are given in Table 2. The three-dimensional (3D) structures of proteins (QNE and cytochrome oxidase subunit 1) were obtained from the protein data bank (www.rcsb.org) (accessed on 25 March 2021). Similarly, 3D confirmers of the selected ligands were retrieved from the PubChem (https://pubchem.ncbi.nlm.nih.gov) (accessed on 25 March 2021 database in PDB and SDF formats, respectively.

Table 2.

List of ligands such as terpenoids, glucosyl flavones, flavonoids, megastigmane derivatives, indolic secondary metabolites, flavone glucosides, polyphenols, antimicrobial compounds, and chemically synthesized compounds used for molecular docking analysis.

Group Sl. No. Compounds PubChem/Drug Bank ID Source
Terpenoids 1 Cucurbitacin-A 5281315 Cucumis sativus L.
2 Cucurbitacin-B 5281316 Cucumis sativus L.
3 Cucurbitacin-C 5281317 Cucumis sativus L.
4 Cucurbitacin-D 5281318 Cucumis sativus L.
5 Cucurbitacin-E 5281319 Cucumis sativus L.
6 Cucurbitacin-I 5281321 Cucumis sativus L.
Glucosyl flavones 7 Cucumerin-A 44257649 Cucumis sativus L.
8 Cucumerin-B 44257648 Cucumis sativus L.
Flavonoids 9 Vitexin 5280441 Cucumis sativus L.
10 Isovitexin 162350 Cucumis sativus L.
11 Orientin 5281675 Cucumis sativus L.
12 Isoorientin 114776 Cucumis sativus L.
Megastigmane derivatives 13 Cucumegastigmane-I 16105430 Cucumis sativus L.
14 Cucumegastigmane-II 16105434 Cucumis sativus L.
15 (+)-Dehydrovomifoliol 688492 Cucumis sativus L.
Indolic secondary metabolites 16 Indole-3-aldehyde 10256 Cucumis sativus L.
17 Indole-3-carboxylic acid 69867 Cucumis sativus L.
Flavone glucosides 18 Isoscoparin 442611 Cucumis sativus L.
19 Saponarin 441381 Cucumis sativus L.
20 Vicenin-2 442664 Cucumis sativus L.
21 Apigenin-7-O-glucoside 5280746 Cucumis sativus L.
22 Quercetin-3-O-glucoside 5280804 Cucumis sativus L.
23 Isorhamnetin-3-O-glucoside 5318645 Cucumis sativus L.
24 Kaemferol-3-O-rhamnoside 5316673 Cucumis sativus L.
Polyphenol 25 4-hydroxycinnamic acid 637542 Cucumis sativus L.
Antimicrobial compounds 26 Carrageenan 71597331 Acanthophora specifira V.
27 Acyclovir 135398513 Chemically synthesized
28 5-Azacytidine 9444 Chemically synthesized
29 Cytarabine 6253 Chemically synthesized
30 Ribavirin 37542 Chemically synthesized
31 Ridovudine 35370 Chemically synthesized
32 Ningnanmycin 44588235 Streptomyces noursei var. xichangensis
33 Vidarabine 21704 Chemically synthesized
34 Acycloguanosine 135398513 Chemically synthesized
35 2-Thiouracil 1269845 Chemically synthesized
36 Moroxydine hydrochloride 76621 Chemically synthesized
37 Luotonin A 10334120 Peganumnigella strum B.
38 Tylophorinine 264751 Cynanchum, Pergularia and Tylophora
39 Antofine 639288 Cynanchum komarovii I.
40 Deoxytylophorinine 6426880 Cynanchum komarovii I.
41 Pyrroloisoquinoline 86733878 Cynanchum komarovii I.
42 Pulmonarin-A 76335702 Synoicum pulmonaria
43 Pulmonarin-B 76313965 Synoicum pulmonaria
44 Streptindole 135431 Streptococcus faecium
45 Tryptanthrin 73549 Indigofera tinctoria L.
46 Essramycin 24829329 Streptomyces sp.
47 Chlorogenic acid 1794427 Solanum tuberosum L.
48 Peonidin 441773 Solanum tuberosum L.
49 Swertianolin 5858086 Swertia chirayita L., S. macrosperma L., Gentiana campestris L.
50 Zidovudine 35370 Chemically synthesized
Clove 51 Eugenol 3314 Syzygium aromaticum
52 Eugenol acetate 7136 Syzygium aromaticum
53 (E)-β-Caryophyllene 5281515 Syzygium aromaticum
Garlic 54 Allyl acetate 11584 Allium sativum
55 Allicin 65036 Allium sativum
56 Allixin 86374 Allium sativum
57 Alliin 87310 Allium sativum
Neem 58 Azadiractin a 5281303 Azadirachta indica
59 Nibolin b 6443005 Azadirachta indica
60 Azadiractin b 16126804 Azadirachta indica
61 Nimbin 108058 Azadirachta indica
Tulasi 62 Gallic acid 370 Ocimum tenuiflorum
63 Catechol 289 Ocimum tenuiflorum
64 Cinnamic acid 444539 Ocimum tenuiflorum
Pudina 65 Menthol 1254 Mentha spicata subsp. spicata
Chemically synthesized compounds 66 Azoxystrobin 3034285 Chemically synthesized
67 Ridomil 3036793 Chemically synthesized
68 Kresoxim methyl 6112114 Chemically synthesized
69 Curzate 5364079 Chemically synthesized
70 Oxalic acid 971 Chemically synthesized
71 Salicylic acid 338 Chemically synthesized

2.2.2. Preparation of Ligands and Target Proteins

Using Avogadro version 1.2.0 [29] with force field type MMFF94, the ligands’ 3D structures were optimized and then translated to PDB format using Open Babel version 3.1.1. Further simplification was attained by running the optimized ligands with the lowest energy through the AutoDock-MGL tools [30], adding the Gasteiger charges, and obtaining the PDBQT files via standard processes. A PyMOL check of the downloaded 3D structures was made to check for side-chain anomalies, improper bonds, and missing hydrogens [19]. Using Biovia Discovery Studio 2020, all water molecules, ions, complex molecules of ligands, and proteins were removed [31]. A PDB structure was optimized with Auto Dock-MGL by adding the polar hydrogens to obtain the PDBQT files.

2.2.3. Active Site Prediction and Molecular Docking

Using Biovia Discovery Studio 2020, the active sites of fungal proteins were determined. Molecular docking of optimized ligands and proteins in PDBQT format was performed using Auto Dock Vina software [30]. Auto Dock Vina software uses its scoring function (binding affinity) to predict the interaction between ligand and protein. A grid box of 60 Å × 60 Å × 60 Å was used for proteins with different XYZ coordinates based on predicted active sites for molecular docking. After docking analysis, the output file consists of the top nine binding poses, with their respective binding affinity in kcal/mol. The ligand binding poses with the highest binding affinity and the lowest root mean square deviation (RMSD) were chosen. The protein-ligand interaction in 3D structure was visualized in PyMOL. The two-dimensional (2D) structure was also visualized in Biovia Discovery Studio 2020. The 3D visualization indicates the target protein’s binding pocket or precise location.

On the other hand, the 2D structure visualization shows the different bonds formed between the amino acid residues of the fungal target protein and ligand. The workflow of molecular docking of compounds with proteins of P. cubensis associated with cucumber is depicted in Figure 1. The botanicals studied in molecular docking were further evaluated under in vitro conditions.

Figure 1.

Figure 1

The workflow of molecular docking analysis of phytochemicals, antimicrobial compounds, and chemically synthesized compound agents with proteins of P. cubensis.

2.3. In Vitro Evaluation of Botanicals

The botanicals were tested at three different concentrations of 5, 10, and 15% by m/v. The required concentration of botanicals was extracted by two different solvents.

2.3.1. Aqueous Extraction

Leaf samples from neem, tulsi, pudina, and cloves of garlic and clove were collected from the fields, College of Horticulture, Bengaluru, India. A hundred grams of each botanical sample were cleaned with tap water and shade dried at room temperature until complete evaporation of moisture. The samples were then made into powder by using an electric blender. Three concentrations of 5, 10, and 15% were prepared by suspending 5 g, 10 g, and 15 g of each botanical powder in 100 mL of sterile distilled water followed by filtration+ through cheesecloth to remove unwanted coarse particles. The filtered extract was centrifuged at 5000 rpm for 5 min to obtain a clear extract [32,33,34,35].

2.3.2. Methanolic Extraction

The procedure for the methanolic extraction of the botanicals was followed according to [35]. Leaf samples from neem, tulsi, and pudina, and cloves of garlic and clove were collected from the college farm located in Bengaluru, India. A hundred grams of each botanical sample were cleaned and made into powder. Thirty grams of each powdered botanical were extracted with 90 mL of methanol and kept on a rotary shaker for three days with periodic shaking. Then, the extract was filtered with muslin cloth and centrifuged at 5000 rpm for 15 min. The supernatant was collected in tubes and kept in a hot air oven until complete evaporation of the solvent. Then the leftover material in the tubes was utilized for the experimentation.

The fresh sporangia of P. cubensis were collected from the naturally infected cucumber research plot located at the College of Horticulture, Bengaluru, India. The procedure for sporangia collection was followed as per Bommesh et al. [34]. Five-day-infected cucumber leaves were picked and cut into small pieces before being soaked in sterile distilled water to make a sporangial suspension. Using a hemocytometer, the sporangia concentration was adjusted to 100 sporangia/mL. Then, a drop of sporangia suspension was mixed with a drop of botanical extract of 5%, 10%, and 15%, respectively, and kept in a BOD incubator at 20 °C and 100 percent relative humidity for 2 h. After 2 h of incubation, the sporangial germination was recorded under a microscope. A cavity slide with sterile distilled water was maintained as the control. The percentage of sporangia germination was calculated by the given formula.

Percent Germination of sporangia (PG) = (A/B) × 100

where,

A = Number of sporangia germinated
B = Number of sporangia observed

The percent inhibition was calculated by the given formula

Percent inhibition of sporangial germination = (C − T)/C × 100

where,

C = Germination of sporangia in control
T = Germination of sporangia in treatment.

The experiment was laid out with a Completely Randomized Design (CRD) with three replications. The cavity slides of each botanical concentration (5%, 10%, and 15%) were maintained with three replications along with the control under similar conditions. All slides were kept in a BOD incubator at 20 °C and 100 percent relative humidity for 2 h. The percentage of sporangia was calculated from all three replications along with the control, then analysis of variance was performed from the mean values,. The data were changed into arc-sine transformation for statistical analysis using OPSTAT [36].

3. Results

3.1. Modeling and Physicochemical Properties of Proteins

3.1.1. Prediction of the 3D Structure of Proteins of P. cubensis

The two protein sequences of P. cubensis were obtained and annotated (Table 1). The BLASTn results showed high query coverage (>99%) and percent identity (>99.47%) in both the proteins of P. cubensis. Later, these sequences were selected for protein modeling using SWISS-MODEL.

3.1.2. Template Selection

The selection of templates for building homology models was performed using the wizard of SWISS-MODEL with the following criteria: the template should show high coverage, i.e., >65 percent of the target aligned to the template and sequence identity should be more than 30 percent. Then, we used the GMQE and QMEAN scoring functions as initial criteria to discriminate good models from bad. Higher GMQE and QMEAN scores and acceptable alignment values were obtained during modeling, suggesting that statistically acceptable homology models were generated [37]. The output file was obtained in a PDB format that was used to visualize the model in PyMOL version 2.3. [19]. Global model quality estimation (GMQE) is the quality estimation that combines properties from the target-template alignment. The quality estimate ranges between 0 and 1 with higher values for better models. Qualitative model energy analysis (QMEAN) is a composite scoring function describing the major geometrical aspects of protein structures (Table 3).

Table 3.

Linear combination of two structural descriptors for model quality assessment.

Sl. No. Protein Template Query Coverage
(%)
Per Cent Similarities (%) GMQE QMEAN
1 Cytochrome oxidase subunit 1 7 jro 1. B 99 99.0 0.77 0.67
2 QNE 4 5 gnc 1. A 100 93.94 0.16 0.43 +/− 0.05

The results showed that the predicted cytochrome oxidase subunit 1 protein of P. cubensis model had 44.77 percent alpha-helices with beta turns comprising 8.27 percent, whereas the QNE4 effector protein has 42.36 percent alpha-helices with 8.70 percent beta turns (Table 4).

Table 4.

Calculated secondary structures (in percentage) by SOPMA.

Secondary Structures QNE4 Cytochrome Oxidase Subunit 1
Alpha helix % 42.36 44.77
Extended strand % 12.38 21.17
Beta turn % 8.70 8.27
Random coil % 36.56 25.79

3.1.3. Ramachandran Plot Analysis

The Ramachandran plot indicated the phi-psi torsion angle for all residues in the structure (except those at the chain termination). The darkest areas correspond to the ‘core’ region representing the most favorable combinations of phi-psi values. Ideally, one would hope to have over 90 percent of the residues in these ‘core’ regions. The percentage of residues in the ‘core’ region is one of the best guides to stereo-chemical quality. A good quality Ramachandran plot has over 90 percent in the most favored region [38].

Ramachandran plot analysis was carried out for two proteins (cytochrome oxidase subunit 1 and QNE4) of P. cubensis. The QNE4 effector protein was shown to have 86.8 percent of residues in the favored region (red color), 12.3 percent in the additionally allowed area (yellow color), 0 percent of residues in the generously allowed region (beige color), and 0.9 percent of residues in the disallowed region (white color) (Figure 2a). Similarly, the cytochrome oxidase subunit 1 protein had 82.8 percent of residues in the favored region (red color), 16.0 percent in the additionally allowed region (yellow color), 1.2 percent of residues in the generously allowed region (beige color), and 0 percent of residues in the disallowed region (white color) (Table 5) (Figure 2b). Homology modeling plays a vital role in structural proteomics and developing or designing potential compounds using an in silico approach.

3.1.4. Physico-Chemical Properties of Two Proteins of P. cubensis

The physico-chemical properties of proteins of P. cubensis were determined by ProtParam from the EXPASY server (www.expasy.ch/tools) (accessed on 28 March 2021) [21] and furnished in Table 6. The extinction coefficient indicates how much light a protein absorbs at a particular wavelength. The instability index estimates the protein’s stability in a test tube. If it is greater than 40, it is not stable; hence the effector QNE4 protein was stable in nature and another protein, cytochrome oxidase subunit 1, was unstable in nature. The grand average of hydropathic (GRAVY) value, which is calculated as the sum of the hydropathic values of all the amino acids divided by the number of residues in the sequence. A negative GRAVY value indicates that the protein is non-polar and a positive value indicates that the protein is polar. Hence, our results revealed that both proteins are non-polar in nature (Table 6). The overall stereochemical properties of the generated models were highly reliable and valuable in understanding the protein function.

Figure 2.

Figure 2

Comparative protein model quality assessment by using a Ramachandran plot for (a) QNE4 and (b) cytochrome oxidase subunit 1 proteins.

Table 5.

Ramachandran plot statistics for QNE4 and cytochrome oxidase subunit 1 proteins.

Sl. No. Ramachandran Plot Statistics QNE4 Cytochrome Oxidase Subunit 1
Residues Percentage (%) Residues Percentage (%)
1 Residues in most favored regions [A, B, L] 92 86.8 140 82.8
2 Residues in additional allowed regions [a, b, l, p] 13 12.3 27 16.0
3 Residues in generously allowed regions [~a,~b,~l,~p] 0 0.0 2 1.2
4 Residues in disallowed regions 1 0.9 0 0.0
5 Number of non-glycine and non-proline residues 106 100.0 169 100.0
6 Number of end-residues (except Gly and Pro) 2 2
7 Number of glycine residues (shown in triangles) 4 7
8 Number of proline residues 5 10
9 Total number of residues 117 188
Table 6.

Physico-chemical parameters computed using Expasy’s ProtParam tool.

Sl. No Description QNE4 Cytochrome Oxidase Subunit 1
1 Number of amino acids 517 412
2 Molecular weight (Daltons) 60,203.75 45,283.65
3 Theoretical pI 7.08 8.70
4 Negatively charged residues 76 14
5 Positively charged residues 75 16
6 Ext. coefficient M−1 cm−1 88,810 82,850
7 Instability index 40.53 25.94
8 Aliphatic index 75.71 114.78
9 Grand average of hydropathicity (GRAVY) −0.726 −0.796

3.2. Molecular Docking Studies

To develop effective phytochemicals/antimicrobial compounds from botanicals against P. cubensis associated with cucumber, approximately 71 compounds from plant and chemical sources were used for molecular docking with proteins as a potential target. Before the docking analysis, the ligands were optimized by minimizing the energy with force field type MMFF94, and this helps in removing clashes among atoms and developing a stable starting pose of the ligands for binding interaction [39]. The docking, coupled with a scoring function, can be utilized to screen a large number of potential phytochemicals in silico. Generally, in molecular docking, a binding affinity lower than the upper threshold (−6 kcal/mol) is considered the cut-off value for concluding good binding affinity between protein and ligand [39]. The 3D and 2D visualization of phytochemicals, antimicrobial compounds, and chemically synthesized compounds based on binding affinity with respective fungal receptor proteins has been represented (Supplementary Figures S1–S6), (Figure 3, Figure 4, Figure 5 and Figure 6). Hydrogen bond energy majorly contributed to the score [40] of selected compounds used in the current molecular docking studies against two proteins of P. cubensis, which displayed very good dock scores above the threshold cut-off of −6 kcal/mol (Table 7). The ligand structures and necessary hydrogen bond formation between the top phytochemicals, antimicrobial compounds, and fungicides with their respective fungal protein receptors have been illustrated in Table 8, Table 9, Table 10 and Table 11.

Table 7.

Dock score of interactions between phytochemicals, antimicrobial compounds, botanicals, and chemically synthesized compounds against cytochrome oxidase subunit 1 and QNE4 effector protein of P. cubensis.

Group Sl. No. Compound Dock Score for Binding Affinity (kcal/mol)
Cytochrome Oxidase Subunit 1 QNE Effector Protein P. cubensis
Terpenoids 1 Cucurbitacin-A −7.9 −8.1
2 Cucurbitacin-B −7.8 −8.3
3 Cucurbitacin-C −7.4 −7.4
4 Cucurbitacin-D −8.0 −8.2
5 Cucurbitacin-E −8.0 −8.1
6 Cucurbitacin-I −8.3 −8.0
Glucosyl flavones 7 Cucumerin-A −7.8 −9.1
8 Cucumerin-B −7.7 −8.5
Flavonoids 9 Vitexin −7.0 −7.5
10 Isovitexin −7.6 −8.0
11 Orientin −7.1 −7.4
12 Isoorientin −7.4 −7.9
Megastigmane derivatives 13 Cucumegastigmane-I −5.3 −5.4
14 Cucumegastigmane-II −6.2 −7.8
15 (+)-Dehydrovomifoliol −5.0 −6.3
Indolic secondary metabolites 16 Indole-3-aldehyde −4.4 −5.0
17 Indole-3-carboxylic acid −4.8 −5.5
Flavone glucosides 18 Isoscoparin −7.5 −8.5
19 Saponarin −8.1 −7.3
20 Vicenin-2 −7.1 −8.0
21 Apigenin-7-O-glucoside −7.5 −8.5
22 Quercetin-3-O-glucoside −6.8 −7.6
23 Isorhamnetin-3-O-glucoside −6.5 −6.9
24 Kaemferol-3-O-rhamnoside −7.2 −7.4
Polyphenol 25 4-hydroxycinnamic acid −4.8 −5.8
Antimicrobial compounds 26 Carrageenan −7.0 −8.0
27 Acyclovir −5.0 −5.7
28 5-Azacytidine −5.4 −5.8
29 Cytarbine −5.4 −5.9
30 Ribavirin −5.2 −5.8
31 Ridovudine −6.0 −7.0
32 Ningnanmycin −6.0 −7.8
33 Vidarabine −5.7 −6.6
34 Acycloguanosine −5.0 −5.5
35 2-Thiouracil −3.3 −4.6
36 Moroxydine hydrochloride −4.7 −5.2
37 Luotonin A −7.8 −6.9
38 Tylophorinine −7.1 −8.1
39 Antofine −7.2 −6.6
40 Deoxytylophorinine −7.2 −6.7
41 Pyrroloisoquinoline −5.0 −7.4
42 Pulmonarin-A −4.8 −5.5
43 Pulmonarin-B −5.0 −5.9
44 Streptindole −6.1 −7.6
45 Tryptanthrin −6.8 −7.7
46 Essramycin −6.6 −7.9
47 Chlorogenic acid −6.7 −7.3
48 Peonidin −6.3 −7.2
49 Swertianolin −8.0 −7.8
50 Zidovudine −5.8 −6.6
Clove 51 Eugenol −4.7 −5.3
52 Eugenol acetate −4.7 −5.4
53 (E)-β-caryophyllene −5.6 −6.8
Garlic 54 Allyl acetate −6.6 −7.2
55 Allicin −3.4 −3.7
56 Allixin −4.9 − 5.8
57 Alliin −3.9 −4.5
Neemm 58 Azadiractin a −3.7 3.5
59 Nibolin b −3.4 −3.4
60 Azadiractin b −3.2 −3.6
61 Nimbin −5.0 −5.5
Tulsi 62 Gallic acid −4.5 −5.1
63 Catechol −4.1 −5.0
64 Cinnamic acid −3.7 −4.4
Pudina 65 Menthol −3.3 −4.8
Fungicides 66 Azoxystrobin −7.2 −8.1
67 Ridomil −5.3 −5.3
68 Kresoxim methyl −6.3 −4.4
69 Curzate −5.3 −6.0
70 Oxalic acid −3.3 −5.3
71 Salicylic acid −4.5 −6.5

Table 8.

Number of hydrogen bonds formed during the interaction between top phytochemicals/antimicrobial compound structures with the QNE 4 effector protein of P. cubensis associated with cucumber.

Sl. No. Compound with PubChem ID Structural and Chemical Formula No. of H Bonds Amino Acid Residue of QNE 4 Effector Protein Involved in Hydrogen Bonding with Ligand
1 Cucumerin-A
44257649
Inline graphic
C29H28O11
4 ARG339, TVR290, LEU 126, ASN134
2. Cucumerin-B
44257648
Inline graphicC29H28O11 1 HIS110
3 Isoscoparin
442611
Inline graphicC22H22O11 3 SER109, HS110, GLY217
4 Apigenin-7-O-glucoside
5280746
Inline graphic
C26H28O14
4 ASN214, SER109, MET224, GLY107
5 Cucurbitacin-B
5281316
Inline graphic
C32H46O8
1 HIS110
6 Cucurbitacin-D
5281318
Inline graphicC32H44O7 3 SER 125, TYR108,ARG146
7 Cucurbitacin-A
5281315
Inline graphic
C32H46O9
2 SER140, SER82
8 Cucurbitacin-E
5281319
Inline graphicC32H44O8 2 SER 82, SER 109
9 Cucurbitacin-I
5281321
Inline graphicC30H42O7 3 LYS121,GLS127,ARG339
10 Vicenin-2
442664
Inline graphicC27H30O15 4 SER109, HIS83, GLY107, SER82

Table 9.

The number of hydrogen bonds formed during the interaction between top antimicrobial compounds from botanicals and chemically synthesized compound structures with the QNE4 effector protein of P. cubensis associated with cucumber.

Sl. No. Compound with PubChem ID Structural and Chemical Formula No. of H Bonds Amino Acid Residue of QNE4 Effector Protein Involved in Hydrogen Bonding with Ligand
1 Azoxystrobin
3034285
Inline graphic
C22H17N3O5
1 SER109
2 Allyl acetate
11584
Inline graphic
C5H8O2
2 ASP86, HIS83
3 Salicylic acid
338
Inline graphic
C7H6O3
3 ALA376,ARG377,LEU381
4 Curzate
5364079
Inline graphic
C7H10N4O3
4 THR456,ALA376
5 Allixin
86374
Inline graphic
C12H18O4
2 ARG285,GLN165

Figure 3.

Figure 3

Two-dimensional visualization of the interaction between the QNE 4 effector protein and the top five phytochemicals (A) Cucumerin A (B) Cucumerin B (C) Isocarpin (D) Apigenin-7-O- glucoside (E) Cucurbitacin-B.

Figure 4.

Figure 4

Two-dimensional visualization of the interaction between the cytochrome oxidase subunit 1 protein and the top five phytochemicals (A) Cucurbitacin-I (B) Saponarin (C) Cucurbitacin-D (D) Cucurbitacin-E (E) Swertianolin S.

Figure 5.

Figure 5

Two-dimensional visualization of the interaction between the cytochrome oxidase subunit 1 protein and top compounds from botanicals and chemical sources (A) Azoxystrobin (B) Allyl acetate (C) Kresoxim methyl (D) Curzate.

Figure 6.

Figure 6

Two-dimensional visualization of the interaction between the QNE 4 effector protein and top compounds from botanicals and chemical sources (A) Azoxystrobin (B) Allyl acetate (C) Salicylic acid (D) Curzate (E) Allixin.

3.3. Interactions between the QNE4 Effector Protein and Phytochemicals, Antimicrobial Compounds, and Chemically Synthesized Compounds

Molecular docking analysis of QNE 4 with 50 phytochemicals showed that the majority of the compounds bind to the effector protein of P. cubensis with favorable binding energies ranging from −4.4 kcal/mol (for Indole-3-aldehyde) to −9.1 kcal/mol (cucumerin-A), whereas antimicrobial compounds from different botanical sources and fungicides showed binding energies in the range of −3.4 to −12.1 (Table 7). Among the 50 phytochemicals, cucumerin-A (−9.1 kcal/mol), Isocarpin (−8.5 kcal/mol), apigenin −7-O-glucoside (−8.5 kcal/mol), cucumerin-B (−8.5 kcal/mol), cucurbitacin-B (−8.3 kcal/mol), cucurbitacin-D (−8.2 kcal/mol), cucurbitacin-A and cucurbitacin-E (−8.1 kcal/mol), cucurbitacin-I (8.0 kcal/mol), vincein (−8.0 kcal/mol), and caragenin (−8.0 kcal/mol) were the top 10 compounds with the highest binding affinities. The phytochemical compounds belonging to glucosyl flavones, terpenoids, and flavonoids have shown an excellent inhibitory action on the ONE4 effector protein of P. cubensis. Among the 15 antimicrobial compounds from botanicals tested, azoxystrobin (−8.1 kcal/mol), allyl acetate (−7.2 kcal/mol), (E)-β-caryophyllene (−6.8 kcal/mol), salicylic acid (−6.5 kcal/mol), curzate (−6.0 kcal/mol), and allixin (−5.8 kcal/mol) showed highest binding affinities (Table 7). The antimicrobial compounds obtained from botanicals namely, garlic and clove have shown a good inhibitory action on ONE4 effector protein of P. cubensis. At the same time, azoxystrobin (−8.1 kcal/mol), salicylic acid (−6.5 kcal/mol) and curzate (−6.0 kcal/mol) are the chemical compounds which exhibited the highest binding affinities. Overall, cucumerin-A (−9.1 kcal/mol) showed good inhibitory action on the ONE4 effector protein of P. cubensis out of 71 compounds tested.

Among the phytochemical compounds, cucumerin-A (−9.1 kcal/mol) exhibited the highest docking score with the QNE 4 effector protein. The ARG339, TVR290, LEU126, ASN134 amino acid residue is involved in forming four hydrogen bonds in the binding pocket of the QNE 4 effector protein. Similarly, cucumerin-B interacted with the HS110 amino acid residue by forming one hydrogen bond. Likewise, isoscoparin interacted with the SER109, HS110, and GLY217 amino acid residues by forming three hydrogen bonds, apigenin −7-O-glucoside showed an interaction with the ASN214, SER109, MET224, and GLY107 amino acids and produced four hydrogen bonds, the HIS110 amino acid shared one hydrogen bond with cucurbitacin-B, three hydrogen bonds of the SER82, SER109, and ALA108 amino acids were generated upon interaction with cucumerin-B, the SER82, SER109, and ALA108 amino acids of cucurbitacin-D were involved in forming three hydrogen bonds, the SER140 and SER82 amino acids of cucurbitacin-A interacted with two hydrogen bonds, the LYS121, GLN127, and ARG339 amino acids of cucurbitacin-I contributed three hydrogen bonds, vicenin-2 created an interaction with the SER109, HIS83, GLY107, and SER82 amino acids and generated four hydrogen bonds, and carrageenan interacted with the SER109, PHE84, HIS83, and HIS110 amino acids by forming four hydrogen bonds with the binding of the QNE4 effector protein of P. cubensis (Table 8).

In binding interactions between 15 antimicrobial compounds from different botanicals and six compounds from chemical sources and QNE 4, the docking score ranged from −3.4 to −8.1. Out of 21 compounds, the azoxystrobin (−8.1 kcal/mol) chemical compound showed the top docking score with the QNE 4 effector protein and interacted with SER109 amino acid residues to form one hydrogen bond in the binding pocket of the QNE 4 effector protein. Likely, allyl acetate created an interaction with the ASP86 and HIS83 amino acids and produced two hydrogen bonds; three hydrogen bonds of the ALA376, ARG377, and LEU381 amino acids were generated upon interaction with salicylic acid, the THR456 and ALA376 amino acids of curzate were involved in forming two hydrogen bonds, and the ARG285 and GLN165 amino acids shared two hydrogen bonds with allixin with the QNE4 effector protein of P. cubensis (Table 9).

3.4. Interactions between the Cytochrome Oxidase Subunit 1 Protein and Phytochemicals, Antimicrobial Compounds, and Fungicides

Among the 50 phytochemicals used for screening against the cytochrome oxidase subunit 1 protein, Indole-3-aldehyde has shown the lowest dock score of −4.4 kcal/mol and cucurbitacin-I have shown the highest dock score of −8.3 kcal/mol (Table 7). Ten compounds; cucurbitacin-I (−8.3 kcal/mol), saponarin (−8.1 kcal/mol), cucurbitacin-D (−8.0 kcal/mol), swertianolin (−8.0 kcal/mol), cucurbitacin-E (−8.0 kcal/mol), cucurbitacin-A (−7.9 kcal/mol), cucurbitacin-B (−7.8 kcal/mol), cucumerin-A (−7.8 kcal/mol), luotonin A (−7.8kcal/mol), and cucumerin-B (−7.7 kcal/mol) exhibited better dock scores. The phytochemicals from terpenoids, glucosyl flavones, and the flavone glucosides group have shown good affinities with the target cytochrome oxidase subunit 1 protein of P. cubensis.

Cucurbitacin-I interacted with the ARG461.GLU142, LEU141, TYR108, and SER125 amino acid residues through forming five hydrogen bonds with the cytochrome oxidase subunit 1 protein of P. cubensis. Likewise, the TRP106, SER167, HIS166, SER125, and MET127 amino acids of catechin shared five hydrogen bonds, cucurbitacin-D displayed an interaction with the ARG146, TYR108, and SER125 amino acids and produced three hydrogen bonds, three hydrogen bonds of the TRP106, SER167, and HIS166 amino acids were generated upon interactions with cucurbitacin-E, swertianolin created an interaction with the SER125, HIS166, SER167, and TRP106 amino acids and developed four hydrogen bonds, the TRP168, SER125, SER167, HIS166, and TRP104 amino acids of cucurbitacin-A were involved in forming five hydrogen bonds, cucurbitacin-B interacted with the ASN152, ARG146, LEU141, VAL145, and VAL147 amino acids by forming five hydrogen bonds, the LEU141, SER125, TRP106, and SER167 amino acids of cucumerin-A contributed four hydrogen bonds, Luotonin A interacted with the TYR108 and SER125 amino acids by forming two hydrogen bonds, and cucumerin-B interacted with the LEU141, MET127, SER125, TYR108, and SER167 amino acids by forming five hydrogen bonds with the active site of the cytochrome oxidase subunit 1 protein (Table 10).

The docking score for the 21 antimicrobial compounds and fungicides ranged from −3.2 kcal/mol (for azadiractin b) to −7.2 kcal/mol (for azoxystrobin) (Table 7). Four compounds; azoxystrobin (−7.2 kcal/mol), allyl acetate (−6.6 kcal/mol), kresoxim methyl (−6.3 kcal/mol), and curzate (−5.3 kcal/mol) exhibited uppermost binding affinities (Table 7). The compounds from chemical sources and antimicrobial compounds from garlic showed superior affinities with the target cytochrome oxidase subunit 1 protein of P. cubensis. Azoxystrobin interacted with the SER125, TYR108, TRP168, and TRP106 amino acid residues in forming four hydrogen bonds with the cytochrome oxidase subunit 1 protein of P. cubensis. Similarly, the SER125, TYR108, and TRP168 amino acids shared three hydrogen bonds with allyl acetate, and two hydrogen bonds of the TAM 552 and SER153 amino acids were interfaced with kresoxim methyl. The VAL147, SER125, and TYR108 amino acids of curzate contributed three hydrogen bonds with the active sites of the cytochrome oxidase subunit 1 protein of P. cubensis (Table 11).

Table 10.

Number of hydrogen bonds formed during the interactions between top phytochemicals/antimicrobial compound structures and the cytochrome oxidase subunit 1 protein of P. cubensis associated with cucumber.

Sl. No. Compound with PubChem ID Structural and Chemical Formula No. of H Bonds Amino Acid Residue of Cytochrome Oxidase Subunit 1 Protein Involved in Hydrogen Bonding with Ligand
1 Cucurbitacin-I
5281321
Inline graphic
C30H42O7
5 ARG461.GLU142, LEU141,TYR108,SER125
2 Saponarin
441381
Inline graphicC22H30O15 5 TRP106, SER167,HIS166,SER125,MET127
3 Cucurbitacin-D
5281318
Inline graphic
C32H44O7
3 ARG146, TYR108, SER125
4 Cucurbitacin-E
5281319
Inline graphicC32H44O8 3 TRP106, SER167, HIS166
5 Swertianolin
5858086
Inline graphicC20H20O11 4 SER125, HIS166, SER167, TRP106
6 Cucurbitacin-A
5281315
Inline graphicC32H46O9 5 TRP168, SER125, SER167, HIS166, TRP104
7 Cucurbitacin-B
5281316
Inline graphic
C32H46O8
5 ASN152, ARG146, LEU141, VAL145, VAL147
8 Cucumerin-A
44257649
Inline graphic
C29H28O11
4 LEU141, SER125, TRP106, SER167
9 Luotonin A
10334120
Inline graphic
C18H11N3O
2 TYR108, SER125
10 Cucumerin-B
44257648
Inline graphicC29H28O11 5 LEU141, MET127, SER125, TYR108, SER167

Table 11.

Number of hydrogen bonds formed during the interaction between top antimicrobial compounds from botanicals and chemically synthesized compound structures and the cytochrome oxidase sub-unit 1 protein of P. cubensis associated with cucumber.

Sl. No. Compound with PubChem ID Structural and Chemical Formula No. of H Bonds Amino Acid Residue of Cytochrome Oxidase Subunit 1 Protein Involved in Hydrogen Bonding with Ligand
1 Azoxystrobin
3034285
Inline graphic
C22H17N3O5
4 SER125, TYR108, TRP168, TRP106
2 Allyl acetate
11584
Inline graphic
C5H8O2
3 SER125, TYR108 and TRP168
3 Kresoxim methyl
6112114
Inline graphic
C18H19NO4
2 TAM 552, SER153
4 Curzate
5364079
Inline graphic
C7H10N4O3
3 VAL147, SER125, TYR108

3.5. In Vitro Evaluation of Botanicals

Evaluation of botanicals against sporangial germination of P. cubensis in vitro was carried out at different concentrations of five botanicals. The data revealed that all the treatments (botanicals) significantly inhibited the sporangial germination of P. cubensis. Among all of the botanicals tested, garlic bulb extract at 15 percent concentration showed significantly higher percentage inhibition (71.42%) followed by clove oil (64.51%) (Figure 7). The slightest inhibition of sporangial germination (33.33%) was observed at 5 percent concentration of neem (Table 12).

Figure 7.

Figure 7

Inhibition of sporangia germination (a) clove oil @5% (b) Garlic @15% (c) Control.

Table 12.

Evaluation of botanicals against downy mildew under in vitro conditions.

Treatment % Inhibition of Sporangial Germination
Concentration
5% 10% 15%
Clove 47.41
(6.95) **
57.14
(7.62)
64.51
(8.09)
Garlic 57.14
(7.62)
61.9
(7.93)
71.42
(8.51)
Tulsi 38.09
(6.25)
47.61
(6.97)
52.38
(7.30)
Pudina 38.09
(6.25)
47.41
(6.95)
57.14
(7.62)
Neem 33.33
(5.85)
42.85
(6.62)
57.14
(7.62)
Control 16
(4.12)
16
(4.12)
16
(4.12)
Mean 42.11
(6.45)
46.43
(6.78)
51.91
(7.15)
Treatment Concentration Treatment X Concentration
S.Em± 0.271 0.177 0.469
CD (p < 0.05) 0.776 0.508 1.344

Figures in parentheses are without transformed values. ** Values in bracket are arc-sin transformed values.

4. Discussion

In the present investigation, glucosyl flavones (cucumerin A, cucumerin B), terpenoids (cucurbitacin-A, cucurbitacin-B, cucurbitacin-C, cucurbitacin-D, cucurbitacin-E, and cucurbitacin-I), flavanone glucosides (isocarpin, apigenin-7-O-glucoside, vicenin-2, and saponarin), and antimicrobial compounds (luotionin) have shown good binding interactions on the ONE4 and cytochrome c oxidase subunit 1 proteins of P. cubensis. Similarly, luotonin-A has shown broad-spectrum fungicidal activities against 14 different phytopathogenic fungi [26].

Among the botanicals tested, antimicrobial compounds from garlic (allyl acetate, allicin, and alliin) and clove (eugenol acetate and (E)-β-caryophyllene) showed an excellent binding affinity with the ONE4 and cytochrome c oxidase subunit 1 proteins of P. cubensis. It was reported that the alliin from garlic showed significant binding interactions with the target-Avr3a11 effector protein of Phytopthora capsici compared to the commonly used fungicides, indicating that alliin can act as a potential inhibitor of Avr3a11 [40]. It was revealed that chemical compounds from garlic have antioxidant properties by conducting molecular docking analysis of the chemical compounds of garlic against NADPH oxidase [41]. The best docking score obtained on NADPH oxidase corresponds to α bisabolol (∆G = −10.62 kcal/mol), followed by 5-methyl-1, 2, 3, 4-tetrathiane (∆G = −9.33 kcal/mol). In silico analysis of eugenol against the β-glucosidase effector protein of Fusarium solani f. sp. piperis revealed that eugenol showed promising fungicidal activity and cytotoxic activity similar to that of tebuconazole fungicide. β-glucosidase showed good binding interaction with eugenol by forming amino acid residues with Arg177 followed by a hydrogen bond with Glu596, indicating an essential role in the interactions and justifying the antifungal action of this compound [42].

Out of the six chemically synthesized compounds evaluated, oxalic acid, salicylic acid, azoxystrobin, and curzate showed good binding interactions with the effector proteins of P. cubensis. Likewise, the resistance mechanisms of QoI fungicides (azoxystrobin) were studied earlier through molecular docking studies of the cytochrome b gene of Peronophythora litchi, the causal agent of litchi downy mildew [43]. They revealed that QoI fungicides (azoxystrobin) are potent inhibitors of P. litchi. Similarly, it was mentioned that salicylic acid has antifungal and antibacterial activity. They conducted homology modeling and docking analysis of salicylic acid against the PR1 protein of Xanthomonas oryzae. The results showed that salicylic acid has more binding affinity and interaction with the PR1 protein [44]. Among the five botanicals tested, garlic bulb extract showed maximum inhibition (71.42%) followed by clove oil (64.51%). Garlic bulb extract at a 15 percent concentration showed maximum inhibition of sporangial germination (71.42%), followed by clove oil at a 5 percent concentration (71.76%). Results from earlier reports found that the concentrations of 50–1000 μg ml/1 allicin in garlic juice reduced the severity of cucumber downy mildew caused by P. cubensis by approximately 50–100 per cent under controlled conditions [42]. The volatile antimicrobial substance allicin (dially thiosulphinate) from garlic (Allium sativum) at concentrations 50–100 μg/mL reduced the severity of P. cubensis on cucumber by approximately 50–100% [45]. In addition, clove oil at 4 percent effectively reduced the downy mildew incidence in cucumber [46].

5. Conclusions

The phytochemical compounds belonging to glucosyl flavones, terpenoids and flavonoids have shown good binding interactions on the ONE4 effector protein of P. cubensis. Among the 15 antimicrobial compounds from botanicals tested, allicin (−7.5 kcal/mol), allixin (−7.5 kcal/mol), allyl acetate (−7.2 kcal/mol), alliin (−5.9 kcal/mol), eugenol acetate (−5.5 kcal/mol), and (E)-β-caryophyllene (−5.5 kcal/mol) showed the highest binding affinities, and salicylic acid (−12.1 kcal/mol), oxalic acid (−11.2 kcal/mol), curzate (−7.7 kcal/mol) and azoxystrobin (−6.6 kcal/mol) are the chemical compounds which exhibited the highest binding affinities. Among the five botanicals tested, garlic bulb extract showed maximum inhibition (71.42%), followed by clove oil (64.51%). However, it is important to evaluate the phytochemicals and chemically synthesized compounds under in vitro and in vivo conditions and botanicals under in vivo conditions to validate the prediction studies as many phytochemicals and chemically synthesized compounds have a potential role in the inhibition of P. cubensis in cucumber.

Acknowledgments

University Grants Commission, Government of India for providing National Fellowship to N.J. and University of Horticultural Sciences, Bagalkot, India for providing facility.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/plants12112202/s1, Figure S1: 3D visualization of the interaction between QNE4 effector protein with top nine phytochemicals (A) Cucumerin-A (B) Cucumerin-B (C) Isoscoparin (D) Apigenin-7-O-glucoside (E) Cucurbitacin-B (F) Cucurbitacin-D (G) Cucurbitacin-A (H) Cucurbitacin-E (I) Cucurbitacin-I; Figure S2. 3D visualization of the interaction between cytochrome oxidase subunit 1 protein with top nine phytochemicals (A) Cucurbitacin-I (B) Saponarin (C) Cucurbitacin-D (D) Cucurbitacin-E (E) Swertianolin (F) Cucurbitacin-A (G) Cucurbitacin-B (H) Cucumerin-A (I) Luotonin A; Figure S3. 3D visualization of the interaction between QNE 4 effector protein with top compounds from botanicals and chemical sources (A) Azoxystrobin (B) Allyl acetate (C) Salicylic acid (D) Curzate (E) Allixin; Figure S4. 3D visualization of the interaction between cytochrome oxidase subunit 1 protein with top nine compounds from botanicals and chemical sources (A) Azoxystrobin (B) Allyl acetate (C) Kresoxim methyl (D) Curzate; Figure S5. 2D visualization of the interaction between QNE 4 effector protein with top five phytochemicals (A) Cucumerin A (B) Cucumerin B (C) Isocarpin (D) Apigenin-7-O-glucoside (E) Cucurbitacin-B (F) Cucurbitacin-D (G) Cucurbitacin-A (H) Cucurbitacin-E (I) Cucurbitacin-I; Figure S6. 3D visualization of the interaction between cytochrome oxidase subunit 1 protein with top nine phytochemicals (A) Cucurbitacin-I (B) Saponin (C) Cucurbitacin-D (D) Cucurbitacin-E (E) Swertianolin (F) Cucurbitacin-A (G) Cucurbitacin-B (H) Cucumerin-A (I) Luotonin A.

Author Contributions

Conceptualization, N.J., K.S.S. and V.D.; methodology, N.J., M.M. and K.S.S.; software, N.J., M.M. and K.S.S.; validation, N.J. and M.M.; formal analysis, N.J., M.M. and K.S.S.; investigation, N.J., M.M., V.D. and K.S.S.; resources, V.D. and K.S.S.; data correction, V.D., C.G.S. and K.S.S.; writing-original draft preparation, N.J., K.S.S. and V.D. writing-review and editing, N.J., K.S.S. and V.D.; visualization, K.S.S., V.D. and S.S.; supervision, V.D. and K.S.S.; project administration, V.D. and K.S.S.; funding acquisition, S.S. and V.D. All authors have read and agreed to the published version of the manuscript.

Conflicts of Interest

The authors declare no conflict of interest.

Funding Statement

This research received no external funding.

Footnotes

Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

References

  • 1.Nandkarni K.M. Indian materia medica. Newsletter. 1927;12:40. [Google Scholar]
  • 2.Mukherjee P.K., Nema N.K., Maity N., Sarkar B.K. Phytochemical and therapeutic potential of cucumber. Fitoterapia. 2013;84:227–236. doi: 10.1016/j.fitote.2012.10.003. [DOI] [PubMed] [Google Scholar]
  • 3.Sahu T., Sahu J. Cucumis sativus (cucumber): A review on its pharmacological activity. J. Appl. Pharm. Res. 2015;3:4–9. [Google Scholar]
  • 4.Ugwu C., Suru S. Cucumber Economic Values and Its Cultivation and Breeding. IntechOpen; Rijeka, Croatia: 2021. Cosmetic, Culinary and Therapeutic Uses of Cucumber (Cucumis sativus L.) p. 39. [Google Scholar]
  • 5.Gocher D., Sharma M.K., Gurjar H.R. Management of root-knot nematode (Meloidogyne incognita) in poly house on cucumber (Cucumis sativus L.) as seed soaking treatment. Indian J. Nematol. 2018;48:108–112. [Google Scholar]
  • 6.FAO . World Food and Agriculture Statistical Yearbook. Food and Agriculture Organization of the United Nations; Rome, Italy: 2021. [DOI] [Google Scholar]
  • 7.Anonymous. Horticulture Statistics Division, Department of Agriculture. Cooperation and Farmers Welfare, Ministry of Agriculture and Farmers Welfare, Government of India; New Delhi, India: 2020. pp. 1–2. [Google Scholar]
  • 8.Palti J., Cohen Y. Downy mildew of cucurbits (Pseudoperonospora cubensis): The fungus and its hosts, distribution, epidemiology and control. Phytoparasitica. 1980;8:109–147. doi: 10.1007/BF02994506. [DOI] [Google Scholar]
  • 9.Savory E.A., Granke L.L., Quesada-ocampo L.M., Varbanova M., Hausbeck M.K., Day B. The cucurbit downy mildew pathogen Pseudoperonospora cubensis. Mol. Plant Pathol. 2011;12:217–226. doi: 10.1111/j.1364-3703.2010.00670.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Rahman M.M., Haque M.N., Hosen S., Akhter J., Kamal U.S.B., Jahan E.N., Hossain A.S.M.S., Uddin M.N., Islam M.B., Islam M.R., et al. Comparative evaluation of antimicrobial activity of different parts of Abelmoschus moschatus against multi-resistant pathogens. Int. J. Pharm. Sci. Res. 2017;8:1873. [Google Scholar]
  • 11.Kaur S., Samota M.K., Choudhary M., Choudhary M., Pandey A.K., Sharma A., Thakur J. How do plants defend themselves against pathogens-Biochemical mechanisms and genetic interventions. Physiol. Mol. Biol. Plants. 2022;28:485–504. doi: 10.1007/s12298-022-01146-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Krajaejun T., Khositnithikul R., Lerksuthirat T., Lowhnoo T., Rujirawat T., Petchthong T., Yingyong W., Suriyaphol P., Smittipat N., Juthayothin T., et al. Expressed sequence tags reveal genetic diversity and putative virulence factors of the pathogenic oomycete Pythium insidiosum. Fungal Biol. 2011;115:683–696. doi: 10.1016/j.funbio.2011.05.001. [DOI] [PubMed] [Google Scholar]
  • 13.Fawzi E.M., Khalil A., Afifi A. Antifungal effect of some plant extracts on Alternaria alternate and Fusarium oxysporum. Afr. J. Biotech. 2009;2:2590–2597. [Google Scholar]
  • 14.Feng W., Zheng X. Control of Alternaria alternata by cassia oil in combination with potassium chloride or sodium chloride. J. App. Microbiol. 2006;101:1317–1322. doi: 10.1111/j.1365-2672.2006.03024.x. [DOI] [PubMed] [Google Scholar]
  • 15.Hayat S., Cheng Z., Ahmad H., Ali M., Chen X., Wang M. Garlic, from remedy to stimulant: Evaluation of antifungal potential reveals diversity in phytoalexin allicin content among garlic cultivars; allicin containing aqueous garlic extracts trigger antioxidants in cucumber. Front. Plant Sci. 2016;7:1235. doi: 10.3389/fpls.2016.01235. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Doshi P., Nisha N., Yousif A.I.A., Korosi K., Bán R., Turóczi G. Preliminary investigation of effect of neem-derived pesticides on Plasmopara halstedii pathotype 704 in sunflower under in vitro and in vivo conditions. Plants. 2020;9:535. doi: 10.3390/plants9040535. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Najdabbasi N., Mirmajlessi S.M., Dewitte K., Landschoot S., Mänd M., Audenaert K., Ameye M., Haesaert G. Biocidal activity of plant-derived compounds against Phytophthora infestans: An alternative approach to late blight management. Crop Prot. 2020;138:105315. doi: 10.1016/j.cropro.2020.105315. [DOI] [Google Scholar]
  • 18.Waterhouse A., Bertoni M., Bienert S., Studer G., Tauriello G., Gumienny R., Heer F.T., De Beer T.A.P., Rempfer C., Bordoli L., et al. Swiss-model: Homology modelling of protein structures and complexes. Nucleic Acids Res. 2018;46:296–303. doi: 10.1093/nar/gky427. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.DeLano W.L. The PyMOL Molecular Graphics System. DeLano Scientific; San Carlos, CA, USA: 2009. [Google Scholar]
  • 20.Lovell S.C., Davis I.W., Arendall W.B., De Bakker P.I., Word J.M., Prisant M.G., Richardson J.S., Richardson D.C. Structure validation by Cα geometry: ϕ, ψ and Cβ deviation. Protein J. 2003;50:437–450. doi: 10.1002/prot.10286. [DOI] [PubMed] [Google Scholar]
  • 21.Gasteiger E., Hoogland C., Gattiker A., Duvaud S., Wilkins M.R., Appel R.D., Bairoch A. Protein identification and analysis tools on the ExPASy server. In: Walker J.M., editor. The Proteomics Protocols Handbook. Humana Press; Totowa, NJ, USA: 2005. pp. 571–607. [Google Scholar]
  • 22.Cortes-Rojas D.F., De Souza C.R.F., Oliveira W.P. Clove (Syzygium aromaticum): A precious spice. Asian Pac. J. Trop. Biomed. 2014;4:90–96. doi: 10.1016/S2221-1691(14)60215-X. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Kaur P., Dhull S.B., Sandhu K.S., Salar R.K., Purewal S.S. Tulsi (Ocimum tenuiflorum) seeds: In vitro DNA damage protection, bioactive compounds and antioxidant potential. J. Food Meas. Charact. 2018;12:1530–1538. doi: 10.1007/s11694-018-9768-6. [DOI] [Google Scholar]
  • 24.Wang K., Jiang S., Pu T., Fan L., Su F., Ye M. Antifungal activity of phenolic monoterpenes and structure related compounds against plant pathogenic fungi. Nat. Prod. Res. 2019;33:1423–1430. doi: 10.1080/14786419.2017.1419232. [DOI] [PubMed] [Google Scholar]
  • 25.Hao Y., Guo J., Wang Z., Liu Y., Li Y., Ma D., Wang Q. Discovery of tryptanthrins as novel antiviral and anti-phytopathogenic fungus agents. J. Agric. Food Chem. 2020;68:5586–5595. doi: 10.1021/acs.jafc.0c02101. [DOI] [PubMed] [Google Scholar]
  • 26.Hao Y., Wang K., Wang Z., Liu Y., Ma D., Wang Q. Luotonin A and its derivatives as novel antiviral and anti-phytopathogenic fungus agents. J. Agric. Food Chem. 2020;68:8764–8773. doi: 10.1021/acs.jafc.0c04278. [DOI] [PubMed] [Google Scholar]
  • 27.Kang J., Gao Y., Zhang M., Ding X., Wang Z., Ma D., Wang Q. Streptindole and its derivatives as novel antiviral and anti-phytopathogenic fungus agents. J. Agric. Food Chem. 2020;68:7839–7849. doi: 10.1021/acs.jafc.0c03994. [DOI] [PubMed] [Google Scholar]
  • 28.Zhang M., Ding X., Kang J., Gao Y., Wang Z., Wang Q. Marine natural product for pesticide candidate: Pulmonarin alkaloids as novel antiviral and anti-phytopathogenic fungus agents. J. Agric. Food Chem. 2020;68:11350–11357. doi: 10.1021/acs.jafc.0c04868. [DOI] [PubMed] [Google Scholar]
  • 29.Hanwell M.D., Curtis D.E., Lonie D.C., Vandermeersch T., Zurek E., Hutchison G.R. Avogadro: An advanced semantic chemical editor, visualization and analysis platform. J. Cheminform. 2012;4:17. doi: 10.1186/1758-2946-4-17. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Morris G.M., Huey R., Lindstrom W., Sanner M.F., Belew R.K., Goodsell D.S., Olson A.J. Auto Dock4 and Auto Dock Tools4: Automated docking with selective receptor flexibility. J. Comput. Chem. 2009;30:2785–2791. doi: 10.1002/jcc.21256. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.Biovia D.S. BIOVIA Workbook, Release BIOVIA Pipeline Pilot, Release. Dassault Systemes; San Diego, CA, USA: 2020. [Google Scholar]
  • 32.Petrikovszki R., Doshi P., Turóczi G., Tóth F., Nagy P. Investigating the side-effects of neem-derived pesticides on commercial entomopathogenic and slug-parasitic nematode products under laboratory conditions. Plants. 2019;8:281. doi: 10.3390/plants8080281. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Yehia H.M. Methanolic extract of neem leaf (Azadirachta indica) and its antibacterial activity against foodborne and contaminated bacteria on sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) Am. Eurasian J Agric Environ. Sci. 2016;16:598–604. [Google Scholar]
  • 34.Bommesh J.C., Pitchaimuthu M., Sadashiva A.T., Sriram S., Varalakshmi B., Ravishankar K.V. Identification and confirmation of downy mildew (Pseudoperonospora cubensis Berk. & Curt.) resistance sources in cucumber (Cucumis sativus L.) Indian Phytopathol. 2018;71:337–348. [Google Scholar]
  • 35.Vincent J.M. Distortion of fungal hyphae in the presence of certain inhibitors. Nature. 1947;159:850. doi: 10.1038/159850b0. [DOI] [PubMed] [Google Scholar]
  • 36.Sheoran O.P., Tonk D.S., Kaushik L.S., Hasija R.C., Pannu R.S. Statistical Software Package for Agricultural Research Workers. Recent Advances in information theory. In: Hooda D.S., Hasija R.C., editors. Statistics & Computer Applications. Department of Mathematics Statistics, CCS HAU; Hisar, India: 1998. pp. 139–143. [Google Scholar]
  • 37.Ekins S., Liebler J., Neves B.J., Lewis W.G., Coffee M., Bienstock R., Southan C., Andrade C.H. Illustrating and homology modeling the proteins of the Zika virus. F1000 Res. 2016;5:275. doi: 10.12688/f1000research.8213.2. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Prajapat R., Bajapai V., Gaur R.K. Structural modeling and validation of rep protein of begomovirus strains (TLCBV and TYLCTHV) Asian J. Biol. Sci. 2011;4:352–361. doi: 10.3923/ajbs.2011.352.361. [DOI] [Google Scholar]
  • 39.Klebe G. Virtual ligand screening: Strategies, perspectives and limitations. Drugs Today. 2006;11:580–594. doi: 10.1016/j.drudis.2006.05.012. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Shityakov S., Sohajda T., Puskas I., Roewer N., Forster C., Broscheit J.A. Ionization states, cellular toxicity and molecular modeling studies of midazolam complexed with trimethyl-Β-cyclodextrin. Molecules. 2014;19:16861–16876. doi: 10.3390/molecules191016861. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.Mohamed A., Hamza A., Derbalah A. Recent approaches for controlling downy mildew of cucumber under greenhouse conditions. Plant Prot. Sci. 2015;52:1–9. doi: 10.17221/63/2015-PPS. [DOI] [Google Scholar]
  • 42.Rani J.R., Aswathy T.R., Kumar M.S., Nair A.S., Soniya E.V. Screening of phytochemicals from selected plants with antifungal properties against RXLR effector protein Avr3a11 in Phytophthora capsici. Can. J. Biotechnol. 2017;1:34. [Google Scholar]
  • 43.Herrera-Calderon O., Chacaltana-Ramos L.J., Huayanca-Gutierrez I.C., Algarni M.A., Alqarni M., Batiha G.E.S. Chemical constituents, in vitro antioxidant activity and in silico study on NADPH oxidase of Allium sativum L. (garlic) essential oil. Antioxidants. 2021;10:1844. doi: 10.3390/antiox10111844. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Maximino S.C., Dutra J.A., Rodrigues R.P., Gonçalves R.C., Morais P.A., Ventura J.A., Schuenck R.P., Junior V.L., Kitagawa R.R., Borges S.W. Synthesis of eugenol derivatives and evaluation of their antifungal activity against Fusarium solani f. sp. piperis. Curr. Pharm. Des. 2020;26:1532–1542. doi: 10.2174/1381612826666200403120448. [DOI] [PubMed] [Google Scholar]
  • 45.Chen D., Oezguen N., Urvil P., Ferguson C., Dann S.M., Savidge T.C. Regulation of protein-ligand binding affinity by hydrogen bond pairing. Sci. Adv. 2016;2:1240. doi: 10.1126/sciadv.1501240. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46.Portz D., Koch E., Slusarenko A.J. Effects of garlic (Allium sativum) juice containing allicin on Phytophthora infestans and downy mildew of cucumber caused by Pseudoperonospora cubensis. Eur. J. Plant Pathol. 2008;122:197–206. doi: 10.1007/s10658-008-9334-x. [DOI] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials


Articles from Plants are provided here courtesy of Multidisciplinary Digital Publishing Institute (MDPI)

RESOURCES