Summary
Epigenetic inheritance refers to the faithful replication of DNA methylation and histone modification independent of DNA sequence. Nucleosomes block access to DNA methyltransferases, unless they are remodeled by DECREASE IN DNA METHYLATION1 (DDM1Lsh/HELLS), a Snf2-like master regulator of epigenetic inheritance. We show that DDM1 activity results in replacement of the transcriptional histone variant H3.3 for the replicative variant H3.1 during the cell cycle. In ddm1 mutants, DNA methylation can be restored by loss of the H3.3 chaperone HIRA, while the H3.1 chaperone CAF-1 becomes essential. The single-particle cryo-EM structure at 3.2 Å of DDM1 with a variant nucleosome reveals direct engagement at SHL2 with histone H3.3 at or near variant residues required for assembly, as well as with the deacetylated H4 tail. An N-terminal autoinhibitory domain binds H2A variants to allow remodeling, while a disulfide bond in the helicase domain is essential for activity in vivo and in vitro. We show that differential remodeling of H3 and H2A variants in vitro reflects preferential deposition in vivo. DDM1 co-localizes with H3.1 and H3.3 during the cell cycle, and with the DNA methyltransferase MET1Dnmt1. DDM1 localization to the chromosome is blocked by H4K16 acetylation, which accumulates at DDM1 targets in ddm1 mutants, as does the sperm cell specific H3.3 variant MGH3 in pollen, which acts as a placeholder nucleosome in the germline and contributes to epigenetic inheritance.
Introduction
DNA methylation, histone modification and nucleosome composition are key determinants of epigenetic inheritance, and are responsible for heterochromatin formation and transposon silencing, thereby contributing to genome stability. DDM1 was first identified in a genetic screen for loss of DNA methylation in Arabidopsis 1, and encodes a conserved SNF2-like chromatin remodeling ATPase required for both DNA and histone methylation 2–4. Similar reductions in both CG and non-CG DNA methylation are observed in mutants in the E3 ubiquitin ligase VIM1 (VARIANT IN METHYLATION1) 5,6, while similar reductions in CG methylation are observed in mutants in the DNA methyltransferase MET1 7. Parallel networks have been described in mammals that utilize the DDM1 ortholog LSH/HELLS 8–11, the VIM1 ortholog UHRF1 (ubiquitin-like with PHD and ring finger domains 1) 12–14, and the MET1 ortholog DNMT1 15.
Nucleosome assembly (wrapping of an H2A/H2B/H3/H4 octamer core with 1.6 gyres of dsDNA) follows DNA replication and begins with the H3/H4 tetramer, resulting in deposition of the canonical histone H3.1 by histone chaperone CAF-1 16–18. This is followed by the addition of two H2A/H2B dimers 19. Canonical histones are subsequently replaced by histone H3.3 and histone H2A.Z at transcribed genes. This replacement requires nucleosome remodeling by SNF2 family proteins EP400 and Chd1, that alter nucleosome positioning via DNA translocation and promote both histone H3.3 and H2A.Z deposition by nucleosome unwrapping and histone exchange 20–23. Like other Snf2 remodelers, Chd1 binds nucleosomes at the first alpha-helix of histone H3, as well as the H4 tail, and induces a 1bp translocation per ATP cycle by distorting the DNA. The N terminus of EP400 also binds H2A.Z/H2B dimers, facilitating exchange. Specificity of Snf2 activity for genes and other chromosomal regions is conferred by recognition of histone modifications, both by the remodelers themselves as well as by subsidiary factors 24,25.
Rather than promote transcription, DDM1 promotes silencing, and ATPase and nucleosome remodeling activities of DDM1 have been demonstrated in vitro, but only when expressed in insect cells 26. These activities require additional co-factors with HELLS 27. DDM1-dependent DNA methylation is limited to pericentromeric heterochromatin, and to transposable elements scattered along the chromosome arms. In ddm1 mutants, these regions lose DNA methylation and associated histone H3 lysine-9 di-methylation (H3K9me2) 3. Importantly, only a subset of these differentially methylated regions (DMRs) re-gain DNA methylation when DDM1 is restored, demonstrating that DDM1 is required for epigenetic inheritance 28. It has therefore been hypothesized that DDM1 remodels heterochromatic nucleosomes to facilitate access of DNA methyltransferases to heterochromatin 2. In ddm1 mutants in Arabidopsis, and in Lsh mutants in the mouse, DNA methylation is lost from nucleosomes, but not from linker DNA, consistent with this idea 29. Arabidopsis heterochromatin comprises specific histone variants, namely H3.1, H2A.W (akin to macroH2A), and the linker histone H1 30, as well as specific histone modifications including H3K27me1, H3K9me2, and deacetylated histones H3 and H4 31. DDM1 impacts most, if not all, of these heterochromatin specific variants and modifications 3,32–35, as does Lsh 36,37, but the mechanism underlying these pleiotropic effects is unknown. We set out to determine the mechanism by which DDM1 recognizes and remodels heterochromatin, and how this contributes to epigenetic inheritance.
Results
DDM1 promotes the replacement of H3.3 for H3.1 in heterochromatin.
Epigenetic marks in Arabidopsis are re-established during replication, when the canonical histone H3.1 is deposited and when it is specifically monomethylated on lysine-27 by ATXR5 and ATXR6 in heterochromatin 38–40. Over-replication of heterochromatin DNA occurs in atxr5 atxr6 mutants, and requires FAS2, the CAF-1 histone chaperone ortholog that mediates H3.1 deposition 38,41. Interestingly, over-replication also requires both DDM1 and MET1 42 raising the possibility that DDM1, like FAS2, is required for deposition of H3.1. Consistently, DDM1 is expressed in dividing cells 43,44 and LSH is expressed specifically during S-phase 45.
To test whether DDM1 plays a role in H3.1 deposition, we crossed ddm1 mutants with H3.1-GFP and H3.3-RFP reporter lines 39, under the control of their endogenous promoters (HTR3 and HTR5, respectively). H3.1-GFP fluorescence was markedly diminished in root tips from ddm1 (Figure 1A), suggesting H3.1 was depleted from chromatin. A similar loss of H3.1-GFP fluorescence was observed in root tips from met1 (Figure 1A), as confirmed by ChIP-qPCR (Figure S1A). In Arabidopsis, the vast majority of H3K27me1 is specific to H3.1 and as previously reported 46, H3K27me1 immunofluorescence signals were also reduced in ddm1 and met1 to similar levels as in fas2CAF1 (Figure S1B). In contrast to H3.1, nuclei in ddm1 had abnormal H3.3-RFP chromocenter localization suggesting ectopic deposition in heterochromatin, though the effect was less obvious in met1 (Figure 1B; Figure S1A). To examine the role of H3 variants in epigenetic inheritance, we visualized nuclear organization of the male germline-specific H3.3 variant MGH3/HTR10, which replaces canonical H3.3 in sperm cells 47. MGH3 was strikingly mis-localized from the center of the nucleus to peripheral heterochromatin (defined by DAPI staining) in ddm1 sperm cells (Figure 1C). Similar mis-localization was observed in met1 sperm cells, but not in the non-CG methyltransferase mutant cmt3 (Figure S1C). Importantly, mis-localization of MGH3 in sperm cells was observed even when DDM1 or MET1 function was restored in heterozygotes (86.7%±5.77 of pollen grains from MGH3-GFP X ddm1 F1 plants; 96.7%±5.77 from MGH3-GFP x met1 F1 plants; n=3 heterozygous plants each). This indicated that MGH3 mis-localization was somehow inherited from ddm1 mutants, even when DDM1 function was restored.
Many of the phenotypes observed in ddm1 mutants are also found in met1, including the epigenetic inheritance of transposon DNA hypomethylation at CG dinucleotides 48. There are some important differences however, such as the loss of CHG methylation from transposons in ddm1, and the loss of gene body CG methylation from exons in met1 48. One explanation could be that DDM1 and MET1 interact and depend on each other for accumulation in heterochromatin. To further explore interactions between DDM1 and MET1 we expressed a functional MET1-mCherry fusion in transgenic plants (see Methods) that also expressed a functional DDM1-GFP fusion 44 and observed co-localization in interphase (Figure S1D). We then performed bimolecular fluorescence complementation by transient expression of split GFP fusion proteins in Arabidopsis leaves, and detected robust complementation indicating close proximity in the nucleus (Figure S1E). Finally, we raised polyclonal antibodies to DDM1 (see Methods) and determined by Western blotting that levels of DDM1 protein were sharply reduced in ddm1 mutants (Figure S1F), consistent with a splice donor site mutation in ddm1–2 49. Importantly, met1–1 mutants had a similarly low level of DDM1 protein in chromatin fractions compared to wild-type (Figure S1F). In mammalian cells, Dnmt1, Lsh and Uhrf1 interact, and are co-recruited to the replication fork by a combination of histone modifications and hemi-methylated DNA 10,50–53. Our results support a similar interaction between Arabidopsis orthologs MET1, DDM1 and VIM1. We therefore focused our subsequent studies on DDM1.
First, we investigated the genome-wide effects of DDM1 on nucleosome composition and modification by ChIP-seq, using antibodies against H3K27me1 and antibodies against H3.3(HTR5)-RFP, as well as by low-input Chip-seq of MGH3-GFP from pollen (Figure 1D). As expected, H3K27me1 was confined to pericentromeric heterochromatin, while H3.3 and MGH3 were found in the gene dense chromosome arms 40,54. We also performed ChIP-seq using anti-DDM1 antibodies (see Methods), and found that DDM1 was found in pericentromeric regions, overlapping closely with H3K27me1, precisely where H3.3 was depleted (Figure 1D; Figure S1G). Next, we examined ddm1 mutants by ChIP-seq using the same antibodies. Consistent with microscopy-based observations, H3K27me1 was depleted in ddm1 compared to wild-type (Figure 1E), while H3.3 was ectopically deposited in pericentromeric regions (Figure 1E). Low-input Chip-seq of pollen from MGH3-GFP X ddm1 F1 plants using anti-GFP antibodies revealed that MGH3 was also ectopically deposited in heterochromatin in pollen (Figure 1E), consistent with peripheral nuclear localization in sperm cells (Figure 1C).
H3.3 deposition prevents DNA methylation of heterochromatin in ddm1 mutants
It has previously been shown that DDM1 is required for methylation of nucleosomal DNA, but not for linker DNA, suggesting that DDM1 allows access to DNA methyltransferase by remodeling the nucleosome 29. The loss of H3.1 and gain of H3.3 in ddm1 mutants (Figure 1E) suggested that H3.3 might prevent methylation when DDM1 was removed. We therefore investigated whether loss of histone H3 variants or their chaperones could rescue loss of DNA methylation in ddm1 mutants. fas2 encodes the large subunit of the CAF-1 histone chaperone responsible for H3.1 deposition during S phase. We did not obtain ddm1 fas2CAF1 double mutants (n=150 F2 plants), while the siliques of ddm1/+ fas2CAF1 plants contained undeveloped seeds (Figure 2A; Methods). This can be explained by exacerbated loss of H3.1 in ddm1 fas2CAF1 double mutants resulting in synthetic lethality.
To assess the role of H3.3 in DNA methylation, we made double mutants between H3.3 and ddm1. The complete knock-out of all H3.3 genes (htr4, htr5, and htr8) is lethal in Arabidopsis 55 and we obtained no viable ddm1 htr4 htr5 htr8 mutants. ddm1 htr4 htr5 htr8/+ mutants, which had only one functional copy of H3.3, were slow growing while ddm1 htr4 htr5 mutants, which had 2 functional copies, were normal indicating dose dependence (Figure 2B). As an alternative to using H3.3 mutants, we examined interactions with mutants in the H3.3 chaperones HIRA and ATRX. The transcriptional histone chaperone HIRA is required for H3.3 deposition during interphase, and has viable mutants 17,18,56,57. ddm1 hira double mutants exhibited delayed growth phenotypes, but these were comparable to ddm1 siblings and were also viable (Figure 2C). ATRX encodes a conserved Snf2-like remodeler specifically required for H3.3 deposition in heterochromatin just before mitosis 58–62. By contrast with ddm1, double mutants between atrx and hira are inviable while atrx fas2CAF1 double mutants are viable 62 and we found that atrx ddm1 double mutants were also fully viable (Figure 2D). These contrasting phenotypes with H3.1 and H3.3 chaperone mutants are consistent with DDM1/FAS2 and ATRX/HIRA having essential roles in H3.1 and H3.3 deposition, respectively.
Next, we performed whole genome bisulfite genome sequencing of ddm1, atrx and hira mutants. DNA methylation levels at transposable element loci were dramatically reduced in ddm1 siblings for all methylation contexts, as expected, but methylation levels were significantly higher in ddm1 hira double mutants (Figure 2E). In contrast, ddm1 atrx mutants did not recover DNA methylation, while atrx single mutants actually lost methylation (Figure 2E). In order to determine if H3.3 was responsible, we examined H3.3 levels at differentially methylated regions (DMRs) that recovered DNA methylation in ddm1 hira, and found a highly significant enrichment of H3.3 in ddm1 mutants relative to wild-type (P<10e-14; Figure 2F). Significant enrichment for H3.3 was found at DMRs genome wide (Figure 1E; Figure 2F) and at individual loci, some of which completely lost DNA methylation in ddm1 mutants but recovered substantially in ddm1hira (Figure 2G). These results indicated that ectopic deposition of H3.3 was responsible for loss of methylation in ddm1 mutants, while ectopic H3.1 deposition was presumably responsible for loss of methylation in atrx mutants. In both cases, loss of DNA methylation occurs because nucleosomes block access to DNA methyltransferase in the absence of chromatin remodeling 29.
Single-particle Cryo-EM reconstruction of the DDM1-nucleosome complex reveals interactions with DNA and with histones H3 and H4
To establish the molecular specificity of physical interactions between DDM1 and nucleosomes, the molecular structure of a DDM1-nucleosome complex was determined by single-particle cryo-electron microscopy (cryo-EM). A nucleosome core particle comprised of H2A.W, H2B, H3.3, H4, and 147 bp Widom 601 DNA was assembled with full-length DDM1 (Figure 3A). After iterative rounds of filtering, classification, and refining selected particle classes (Figure S2A), a 3D reconstruction of the DDM1-nucleosome complex was obtained at 3.2 Å resolution (Figure 3B; Figure S2B–D). Estimation of the local resolution was higher for the nucleosome core compared to DDM1 (Figure S2C,D). The final structure spans residues 200–435 of DDM1, including the DEXD ATPase domain, and residues 442–673, which include the helicase superfamily C-terminal (HELICc) domain (Figure 3A).
Like other Snf2 remodelers, DDM1 has two main lobes, each consisting of a parallel β-sheet core surrounded by short a helices, connected by a flexible linker (Figure 3B; Figure S3A,B). As expected from intrinsic disorder predictions, the N-terminal DEXD ATPase domain and the C-terminal HELICc helicase domain exhibited higher resolution than the peripheral regions (Figure S2D). Density for the disordered N-terminus was not observed in the cryo-EM map (Figure 3A), consistent with predictions of a highly disordered domain.
DDM1 clasps the nucleosome on the outside of superhelix location-2 (SHL-2), making contact with both gyres as well as the histone octamer core. By comparison with other Snf2-family structures 63–66 this placement of DDM1 and the associated distortion of the DNA helix indicates a role in DNA translocation, nucleosome sliding and assembly or disassembly (Figure S3A–C). Both lobes of DDM1 make multiple contacts with the DNA, with positively charged grooves and patches of DDM1 serving as DNA interfaces (Figure S3D). The helical structure of DNA was notably unwound where the upper gyre contacts the HELICc domain, and the DNA strands displaced about 7 Å toward the enzyme, while the other gyre shifts in the other direction compared to an unbound nucleosome, causing an opening between the two gyres (Figure 4A). This feature is observed in other chromatin remodelers 67,68, in both nucleotide-free and ADP-bound states, though the displacement for DDM1 appears to be somewhat larger.
Surprisingly, a disulfide bond was observed in the HELICc domain, bridging C615 and C634 (Figure 4B). Intriguingly, the first allele of ddm1 to be discovered, ddm1–1, has a C615Y substitution predicted to specifically disrupt the S-S bond (Figure S4B), and has strong defects in DNA methylation and DNA repair 49,69. A second allele (ddm1–9) has strong silencing defects, and lies between the two cysteines in an absolutely conserved glutamine found in all Snf2 remodelers (Q629R) that lies in the cleft between the two lobes (Figure 4C) 70. Although this arginine is too far to contact DNA in the nucleotide-free open conformation (Figure S3A), ADP bound structures of other Snf2 remodelers (Figure S3B) indicate a closed conformation and potential DNA contact 68. Intriguingly, a substitution in HELLS, identified in an ICF patient, occurs in a second conserved glutamine nearby (Q625R in DDM1 alignment) indicating conservation of function in humans (Figure 4C) 27. In both cases, arginine substitutions are predicted to contact the phosphate backbone around the site of DNA distortion (Figure 4C). A third allele of ddm1 with strong silencing defects (ddm1–14) has a surface substitution (D382E) potentially involved in interacting with protein partners (Figure 4D) 70. This surface has a high degree of conservation with other Snf2 remodelers (Figure S3C).
The HELICc domain of DDM1 interacts with histones H3.3 and H4. The majority of the interface is formed by a loop in DDM1 (residues 480–487) that makes contact with H3 at the C-terminus of its α1 helix (residues 73–81) (Figure 3C). In this region, DDM1, DNA, histone H3.3, and histone H4 all contact one another. With histone H3.3, DDM1 makes direct contact at residue T80 (Figure 3C). Intriguingly this residue is substituted by V in the male germline specific variant MGH3 (Figure 4E; Figure S4A), which has been implicated in epigenetic inheritance 54 and is mislocalized in heterochromatin in pollen from ddm1/+ plants (Figure 1C,E). A full experimental density map reveals that additionally, the N-terminal tail of histone H4 extends into a pocket of DDM1, possibly serving as another site for histone mark recognition, although the side chains cannot be resolved (Figure 4F). The H4 tail extends into the same domain in other remodeler structures, including Snf2h and Snf2, but takes a different direction at approximately residue 22 toward the N-terminal end. In the case of DDM1, an aromatic cage comprised of up to 3 tyrosine residues in DDM1 appears at the base of the unstructured H4 tail (Figure S3E). Since the first structured residue is at position 21, the aromatic cage could potentially interact with lysine-20 if it were methylated (Figure S3E). Only one of the three aromatic residues is conserved in HELLS: the positions of key residues in DDM1 and HELLS are summarized in Figure S4B.
DDM1 has an N-terminal autoinhibitory domain and has remodeling specificity for histone variants.
While the ATPase and HELICc domains of DDM1 are well-conserved with Snf2 and well-structured, the N-terminal domain is predicted to be unstructured (Figure 5A; Figure S4C). To establish the role of this N-terminal domain in DDM1 function, we expressed and purified various recombinant DDM1 proteins in E. coli and subjected them to peptide binding and ATPase activity assays. Microscale thermophoresis (MST) affinity assays revealed binding of full length DDM1 with unmodified H4 peptides (Figure 5B). Modified H4K20me1, H4K20me2 and H4K20me3 peptides had similar affinities in vitro, while fully acetylated H4K5K8K12K16Ac peptides failed to bind (Figure 5B). Recombinant DDM1 has previously been shown to have DNA-dependent ATPase and nucleosome sliding activity, but only when expressed in insect cells and not in E.coli 26. Consistently, we found only low levels of DNA dependent ATPase activity for full length recombinant DDM1 from E. coli, which were further reduced by disruption of the disulfide bond by C615S mutation (Figure 5C). Importantly, however, we found much higher levels of ATPase activity for N-terminally truncated DDM1(Δ1–132) indicating the presence of an N-terminal autoinhibitory domain (Figure 5C). By analogy with ISWI, we named this autoinhibitory domain DDM1 AutoN (Figure 5A). H4 peptide binding assays indicated a slightly higher affinity for the N-terminal truncation that lacks AutoN (Figure 5B).
Next, we performed nucleosome remodeling assays using nucleosomes composed of H2A, H2A.W, H3.1, and H3.3 variants and the Widom 601 147bp DNA fragment plus 60bp linker (Figures 5D,E). In these assays, nucleosomes come to equilibrium at the center of the fragment, or at the ends, but ATP-dependent DNA translocation activity can ”slide” them resulting in altered mobility on a native gel. ATP-dependent unwrapping activity, on the other hand, can disassemble the octamer into hexasomes and tetrasomes, or remove the octamer altogether 19. After incubating nucleosomes with DDM1, DDM1C615S, or DDM1(Δ1–132) at t=0, ATP was added and samples taken every 2 minutes. As an important control, ATP-dependent remodeling was not observed with the DDM1 C615S catalytic mutant enzyme on any of the variant combinations (Figure 5D). The N-terminal truncated form of DDM1, on the other hand, had strong remodeling activity on most histone variant combinations (Figure 5D). In contrast, full-length DDM1 had only weak activity on H3.1-containing nucleosomes, as previously reported 26 but stronger activity on H3.3 nucleosomes (Figure 5D).
DDM1 remodeling activity resulted in a pronounced ATP-dependent reduction in intact nucleosomes over time. The proportion of intact nucleosomes (arrows, Figure 5D) were quantified by comparison with levels at t=0 in each reaction. For full length DDM1, reduction of intact nucleosomes was only observed for H3.3 containing nucleosomes (green and purple lines, Figure 5E). For the truncated enzyme, remodeling was much more pronounced, but reduction of intact nucleosomes was restricted to nucleosomes containing H3.1/H2A, H3.3/H2A or H3.3/H2A.W, reaching equilibrium at roughly 50% intact nucleosomes (Figure 5E). Despite close similarity of H3.1 and H3.3 (Figure S4A), DDM1 could not reduce the level of intact nucleosomes composed of both H3.1 and H2A.W (red lines, Figure 5E), despite the presence of slower migrating bands indicating potential sliding activity. The germline specific H3.3 variant MGH3 differs from H3.3 at 12 positions, 4 of which are in the globular domain, one of which (Y41F) is shared with H3.1 (Figure S4A) and one of which (T80V) contacts DDM1 directly (Figure 3C; Figure 4E). We performed remodeling assays on MGH3 variant nucleosomes, and found that replacing H3.3 by MGH3 made H2A nucleosomes resistant to remodeling by DDM1, differing dramatically from both H3.1 H2A and H3.3 H2A nucleosomes (Figure 5D), and resembling H3.1 H2A.W nucleosomes instead (Figure 5E).
To further test the idea that remodeling of histone H3 variants underlies the role of DDM1 in epigenetic inheritance, we performed confocal microscopy and live imaging of cycling root tip cells, to examine the localization of DDM1 and histone variants. We found that DDM1-mCherry colocalized with H3.1-CFP at chromocenters during S phase (Figure 6A) 39,71 when deposition of H3.1 is mediated by CAF-1 72. In most interphase cells, however, DDM1-GFP was diffusely localized in the nucleoplasm along with H3.3-RFP (Figure 6B). In live imaging experiments, DDM1 was recruited to chromatin in G1, remained until G2, and then dissociated upon mitosis (Videos S1 and S2). In humans, HELLS also has diffuse nucleoplasmic localization, but mutation of the Walker-A ATP binding site (K237Q) results in tight association with chromocenters and reduced soluble fractionation in nuclear extracts 73. Given the high conservation between LSH/HELLS and DDM1 in this region (Figure 6C), we generated an equivalent DDM1K233Q mutation in the pDDM1:DDM1-mCherry transgene. Relative to the wild-type transgene fusion, this mutated version of DDM1 also displayed enhanced chromocenter localization in WT cells (Figure 6C), and reduced partitioning into the soluble nuclear fraction (Figure 6D).
The role of DDM1 in epigenetic inheritance during the cell cycle.
In serial crosses to wild-type, unmethylated DNA is epigenetically inherited from ddm1 mutants, and differentially methylated regions (DMRs) between WT and ddm1 can be divided into two classes depending on their inheritance 74. The first class are stable DMRs that are never remethylated in serial crosses to WT plants. The second class of DMRs eventually revert to WT in similar crosses, although reversion can take multiple generations. Both classes of DMRs represent epigenetically inherited targets of DDM1 and are almost exclusively comprised of transposable elements 74. We mapped our ChIP-seq reads to these DMRs, and compared them to random sequences and genes (Figure 6E). Additionally, we performed ChIP-seq using antibodies for H4K16ac, a highly conserved modification that marks active chromatin and has been shown to accumulate in chromocenters in ddm1 mutants 75. H4K16ac is a reliable marker for histone H4 acetylation in plants, and is accompanied by H4K12, K8 and K5 acetylation 76, which we found prevents binding of DDM1 to H4 tails in vitro (Figure 5B). Using these DMRs as proxies for DDM1 activity, we first found that DDM1 is strongly enriched precisely over these DMRs, consistent with DMRs being DDM1 targets (Figure 6E), and mostly comprising pericentromeric transposable elements (Figure S5A,B). Similarly, H3K27me1 was also strongly enriched in DDM1 targets but depleted in ddm1. In contrast H3.3, MGH3 and H4K16Ac are precisely excluded from DDM1 targets in WT plants, but encroach into these regions in ddm1 mutants (Figure 6E; Figure S5). Notably, H4K16Ac was especially enriched in stably inherited DMRs in ddm1 mutants. Thus, histone H3.3, MGH3 and H4K16Ac are each strongly anti-correlated with both DDM1 and H3.1, specifically at the epigenetically inherited and differentially methylated targets of DDM1.
Discussion
Nucleosome remodeling is an important pre-requisite for DNA metabolism, including DNA replication, repair, recombination, and transcription 19. Here we show that DDM1 promotes DNA methylation by preferentially remodeling heterochromatic nucleosomes during S phase, when H3.1 and H2A are deposited, allowing DNA methylation of CG dinucleotides by the methyltransferase MET1 (Figure 7). Subsequent incorporation of H2A.W stabilizes H3.1, but not H3.3 nucleosomes, allowing DNA methylation of non-CG cytosines in G2 by the chromomethylases CMT3 and CMT2, which depends on lysine 9 di-methylation of intact histone H3 nucleosomes 77. DDM1 is then evicted in mitosis. Mutants in H3.1 and H3.3, their chaperones, and their modifying enzymes, all exhibit strong genetic interactions with mutants in ddm1, supporting the essential role of this mechanism in heterochromatic DNA replication 42 and DNA methylation 2–4.
Remodeling assays with variant histones supported our conclusions. Octamers containing both H3.1 and H2A.W were much more stable in remodeling assays with DDM1 than other octamers (Figure 5D,E), although slower migrating nucleosomes were evidence of sliding or unwrapping activity, as opposed to disassembly. These differential activities could result in the preferential deposition of H3.1 and H2A.W by destabilizing nucleosomes containing H3.3 or H2A 34,78. This mechanism may also account for the dependence on DDM1 for deposition of histone H1 34,35 and for the requirement of LSH for histone macroH2A deposition in vivo 37 and macroH2A exchange in vitro 36. This is because assembly of H1 linkers, and of H2A/H2B dimers, depend on previous assembly of H3/H4 tetramers 19. In the presence of DDM1, histone gene mutations indicate that histone H1 inhibits DNA methylation 29,32–35,37, while histone H3.3 and histone H2A.W can actually promote it 55, although the effects are small. In the absence of remodeling by DDM1, access to DNA methyltransferase is blocked by the residual H3.3 nucleosomes. What then is the role of H2A.W or macroH2A? We identified an N-terminal autoinhibitory domain in DDM1 that is analogous to the N-terminal intrinsic autoinhibitory domain (AutoN) of ISWI 79. ISWI AutoN inhibits ATP hydrolysis but this inhibition is relieved upon interaction with an acidic patch on H2A 80. In a recent study, the N-terminal domain of DDM1 was shown to bind H2A.W in a similar way 34, which could promote ATPase activity. Thus H3.1H2A.W sliding activities we observe might promote DNA methylation of intact nucleosomes in the G2 phase of the cell cycle by CMT2 and CMT3 77, accounting for the modest reductions in non-CG methylation observed in h2a.w mutants 34.
Single-particle cryo-EM reconstruction of DDM1 bound to variant nucleosomes supports this model, in that DDM1 engages the nucleosome at SHL-2 making direct contact with histone H3 at T80 and D81, just 6 amino acids from H87, the residue which confers specificity to histone H3.3 nucleosome assembly in Arabidopsis (Figure S4A) 81. The H3-interacting loop of DDM1 is only moderately conserved between plants and mammals (Figure S4B), which have differing variant residues in histone H3.3, indicating co-evolution with histone H3.3. A disulfide bridge in the C terminal helicase domain is required for DNA-dependent ATPase activity and chromatin remodeling in vitro, and is disrupted in the very first ddm1 allele (ddm1–1), providing strong support that ATP-dependent remodeling of histone variants is required for DNA methylation (Figure 4B; Figure 5C,D,E). In mammalian cells, histone residues H3K79 and T80 are modified by methylation and phosphorylation, respectively, during mitosis, which might be expected to prevent interaction with DDM1 82. Consistently, imaging of wild-type and catalytic mutant DDM1 revealed colocalization with H3.3 in interphase, and with H3.1 during S phase, but DDM1 was lost during mitosis when histone H3.3 accumulates instead (Figure 6; Videos S1 and S2). The reverse is true for ATRX, which deposits H3.3 in heterochromatin in mammals 58–61, and removes macroH2A 83 likely promoting heterochromatic transcription in G1 84. In Arabidopsis, ATRX is also required for H3.3 deposition in heterochromatin 62,85 and may have a reciprocal function to DDM1 in mitosis (Graphical abstract). Intriguingly, we found that ATRX is also required for DNA methylation of a subset of DDM1 targets, confirming that remodeling itself, rather than specific histone variants, is required for DNA methylation 29.
The cryo-EM single particle reconstruction has also revealed important clues to heterochromatic specificity. The nucleosomal contacts made with histone H4 by DDM1 are similar to those made by ISWI/Snf2h 63,66,86. Histone H4 deacetylation is a hallmark of heterochromatin, and in ISWI the H4 tail must be deacetylated to stimulate remodeling activity 19,79. Chd1 also interacts with the H4 tail for DNA translocation activity 67 and physically associates with HIRA for H3.3 deposition 23. Binding assays with DDM1 demonstrated specific affinity for deacetylated H4 tails but not for fully acetylated H4 peptides (Figure 5B), consistent with specific activity for heterochromatic nucleosomes which are strongly deacetylated in Arabidopsis (Figure S5B). ISWI AutoN competes with the H4 tail, and DDM1 without AutoN had higher affinity for H4 peptides (Figure 5B), consistent with this mechanism. In striking agreement with these conclusions, H4K16 acetylation, which is a reliable marker for H4 acetylation, is enriched in precisely those regions of heterochromatin in which DDM1 is depleted (Figure 6D, Figure S6A,B). DDM1 also has high affinity for H4K20me1, H4K20me2, and H4K20me3 peptides, and although their association with plant heterochromatin is less well established, they might provide specificity for other roles of DDM1, such as DNA repair.
Our results shed important light on the role of DDM1 in epigenetic inheritance. We found that DDM1 interacts with MET1 in Arabidopsis (Figures S1D,E), similar to the interaction of LSH with DNMT1 in the mouse 10,50,51. DDM1 remodeling activity allows chromatin access to MET1 29, but MET1 is also required for DDM1 binding to chromatin (Figure S1F). Histone H4 deacetylation is likely responsible, as it depends on MET1 87,88. Unmethylated DNA is epigenetically inherited for multiple generations from ddm1, met1 and hda6 mutants, but not from other histone and DNA modification mutants 89,90, consistent with this circular logic. However, it has been previously reported that H4K16ac is restored to wild type levels when DDM1 activity is restored in heterozygotes 75, as is H2A.W 34, arguing against a direct role in epigenetic inheritance. Instead, we found that the Male Germline H3.3 variant MGH3 is mislocalized to heterochromatin at the nuclear periphery in sperm cells from ddm1/+ and met1/+, even when wild-type DDM1 function was restored (Figure 1E; Figure 6E). MGH3 has a T80V substitution predicted to alter interaction with DDM1 (Figure 4E; Figure S4A), potentially accounting for failure to remove ectopic MGH3 in WT pollen. Consistent with this idea, remodeling assays with DDM1 revealed that MGH3 H2A nucleosomes were much more resistant to remodeling than H3.3 H2A or H3.1 H2A nucleosomes. While the precise mechanism remains to be determined, interaction with histone H3 variants in vivo and in vitro suggests that they contribute to silencing by DDM1.
These results lead to a model for epigenetic inheritance of unmethylated transposable elements that depends on differential nucleosome remodeling (Figure 7). Active transposons are transcribed, and associated with H3.3 and H2A. When active transposons are introduced into WT plants by genetic crosses with ddm1 mutants, DDM1 remodels chromatin by unwrapping H3.3 and H2A nucleosomes, promoting the assembly of H3.1 H2A.W nucleosomes instead. Remodeling promotes access to DNA methyltransferases, DNA methylation and silencing. An exception occurs if active transposons are introduced from the male, because MGH3 replaces H3.3 in sperm cells, where it cannot be removed by DDM1. Subsequent replacement in the zygote with H3.3, and H4K16 acetylation results in epigenetic inheritance of the active transposon. One prediction of this model is that transgenerational epigenetic inheritance of unmethylated transposons should occur preferentially through the male germline. Remarkably inheritance of active transposons is indeed paternally biased 91 resulting in the gradual restoration of DNA methylation from one seed generation to the next 48. We previously found that MGH3 is also resistant to H3K27 tri-methylation by Polycomb repressor complex 54, resembling placeholder nucleosomes that underlie paternal inheritance of DNA methylation in zebrafish 92. Thus, chromatin remodeling of histone variants by DDM1 underlies the epigenetic inheritance of DNA methylation in plants. Transgenerational inheritance is much less common in mammals 93, but close parallels with HELLS and Lsh suggest similar mechanisms may operate in the mammalian germline as well. A recent study has indicated that transgenerational inheritance of a methylated promoter in the mouse occurs despite the reprogramming and loss of DNA methylation in the embryo, suggesting a similar placeholder mechanism may be at work in mammals as well 94.
STAR Methods
Resource availability
Lead Contact
Further information and requests for resources and materials should be directed to and will be fulfilled by the lead contact, Robert A. Martienssen (martiens@cshl.edu).
Materials availability
All materials generated in this study are available upon request to the lead contact.
Data and code availability
ChIP-sequencing and Bisulfite-sequencing data have been deposited at GEO and are publicly available as of the date of publication. Accession numbers are listed in the key resources table (GEO study: GSE231563).
This paper also analyzes existing, publicly available data. These accession numbers for the datasets are listed in the key resources table.
Coordinates and the cryo-electron microscopy map for the DDM1-nucleosome complex have been deposited in the Protein Data Bank and are publicly available as of the date of publication. Accession numbers are listed in the key resources table. (PDB: 7UX9; EMD-26855).
All original code has been deposited at https://github.com/martienssenlab/DDM1-manuscript
Any additional information required to reanalyze the data reported in this paper is available from the lead contact upon request.
Experimental model
Seed stocks and plant materials
Plants were grown under long day conditions at 22°C. Seeds were grown on ½ Murashige and Skoog (MS) medium and seedlings were transplanted to soil 7 day after germination for BS-seq, or harvested at 10 days for ChIP. For MGH3, ChIP was performed on mature pollen grains.
All genotypes including wild-type and met1–1, met1–7, cmt3–11, ddm1–2, ddm1–10, fas2–4, hira-1, and atrx-2 mutants are in the Col-0 background and described in Table S3. The pHTR3:HTR3-GFP (referred herein as H3.1-GFP) and pHTR5:HTR5-RFP (referred to as H3.3-RFP) lines were previously reported 39, as were htr4 htr5 htr8/+ 55, pMGH3:MGH3-GFP 103, pHTR13:HTR13-CFP 104 and pDDM1:DDM1-GFP 44. To generate mCherry reporter lines, genomic fragments of DDM1 (AT5G66750) and MET1 (AT5G49160) were cloned into the vector pDONR221 with the mCherry fragment inserted before the stop codon by NEBuilder HiFi DNA Assembly Master Mix (New England Biolabs) (Table S4 for primer sequences). mCherry constructs in pDONR221 were transferred into the pB7WG binary destination vector using Gateway LR Clonase II (Thermo Fisher Scientific). pDDM1:DDM1K233Q-mCherry was generated from pB7WG-pDDM1:DDM1-mCherry using the Q5 Site-Directed Mutagenesis Kit (New England Biolabs). For biomolecular complementation experiments, DDM1 and MET1 coding sequences were cloned into pBiFC2 and pBiFC4, respectively. DDM1-GFP constructs were shown to complement ddm1 mutants previously 44. met1–1 mutants were late flowering (57 leaves, n=23), unlike WT Col-0 (15.6 leaves, n=12) and met1–1 mutants were partially complemented by MET1-mCherry (37.5 leaves, n=4). ddm1 fas2/+ plants had 19% aborted seed (n=122) while fas2 ddm1/+ plants had 17% aborted seeds (n=75). No double mutants were recovered (n>150).
Methods
Chromatin immunoprecipitation (ChIP)
ChIP was performed as previously described 105, starting with 1g of seedlings. In brief, after crosslinking in 1% formaldehyde for 10 min, the tissue was ground to a fine powder in liquid nitrogen, chromatin was extracted with 1% SDS Tris-based lysis buffer and sonicated to ~200bp fragments. Chromatin was cleared with protein A magnetic beads and incubated overnight with the antibody listed below. Immune complexes were eluted with low, and then high salt buffers, before reversing crosslinks and purifying DNA fragments with ChIP DNA clean and concentrator kit (Zymo Research). Low input ChIP for MGH3-GFP was performed with ~10e8 pollen grains. Fixation was for 15 min and subsequent grinding with acid-washed glass beads. DNA fragments underwent a preliminary phenol-chloroform and ethanol precipitation step before clean up.
For histone modifications, anti-H3K27me1 (Active Motif; 61015) and anti-H3 antibodies (Abcam; ab1791), or anti-H4K16ac (EMD millipore; 07–329) and anti-H4 (abcam; ab10158) antibodies were used. For ChIP experiments against H3.1-GFP, H3.3-RFP, and DDM1-mCherry, GFP-trap (ChromoTek; gtma-10) or RFP-trap (ChromoTek; rtma-10) magnetic beads were used. For MGH3-GFP ChIP, anti-GFP (Thermo Fisher scientific; A-11122) polyclonal antibody was used. Polyclonal DDM1 antibodies were raised against a synthetic peptide (TINGIESESQKAEPEKTGRGRKRKAASQYNNTKAKRAVAAMISRSKE) outside the SWI/SNF domain by Covance antibody services. Anti-H3 was used as control for H3K27me1 and H3.3, anti-H4 was used as control for H4K16ac, and input DNA were used as controls for MGH3 and DDM1 ChIP-seq. After ChIP, qPCR was performed using KAPA SYBR FAST qPCR Master Mix (Kapa Biosystems). qPCR primers are listed in Table S4. ChIP-sequencing (ChIP-seq) libraries were prepared with ~200 bp insert size using NEBNext Ultra II DNA Library Prep Kit for Illumina (New England Biolabs). The ChIP-seq libraries were sequenced using an Illumina NextSeq platform with 75-cycle single reads for H3K27me1 and HTR5 samples and with paired-end 151 cycles for DDM1 and H4K16ac samples. MGH3 libraries were prepared by Fasteris SA (Switzerland) and sequenced on HiSeq platform to 100bp paired-end reads for WT and 100bp single reads for ddm1/+. Only read1 was processed from the WT sample to compare to single-end ddm1/+. Sequencing metrics on all ChIP-seq libraries are listed in Table S5. ChIP-seq data were analyzed as previously described 106, trimming adapters with cutadapt 107 but using bowtie2 108 to map to TAIR10, before filtering primary alignements with samtools 109. Two independent replicates of ChIP-seq were obtained for each antibody and genotype except for MGH3-GFP, which was compared instead to H3.3. The Pearson correlation coefficient was at least 0.8 for the replicates (Figure S6A). When available, the IP and control of the two biological replicates were merged after mapping and deduplication with samtools, and then the signal tracks (bigwig) were generated with Deeptools 95 by calculating the log2 fold change of IP over control after count-per-million normalization. MGH3 and H3.3 ChIP-seq datasets produced in this study have been compared to previously published datasets GSE120664 47 (Figure S6B) and from GSE34840 40 (Figure S6C), respectively. Figures were generated in R (https://www.r-project.org/) using ggplot2 110 and GViz 111 packages. Heatmaps were generated with Deeptools.
Bisulfite sequencing (BS-seq)
Genomic DNA (gDNA) was extracted from rosette leaves of 3–4 plants for each genotype with Nucleon PhytoPure Genomic DNA Extraction Kits (Cytiva). 1 μg gDNA samples were sheared to an average size of 400 bp using a Covaris S220 focused-ultrasonicator. BS-seq libraries were made using the NEXTFLEX Bisulfite Library Prep Kit (PerkinElmer). The library samples were sequenced as paired-end 101bp reads with an Illumina NextSeq system. Sequencing metrics on all Bisulfite sequencing libraries are listed in Table S6. Adaptors were trimmed using Cutadapt 107 and aligned to the TAIR10 reference genome with Bismark 112. Duplicate reads were collapsed, and methylation levels at each cytosine were calculated as a ratio of #C / (#C + #T). DMRs were defined using DMRcaller 113. A minimum difference of 30%, 20%, and 10% was used for DMRs in CG, CHG, and CHH contexts, respectively. Two independent biological replicates were performed for each genotype, showing high reproducibility (Pearson correlation > 0.9, Figure S6D,E). Figures were generated in R (https://www.r-project.org/) using ggplot2 110 and GViz 111 packages.
Nuclear fractionation
Soluble and insoluble chromatin fractions were obtained as previously described 114. Briefly, 0.3 mL of seedling tissues were incubated in 0.6 mL N1 buffer (15 mM Tris-HCl, pH 7.5, 60 mM KCl, 15 mM NaCl, 5 mM MgCl2, 1 mM CaCl2, 1 mM DTT, and 250 mM sucrose, with Complete Mini EDTA-free protease inhibitor and PhosSTOP (Roche)) on ice for 30 mins. After filtering the extract with 30 μm CellTrics filters (Sysmex), nuclei were isolated by centrifugation at 4 °C and 1000g for 10 min. Nuclei were washed twice with N2 buffer (15 mM Tris-HCl, pH 7.5, 60 mM KCl, 15 mM NaCl, 5 mM MgCl2, 1 mM CaCl2, and 1 mM DTT, with Complete Mini EDTA-free protease inhibitor and PhosSTOP) and subsequently incubated with 600 μL of N3 buffer (15 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM MgCl2, 1 mM CaCl2, and 1 mM DTT, with Complete Mini EDTA-free protease inhibitor and PhosSTOP) for 30 min. The samples were centrifuged at 12,800g and 4 °C for 15 min to yield the soluble and insoluble pellet fractions. Soluble fractions were concentrated by vortexing with StrataClean resin (Agilent) for 1 min. Samples were boiled at 95 °C in SDS loading buffer and used for Western blot experiments. Anti-DDM1, anti-RFP (Rockland; 600-401-379) and anti-H3 (Abcam; ab1791) antibodies were used for detection of endogenous DDM1, DDM1-mCherry, and H3, respectively.
Microscopy
Immunofluorescence experiments for leaf nuclei were performed using 3-week-old leaves as previously described 115. Monoclonal antibodies of anti-H3K27me1 (Active Motif; 61015) were used as primary antibodies and goat anti-mouse Alexa Fluor 488 (Thermo Fisher Scientific; A-10680) was used as secondary antibody. DAPI (2 μg/mL final concentration) was used for nuclei staining and the samples were mounted with Prolong Diamond (Thermo Fisher Scientific). DDM1-GFP, DDM1-mCherry, HTR3-GFP, and HTR5-RFP were observed with a Zeiss 710 confocal microscope. Live imaging data of DDM1-GFP was acquired using a Perkin-Elmer UltraVIEW VoX confocal microscope.
Expression and purification of DDM1 protein
His-TEV-DDM1 and His-TEV-DDM1(Δ1–132) were transformed into the E.coli strain BL21-CodonPlus (DE3)-RIPL (Agilent) for large-scale expression using standard methods. Briefly, cultures were grown in Terrific Broth media supplemented with appropriate antibiotic(s) at 37°C to a culture density of approximately ODλ=600 nm of 1.2. Cultures were then cooled in an ice water bath for 15 minutes followed by induction of protein expression with 0.5 mM IPTG. Induction proceeded overnight at 16 °C with shaking at 220 rpm. Cells were harvested by centrifugation at 4000g for 30 minutes at 4 °C. The supernatant was discarded and the pelleted cells were taken for protein purification.
For Ni-NTA purification, cell pellets were resuspended in 20 mL lysis buffer (20 mM Tris, pH 8.0, 300 mM NaCl, 5 mM MgCl2, 10% glycerol, 1 mM TCEP, 20 mM imidazole) per liter culture. Protease inhibitors and 0.1% Triton-X were next added to the resuspension and the cells lysed by sonication. Turbo nuclease (Accelagen) was added to the cell lysate (2.5 units per mL of cell resuspension) and the lysate was then clarified by ultracentrifugation at roughly 100,000g for 30 minutes. The soluble supernatant was taken for affinity purification via batch binding with Ni-NTA resin (2 mL of beads per liter culture), pre-equilibrated with lysis buffer. Batch binding was performed for 2–3 hours at 4 °C with gentle agitation. The Ni-NTA beads were then collected by centrifugation at 1000g for 5 minutes, resuspended in lysis buffer, then transferred to a column for further washing and elution. Beads were washed with 20 column volumes of lysis buffer followed by elution of the target protein in lysis buffer supplemented with 100–250 mM imidazole.
To remove the affinity tag, TEV protease was added in a 1:20 mass ratio (protease:DDM1) and incubated overnight at 4 °C. In addition, DTT was added to a final concentration of 10 mM to limit aggregation. Protein was further purified using a HiTrap Heparin HP column (Cytiva/GE Healthcare Life Sciences). Digested protein was first diluted two-fold with low salt buffer (20 mM Tris, pH 8.0, 1 mM DTT) prior to loading the heparin column. The target protein was then eluted using a 25–75% gradient of high salt buffer (20 mM Tris, pH 8.0, 1 mM DTT, 1 M NaCl) over approximately 50 mL. Peak fractions were assessed by SDS-PAGE then selected and pooled for further purification.
Pooled fractions were concentrated to 500 μL and applied to a Superdex 200 increase 10/300 column (Cytiva/GE Healthcare Life Sciences). The protein was chromatographed over ~30 mL at a flow rate of 0.6 mL/min in a running buffer of 20 mM Tris, pH 8.0, 300 mM NaCl, 5 mM MgCl2, 1 mM TCEP. Peak fractions were assessed by SDS-PAGE. Fractions with highly-purified protein were concentrated, then taken for enzymatic assays and/or storage. For long-term storage the protein was flash frozen in liquid nitrogen, then kept at −80 °C. Typical yields were 1–2 mg of highly purified protein (>98% pure as assessed by SDS-PAGE) per liter culture.
DDM1 ATPase, remodeling, gel shift, and peptide-binding assays
DDM1 ATPase assays were performed in reaction buffer (10 mM Tris pH 7.5, 50 mM NaCl, 10 mM MgCl2, 20% Glycerol) containing various ATP concentrations and quantified using the ADP-Glo MAX Assay (Promega; Catalog No. V7001) as described previously 116. The double-stranded DNA substrate was prepared by PCR amplification of the Widom 601 DNA sequence described in the remodeling assays below (see Table S4 for primer sequence information). Methylated DNA was amplified by PCR in the presence of 5m-dCTP rather than dCTP (New England Biolabs). Additional experimental procedures followed the manufacturer’s guidelines. Luminescence was quantified using GloMax-Multi+ Detection System (Promega).
DDM1 nucleosome remodeling assays were performed with mononucleosomes. Histone octamers consisting of Arabidopsis H2A.W (AT5G59870), H3.3 (At5g10980), H3.1 (At1g09200), H2A (AT3G20670) and H2B (AT3G45980), and Xenopus H4 were assembled as described previously 117. Briefly, core histones were expressed in E. coli, solubilized from inclusion bodies, and purified by sequential anion and cation exchange chromatography before refolding into histone octamers and purifying by size exclusion chromatography. Nucleosomes were assembled by gradient dialysis against TE buffer at 4 °C overnight with 147 bp core Widom 601 DNA, with or without a a 60 bp-overhang (underlined), as indicated 5’-CTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGTGCATGTATTGAACAGCGACCTTGCCGGTGCCAGTCGGATAGTGTTCCGAGCTCCCACTCT-3’ 63. For remodeling assays, the reaction buffer contained 20 mM Tris-HCl, pH 8.0, 75 mM NaCl, 2 mM MgCl2, and 1 mM ATP. After adding DDM1 to Widom 601 + 60 bp nucleosome samples in a 2:1 ratio, the reactions were incubated at 25 °C and stopped by addition of 5 mM EDTA and excess plasmid DNA. Reaction samples were resolved by 6% native PAGE (37.5:1 acrylamide:bis-acrylamide) run in 0.5× TBE buffer and stained with SYBR Gold (Thermo Fisher Scientific). For gel shift assays, nucleosomes were assembled with 147 bp core Widom 601 DNA. In brief, DDM1 was mixed with nucleosomes in the binding buffer (20 mM Tris-HCl, pH 8.0, 75 mM NaCl, 2 mM MgCl2) and incubated for 30 min. The DDM1-nucleosome complex samples were resolved by 6% native PAGE in 0.5 × TBE (29:1 acrylamide:bis-acrylamide).
Peptide binding assays of purified His-TEV-DDM1 or His-TEV-DDM1[133-end] were measured using a Monolith NT.115 Pico running MO Control version 1.6 (NanoTemper Technologies). Assays were performed in PBS-T (137 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8m mM KH2PO4, 0.1% Tween-20) for DDM1 and PBS-T supplemented with 1mM ADP for DDM1[133-end]. His-label RED-tris-NTA (NanoTemper Technologies) labeled DDM1 or DDM1[133-end] (5 nM) was mixed with 16 serial dilutions of histone H4 peptides starting at 1 mM and loaded into microscale thermophoresis premium coated capillaries (NanoTemper Technologies). MST measurements were recorded at 23°C using 20% excitation power and 60% MST power. Measurements were performed in triplicate (except 133-end). Determination of the binding constant was performed using MO Affinity Analysis v.2.3.
Cryo-electron microscopy sample preparation
Purified DDM1 and reconstituted nucleosomes (H2A.W, H2B, H3.3, H4, and 147 bp DNA) were each desalted into binding buffer (10 mM HEPES, pH 7.5, 50 mM NaCl). DDM1 at 1.3 mg/mL and nucleosomes at ~0.16 mg/mL were then mixed in a 4:1 molar ratio and incubated at room temperature for 10 minutes. DDM1-nucleosome complexes were cross-linked with 0.05% glutaraldehyde for 15 minutes then quenched by the addition of 2 mM Tris, pH 8.0. After five minutes at room temperature, the slowly-hydrolyzable ATP analog ATP-γ-S and MgCl2 were added to final concentrations of 1 mM and 2 mM, respectively. The reaction was incubated at 4°C overnight.
For cryo-EM grid preparation, 4 μL samples at approximately 0.35 mg/mL were applied to glow-discharged Quantifoil 0.6/1 300 μm mesh copper grids. After a 10 s incubation at 25 °C and 95% humidity, samples were blotted for 2.5 s then plunged into liquid ethane using an Automatic Plunge Freezer EM GP2 (Leica).
Cryo-electron microscopy data acquisition
Data were acquired on a Titan Krios transmission electron microscope (ThermoFisher) operating at 300 keV. EPU data collection software version 2.10.0.5 (ThermoFisher) was used to collect micrographs at a nominal magnification of 81,000x (1.1 Å/pixel) and defocus range of −1.0 to −2.2 μm. Dose-fractionated movies were collected using a K3 direct electron detector (Gatan) operating in electron counting mode. In total, 30 frames were collected over a 4.8 s exposure. The exposure rate was 14.8 e−/Å2/s, which resulted in a cumulative exposure of approximately 71.2 e−/Å2. In total, 8,165 micrographs were collected.
Cryo-electron microscopy data processing
Real-time image processing (motion correction, CTF estimation, and particle picking) was performed concurrently with data collection using WARP version 1.0.9 96. Automated particle picking was performed with the BoxNet pretrained deep convolutional neural network bundle included with WARP that is implemented in TensorFlow. A particle diameter of 180 Å and a threshold score of 0.6 yielded 3,788,872 particle coordinates.
Of the particles collected during cryo-EM acquisition, nearly three-quarters were free nucleosomes. Classification and refinement were carried out in cryoSPARC v3.2.0+210831 97. Initial 2D classification showed distinct classes of nucleosomes both bound to and independent of DDM1. To isolate the DDM1-bound nucleosome particles, 2D classes were first manually inspected. Classes that clearly showed the presence of DDM1—typically top views—were preferentially selected (497,127 particles) for ab initio reconstruction of four, 3D classes using a 200,000 particle subset. The resulting models (one of which showing DDM1-bound nucleosome), were then used for 3D heterogenous refinement with the full particle set. The resulting DDM1-bound nucleosome class was then taken for iterative rounds of homogenous refinement, non-uniform refinement, and further filtering using the refined reconstruction together with DDM1-free nucleosome decoy classes. The final non-uniform refined reconstruction was generated from 215,066 particles and had a resolution of 3.2 Å according to the gold standard FSC.
Molecular model building and refinement
An atomic model of the SWI/SNF nucleosome complex (PDB: 6UXW) 118 and the AlphaFold prediction of DDM1 119 were used as initial references for model building in Coot version 0.9.2-pre 120. After the initial build was generated, density modification was performed using Resolve 121. Subsequent rounds of interactive model building and refinement were performed with Coot and Phenix version 1.19.2-4158-000 122, respectively. Secondary structure restraints for both the protein (helix and β-strand) and DNA (base-stacking and base-pairing) were used throughout refinement. Structure validation was conducted by MolProbity version 4.5.1 123. Data collection, processing, and model validation statistics are provided in Tables S7 and S8.
Molecular graphics
Figures of molecular models were generated using ChimeraX version 1.2.5 124. Electrostatic surface calculations were performed by APBS 100 with a solvent ion concentration of 0.15 M at 298 K using the PARSE force field. Superpositioning of structural homologs was performed by the DALI server 125. Conservation analysis was performed using the Consurf server 98.
Quantification and statistical analysis
The statistical details of analysis applied in this paper are provided alongside in the figure legends.
Supplementary Material
Acknowledgments
We thank Crisanto Gutierrez for providing H3.1-GFP and H3.3-RFP Arabidopsis reporter lines and Frédéric Berger for providing the htr4 htr5 htr8/+ and HTR13-CFP lines. We thank Eric Richards, Vincent Colot and Tetsuji Kakutani for discussions on the genetics of ddm1, and Cigall Kadoch, Filipe Borges and Jean-Sebastien Parent for helpful advice. We thank Joe Calarco (in memoriam) for the anti-DDM1 polyclonal antibodies. We acknowledge technical assistance for live imaging from Nour El-Amine, and informatics help from Leandro Quadrana (Ecole Normale Superieur, France). Research in the Martienssen laboratory is supported by the U.S. National Institutes of Health (NIH) grant R01 GM067014, the National Science Foundation Plant Genome Research Program, and the Howard Hughes Medical Institute. The authors acknowledge assistance from the Cold Spring Harbor Laboratory Shared Resources, which are funded in part by a Cancer Center Support grant (5PP30CA045508). This work was also supported by Grant #R35GM128661 from the National Institutes of Health to Y.J., the Wellcome Trust [104175/Z/14/Z], Sir Henry Dale Fellowship to P.V. and through funding from the European Research Council (ERC) under the European Union’s Horizon 2020 research and innovation program (ERC-STG grant agreement No. 639253 to P.V.). The Wellcome Centre for Cell Biology is supported by core funding from the Wellcome Trust [203149]. We are grateful to the Edinburgh Protein Production Facility (EPPF) for their support. The EPPF was supported by the Wellcome Trust through a Multi-User Equipment grant [101527/Z/13/Z]. LJ and RAM are Investigators of the Howard Hughes Medical Institute.
Footnotes
Competing interests
The authors declare no competing interests.
References
- 1.Vongs A., Kakutani T., Martienssen R.A., and Richards E.J. (1993). Arabidopsis thaliana DNA methylation mutants. Science (1979) 260, 1926–1928. 10.1126/science.8316832. [DOI] [PubMed] [Google Scholar]
- 2.Jeddeloh J.A., Stokes T.L., and Richards E.J. (1999). Maintenance of genomic methylation requires a SWI2/SNF2-like protein. Nat Genet 22, 94–97. 10.1038/8803. [DOI] [PubMed] [Google Scholar]
- 3.Lippman Z., Gendrel A.-V., Black M., Vaughn M.W., Dedhia N., McCombie W.R., Lavine K., Mittal V., May B., Kasschau K.D., et al. (2004). Role of transposable elements in heterochromatin and epigenetic control. Nature 430, 471–476. 10.1038/nature02651. [DOI] [PubMed] [Google Scholar]
- 4.Zhang X., Yazaki J., Sundaresan A., Cokus S., Chan S.W.-L., Chen H., Henderson I.R., Shinn P., Pellegrini M., Jacobsen S.E., et al. (2006). Genome-wide high-resolution mapping and functional analysis of DNA methylation in Arabidopsis. Cell 126, 1189–1201. 10.1016/j.cell.2006.08.003. [DOI] [PubMed] [Google Scholar]
- 5.Woo H.R., Dittmer T.A., and Richards E.J. (2008). Three SRA-domain methylcytosine-binding proteins cooperate to maintain global CpG methylation and epigenetic silencing in Arabidopsis. PLoS Genet 4. 10.1371/journal.pgen.1000156. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Woo H.R., Pontes O., Pikaard C.S., and Richards E.J. (2007). VIM1, a methylcytosine-binding protein required for centromeric heterochromatinization. Genes Dev 21, 267–277. 10.1101/gad.1512007. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7.Kankel M.W., Ramsey D.E., Stokes T.L., Flowers S.K., Haag J.R., Jeddeloh J.A., Riddle N.C., Verbsky M.L., and Richards E.J. (2003). Arabidopsis MET1 cytosine methyltransferase mutants. Genetics 163, 1109–1122. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Dennis K., Fan T., Geiman T., Yan Q., and Muegge K. (2001). Lsh, a member of the SNF2 family, is required for genome-wide methylation. Genes Dev 15, 2940. 10.1101/GAD.929101. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Dunican D.S., Cruickshanks H.A., Suzuki M., Semple C.A., Davey T., Arceci R.J., Greally J., Adams I.R., and Meehan R.R. (2013). Lsh regulates LTR retrotransposon repression independently of Dnmt3b function. Genome Biol 14, R146. 10.1186/GB-2013-14-12-R146. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Han M., Li J., Cao Y., Huang Y., Li W., Zhu H., Zhao Q., Han J.D.J., Wu Q., Li J., et al. (2020). A role for LSH in facilitating DNA methylation by DNMT1 through enhancing UHRF1 chromatin association. Nucleic Acids Res 48, 12116. 10.1093/NAR/GKAA1003. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Zhu H., Geiman T.M., Xi S., Jiang Q., Schmidtmann A., Chen T., Li E., and Muegge K. (2006). Lsh is involved in de novo methylation of DNA. EMBO Journal 25, 335–345. 10.1038/SJ.EMBOJ.7600925. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Bostick M., Kim J.K., Estève P.-O., Clark A., Pradhan S., and Jacobsen S.E. (2007). UHRF1 plays a role in maintaining DNA methylation in mammalian cells. Science (1979) 317, 1760–1764. 10.1126/science.1147939. [DOI] [PubMed] [Google Scholar]
- 13.Nishiyama A., Yamaguchi L., Sharif J., Johmura Y., Kawamura T., Nakanishi K., Shimamura S., Arita K., Kodama T., Ishikawa F., et al. (2013). Uhrf1-dependent H3K23 ubiquitylation couples maintenance DNA methylation and replication. Nature 502, 249–253. 10.1038/nature12488. [DOI] [PubMed] [Google Scholar]
- 14.Sharif J., Muto M., Takebayashi S.-I., Suetake I., Iwamatsu A., Endo T.A., Shinga J., Mizutani-Koseki Y., Toyoda T., Okamura K., et al. (2007). The SRA protein Np95 mediates epigenetic inheritance by recruiting Dnmt1 to methylated DNA. Nature 450, 908–912. 10.1038/nature06397. [DOI] [PubMed] [Google Scholar]
- 15.Hermann A., Goyal R., and Jeltsch A. (2004). The Dnmt1 DNA-(cytosine-C5)-methyltransferase Methylates DNA Processively with High Preference for Hemimethylated Target Sites. Journal of Biological Chemistry 279, 48350–48359. 10.1074/JBC.M403427200. [DOI] [PubMed] [Google Scholar]
- 16.Clément C., Orsi G.A., Gatto A., Boyarchuk E., Forest A., Hajj B., Miné-Hattab J., Garnier M., Gurard-Levin Z.A., Quivy J.P., et al. (2018). High-resolution visualization of H3 variants during replication reveals their controlled recycling. Nat Commun 9. 10.1038/S41467-018-05697-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Szenker E., Ray-Gallet D., and Almouzni G. (2011). The double face of the histone variant H3.3. Cell Res 21, 421. 10.1038/CR.2011.14. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Tagami H., Ray-Gallet D., Almouzni G., and Nakatani Y. (2004). Histone H3.1 and H3.3 Complexes Mediate Nucleosome Assembly Pathways Dependent or Independent of DNA Synthesis. Cell 116, 51–61. 10.1016/S0092-8674(03)01064-X. [DOI] [PubMed] [Google Scholar]
- 19.Zhou C.Y., Johnson S.L., Gamarra N.I., and Narlikar G.J. (2016). Mechanisms of ATP-Dependent Chromatin Remodeling Motors. Annu Rev Biophys 45, 153. 10.1146/ANNUREV-BIOPHYS-051013-022819. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Pradhan S.K., Su T., Yen L., Jacquet K., Huang C., Côté J., Kurdistani S.K., and Carey M.F. (2016). EP400 Deposits H3.3 into Promoters and Enhancers During Gene Activation. Mol Cell 61, 27. 10.1016/J.MOLCEL.2015.10.039. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Hopfner K.P., Gerhold C.B., Lakomek K., and Wollmann P. (2012). Swi2/Snf2 remodelers: hybrid views on hybrid molecular machines. Curr Opin Struct Biol 22, 225. 10.1016/J.SBI.2012.02.007. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22.Ryan D.P., and Owen-Hughes T. (2011). Snf2-family proteins: chromatin remodellers for any occasion. Curr Opin Chem Biol 15, 649. 10.1016/J.CBPA.2011.07.022. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23.Konev A.Y., Tribus M., Sung Y.P., Podhraski V., Chin Y.L., Emelyanov A. V., Vershilova E., Pirrotta V., Kadonaga J.T., Lusser A., et al. (2007). The CHD1 motor protein is required for deposition of histone variant H3.3 into chromatin in vivo. Science 317, 1087. 10.1126/SCIENCE.1145339. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Reyes A.A., Marcum R.D., and He Y. (2021). Structure and Function of ATP-dependent Chromatin Remodeling Complexes. J Mol Biol 433, 166929. 10.1016/J.JMB.2021.166929. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Narlikar G.J., Fan H.Y., and Kingston R.E. (2002). Cooperation between Complexes that Regulate Chromatin Structure and Transcription. Cell 108, 475–487. 10.1016/S0092-8674(02)00654-2. [DOI] [PubMed] [Google Scholar]
- 26.Brzeski J., and Jerzmanowski A. (2003). Deficient in DNA methylation 1 (DDM1) defines a novel family of chromatin-remodeling factors. J Biol Chem 278, 823–828. 10.1074/jbc.M209260200. [DOI] [PubMed] [Google Scholar]
- 27.Jenness C., Giunta S., Müller M.M., Kimura H., Muir T.W., and Funabiki H. (2018). HELLS and CDCA7 comprise a bipartite nucleosome remodeling complex defective in ICF syndrome. Proc Natl Acad Sci U S A 115, E876–E885. 10.1073/PNAS.1717509115/-/DCSUPPLEMENTAL. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Teixeira F.K., Heredia F., Sarazin A., Roudier F., Boccara M., Ciaudo C., Cruaud C., Poulain J., Berdasco M., Fraga M.F., et al. (2009). A role for RNAi in the selective correction of DNA methylation defects. Science (1979) 323, 1600–1604. 1165313 [pii]\r10.1126/science.1165313. [DOI] [PubMed] [Google Scholar]
- 29.Lyons D.B., and Zilberman D. (2017). DDM1 and Lsh remodelers allow methylation of DNA wrapped in nucleosomes. Elife 6. 10.7554/eLife.30674. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Martire S., and Banaszynski L.A. (2020). The roles of histone variants in fine-tuning chromatin organization and function. Nat Rev Mol Cell Biol 21, 522. 10.1038/S41580-020-0262-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.Roudier F., Ahmed I., Bérard C., Sarazin A., Mary-Huard T., Cortijo S., Bouyer D., Caillieux E., Duvernois-Berthet E., Al-Shikhley L., et al. (2011). Integrative epigenomic mapping defines four main chromatin states in Arabidopsis. EMBO J 30, 1928–1938. 10.1038/emboj.2011.103. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.Bourguet P., Picard C.L., Yelagandula R., Pélissier T., Lorković Z.J., Feng S., Pouch-Pélissier M.N., Schmücker A., Jacobsen S.E., Berger F., et al. (2021). The histone variant H2A.W and linker histone H1 co-regulate heterochromatin accessibility and DNA methylation. Nature Communications 2021 12:1 12, 1–12. 10.1038/s41467-021-22993-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Choi J., Lyons D.B., Kim M.Y., Moore J.D., and Zilberman D. (2020). DNA Methylation and Histone H1 Jointly Repress Transposable Elements and Aberrant Intragenic Transcripts. Mol Cell 77, 310–323.e7. 10.1016/J.MOLCEL.2019.10.011. [DOI] [PubMed] [Google Scholar]
- 34.Osakabe A., Jamge B., Axelsson E., Montgomery S.A., Akimcheva S., Kuehn A.L., Pisupati R., Lorković Z.J., Yelagandula R., Kakutani T., et al. (2021). The chromatin remodeler DDM1 prevents transposon mobility through deposition of histone variant H2A.W. Nature Cell Biology 2021 23:4 23, 391–400. 10.1038/s41556-021-00658-1. [DOI] [PubMed] [Google Scholar]
- 35.Zemach A., Kim M.Y., Hsieh P.H., Coleman-Derr D., Eshed-Williams L., Thao K., Harmer S.L., and Zilberman D. (2013). The arabidopsis nucleosome remodeler DDM1 allows DNA methyltransferases to access H1-containing heterochromatin. Cell 153, 193–205. 10.1016/j.cell.2013.02.033. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 36.Ni K., and Muegge K. (2021). LSH catalyzes ATP-driven exchange of histone variants macroH2A1 and macroH2A2. Nucleic Acids Res 49, 8024. 10.1093/NAR/GKAB588. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Ni K., Ren J., Xu X., He Y., Finney R., Braun S.M.G., Hathaway N.A., Crabtree G.R., and Muegge K. (2020). LSH mediates gene repression through macroH2A deposition. Nat Commun 11. 10.1038/S41467-020-19159-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38.Jacob Y., Bergamin E., Donoghue M.T.A., Mongeon V., Voigt P., Underwood C.J., Brunzelle J.S., Michaels S.D., Reinberg D., Couture J., et al. (2014). Selective methylation of histone H3 variant H3.1 regulates heterochromatin replication. Science (1979) 343, 1249–1253. 10.1126/science.1248357.Selective. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.Otero S., Desvoyes B., Peiró R., and Gutierrez C. (2016). Histone H3 Dynamics Reveal Domains with Distinct Proliferation Potential in the Arabidopsis Root. Plant Cell 28, 1361. 10.1105/TPC.15.01003. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40.Stroud H., Otero S., Desvoyes B.B., Ramírez-Parra E., Jacobsen S.E., Gutierrez C., Ramirez-Parra E., Jacobsen S.E., and Gutierrez C. (2012). Genome-wide analysis of histone H3.1 and H3.3 variants in Arabidopsis thaliana. Proc Natl Acad Sci U S A 109, 5370–5375. 10.1073/pnas.1203145109/-/DCSupplemental.www.pnas.org/cgi/doi/10.1073/pnas.1203145109. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Davarinejad H., Huang Y.C., Mermaz B., LeBlanc C., Poulet A., Thomson G., Joly V., Muñoz M., Arvanitis-Vigneault A., Valsakumar D., et al. (2022). The histone H3.1 variant regulates TONSOKU-mediated DNA repair during replication. Science 375, 1281. 10.1126/SCIENCE.ABM5320. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 42.Stroud H., Hale C.J., Feng S., Caro E., Jacob Y., Michaels S.D., and Jacobsen S.E. (2012). DNA Methyltransferases Are Required to Induce Heterochromatic Re-Replication in Arabidopsis. PLoS Genet 8, 1002808. 10.1371/JOURNAL.PGEN.1002808. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Kawakatsu T., Stuart T., Valdes M., Breakfield N., Schmitz R.J., Nery J.R., Urich M.A., Han X., Lister R., Benfey P.N., et al. (2016). Unique cell-type-specific patterns of DNA methylation in the root meristem. Nat Plants, 16058. 10.1038/nplants.2016.58. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44.Slotkin R.K., Vaughn M., Tanurdzic M., Borges F., Becker J.D., Feijó J.A., and Martienssen R.A. (2009). Epigenetic reprogramming and small RNA silencing of transposable elements in pollen. Cell 136, 461–472. 10.1016/j.cell.2008.12.038.Epigenetic. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Geiman T.M., and Muegge K. (2000). Lsh, an SNF2/helicase family member, is required for proliferation of mature T lymphocytes. Proc Natl Acad Sci U S A 97, 4772. 10.1073/PNAS.97.9.4772. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46.Ikeda Y., Pélissier T., Bourguet P., Becker C., Pouch-Pélissier M.N., Pogorelcnik R., Weingartner M., Weigel D., Deragon J.M., and Mathieu O. (2017). Arabidopsis proteins with a transposon-related domain act in gene silencing. Nat Commun 8. 10.1038/NCOMMS15122. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 47.Borg M., Jacob Y., Susaki D., LeBlanc C., Buendía D., Axelsson E., Kawashima T., Voigt P., Boavida L., Becker J., et al. (2020). Targeted reprogramming of H3K27me3 resets epigenetic memory in plant paternal chromatin. Nature Cell Biology 2020 22:6 22, 621–629. 10.1038/s41556-020-0515-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 48.Quadrana L., and Colot V. (2016). Plant transgenerational epigenetics. Annu Rev Genet 50, 467–491. 10.1146/annurev-genet-120215-035254. [DOI] [PubMed] [Google Scholar]
- 49.Jeddeloh J.A., Bender J., and Richards E.J. (1998). The DNA methylation locus DDM1 is required for maintenance of gene silencing in Arabidopsis. Genes Dev, 1714–1725. 10.1101/gad.12.11.1714. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50.Dunican D.S., Pennings S., and Meehan R.R. (2015). Lsh Is Essential for Maintaining Global DNA Methylation Levels in Amphibia and Fish and Interacts Directly with Dnmt1. Biomed Res Int 2015. 10.1155/2015/740637. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 51.Myant K., and Stancheva I. (2008). LSH Cooperates with DNA Methyltransferases To Repress Transcription. Mol Cell Biol 28, 215. 10.1128/MCB.01073-07. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 52.Schermelleh L., Haemmer A., Spada F., Rösing N., Meilinger D., Rothbauer U., Cardoso C.M., and Leonhardt H. (2007). Dynamics of Dnmt1 interaction with the replication machinery and its role in postreplicative maintenance of DNA methylation. Nucleic Acids Res 35, 4301. 10.1093/NAR/GKM432. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53.Yan Q., Cho E., Lockett S., and Muegge K. (2003). Association of Lsh, a Regulator of DNA Methylation, with Pericentromeric Heterochromatin Is Dependent on Intact Heterochromatin. Mol Cell Biol 23, 8416. 10.1128/MCB.23.23.8416-8428.2003. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54.Borg M., Papareddy R.K., Dombey R., Axelsson E., Nodine M.D., Twell D., and Berger F. (2021). Epigenetic reprogramming rewires transcription during the alternation of generations in Arabidopsis. Elife 10, 1–66. 10.7554/ELIFE.61894. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 55.Wollmann H., Stroud H., Yelagandula R., Tarutani Y., Jiang D., Jing L., Jamge B., Takeuchi H., Holec S., Nie X., et al. (2017). The histone H3 variant H3.3 regulates gene body DNA methylation in Arabidopsis thaliana. Genome Biol, 1–10. 10.1186/s13059-017-1221-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 56.Duc C., Benoit M., Le Goff S., Simon L., Poulet A., Cotterell S., Tatout C., and Probst A. V. (2015). The histone chaperone complex HIR maintains nucleosome occupancy and counterbalances impaired histone deposition in CAF-1 complex mutants. The Plant Journal 81, 707–722. 10.1111/tpj.12758. [DOI] [PubMed] [Google Scholar]
- 57.Nie X., Wang H., Li J., Holec S., and Berger F. (2014). The HIRA complex that deposits the histone H3.3 is conserved in Arabidopsis and facilitates transcriptional dynamics. Biol Open 3, 794–802. 10.1242/bio.20148680. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 58.Baumann C., Viveiros M.M., and De La Fuente R. (2010). Loss of Maternal ATRX Results in Centromere Instability and Aneuploidy in the Mammalian Oocyte and Pre-Implantation Embryo. PLoS Genet 6, 1001137. 10.1371/JOURNAL.PGEN.1001137. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 59.Ratnakumar K., and Bernstein E. (2013). ATRX: The case of a peculiar chromatin remodeler. Epigenetics 8, 3. 10.4161/EPI.23271. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 60.Ritchie K., Seah C., Moulin J., Isaac C., Dick F., and Bérubé N.G. (2008). Loss of ATRX leads to chromosome cohesion and congression defects. J Cell Biol 180, 315. 10.1083/JCB.200706083. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 61.Voon H.P.J., Hughes J.R., Rode C., DeLaRosa-Velázquez I.A., Jenuwein T., Feil R., Higgs D.R., and Gibbons R.J. (2015). ATRX Plays a Key Role in Maintaining Silencing at Interstitial Heterochromatic Loci and Imprinted Genes. Cell Rep 11, 405. 10.1016/J.CELREP.2015.03.036. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 62.Duc C., Benoit M., Détourné G., Simon L., Poulet A., Jung M., Veluchamy A., Latrasse D., Le Goff S., Cotterell S., et al. (2017). Arabidopsis ATRX Modulates H3.3 Occupancy and Fine-Tunes Gene Expression. Plant Cell 29, 1773–1793. 10.1105/tpc.16.00877. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 63.Armache J.P., Gamarra N., Johnson S.L., Leonard J.D., Wu S., Narlikar G.J., and Cheng Y. (2019). Cryo-EM structures of remodeler-nucleosome intermediates suggest allosteric control through the nucleosome. Elife 8. 10.7554/ELIFE.46057. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 64.Li M., Xia X., Tian Y., Jia Q., Liu X., Lu Y., Li M., Li X., and Chen Z. (2019). Mechanism of DNA translocation underlying chromatin remodelling by Snf2. Nature 2019 567:7748 567, 409–413. 10.1038/s41586-019-1029-2. [DOI] [PubMed] [Google Scholar]
- 65.Wagner F.R., Dienemann C., Wang H., Stützer A., Tegunov D., Urlaub H., and Cramer P. (2020). Structure of SWI/SNF chromatin remodeler RSC bound to a nucleosome. Nature 579, 448. 10.1038/S41586-020-2088-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 66.Yan L., Wu H., Li X., Gao N., and Chen Z. (2019). Structures of the ISWI–nucleosome complex reveal a conserved mechanism of chromatin remodeling. Nature Structural & Molecular Biology 2019 26:4 26, 258–266. 10.1038/s41594-019-0199-9. [DOI] [PubMed] [Google Scholar]
- 67.Farnung L., Vos S.M., Wigge C., and Cramer P. (2017). Nucleosome-Chd1 structure and implications for chromatin remodelling. Nature 550, 539. 10.1038/NATURE24046. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 68.Liu X., Li M., Xia X., Li X., and Chen Z. (2017). Mechanism of chromatin remodelling revealed by the Snf2-nucleosome structure. Nature 2017 544:7651 544, 440–445. 10.1038/nature22036. [DOI] [PubMed] [Google Scholar]
- 69.Choi S.H., Ryu T.H., Kim J. Il, Lee S. Lee S.S., and Kim J.H. (2019). Mutation in DDM1 inhibits the homology directed repair of double strand breaks. PLoS One 14. 10.1371/JOURNAL.PONE.0211878. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 70.Zhang Q., Li Y., Xu T., Srivastava A.K., Wang D., Zeng L., Yang L., He L., Zhang H., Zheng Z., et al. (2016). The chromatin remodeler DDM1 promotes hybrid vigor by regulating salicylic acid metabolism. Cell Discov 2, 16027. 10.1038/celldisc.2016.27. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 71.Galvani A., Courbeyrette R., Agez M., Ochsenbein F., Mann C., and Thuret J.-Y. (2008). In Vivo Study of the Nucleosome Assembly Functions of ASF1 Histone Chaperones in Human Cells. Mol Cell Biol 28, 3672. 10.1128/MCB.00510-07. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 72.Shibahara K.I., and Stillman B. (1999). Replication-Dependent Marking of DNA by PCNA Facilitates CAF-1-Coupled Inheritance of Chromatin. Cell 96, 575–585. 10.1016/S0092-8674(00)80661-3. [DOI] [PubMed] [Google Scholar]
- 73.Lungu C., Muegge K., Jeltsch A., and Jurkowska R.Z. (2015). An ATPase-Deficient Variant of the SNF2 Family Member HELLS Shows Altered Dynamics at Pericentromeric Heterochromatin. J Mol Biol 427, 1903. 10.1016/J.JMB.2015.03.014. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 74.Colomé-Tatché M., Cortijo S., Wardenaar R., Morgado L., Lahouze B., Sarazin A., Etcheverry M., Martin A., Feng S., Duvernois-Berthet E., et al. (2012). Features of the Arabidopsis recombination landscape resulting from the combined loss of sequence variation and DNA methylation. Proc Natl Acad Sci U S A 109, 16240–16245. 10.1073/pnas.1212955109. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 75.Soppe W.J.J., Jasencakova Z., Houben A., Kakutani T., Meister A., Huang M.S., Jacobsen S.E., Schubert I., and Fransz P.F. (2002). DNA methylation controls histone H3 lysine 9 methylation and heterochromatin assembly in Arabidopsis. EMBO J 21, 6549–6559. 10.1093/emboj/cdf657. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 76.Earley K.W., Shook M.S., Brower-Toland B., Hicks L., and Pikaard C.S. (2007). In vitro specificities of Arabidopsis co-activator histone acetyltransferases: Implications for histone hyperacetylation in gene activation. The Plant Journal 52, 615–626. 10.1111/j.1365-313X.2007.03264.x. [DOI] [PubMed] [Google Scholar]
- 77.Borges F., Donoghue M.T.A., LeBlanc C., Wear E.E., Tanurdžić M., Berube B., Brooks A., Thompson W.F., Hanley-Bowdoin L., and Martienssen R.A. (2021). Loss of small RNA-directed DNA methylation in the plant cell cycle promotes germline reprogramming and somaclonal variation. Curr Biol 31, 591. 10.1016/J.CUB.2020.10.098. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 78.Zhao T., Lu J., Zhang H., Xue M., Pan J., Ma L., Berger F., and Jiang D. (2022). Histone H3.3 deposition in seed is essential for the post-embryonic developmental competence in Arabidopsis. Nat Commun 13. 10.1038/S41467-022-35509-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 79.Clapier C.R., and Cairns B.R. (2012). Regulation of ISWI involves inhibitory modules antagonized by nucleosomal epitopes. Nature 492, 280. 10.1038/NATURE11625. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 80.Gamarra N., Johnson S.L., Trnka M.J., Burlingame A.L., and Narlikar G.J. (2018). The nucleosomal acidic patch relieves auto-inhibition by the ISWI remodeler SNF2h. Elife 7. 10.7554/ELIFE.35322. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 81.Shi L., Wang J., Hong F., Spector D.L., and Fang Y. (2011). Four amino acids guide the assembly or disassembly of Arabidopsis histone H3.3-containing nucleosomes. Proc Natl Acad Sci U S A 108, 10574–10578. 10.1073/PNAS.1017882108/-/DCSUPPLEMENTAL. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 82.Schmitz M.L., Higgins J.M.G., and Seibert M. (2020). Priming chromatin for segregation: functional roles of mitotic histone modifications. Cell Cycle 19, 625. 10.1080/15384101.2020.1719585. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 83.Ratnakumar K., Duarte L.F., LeRoy G., Hasson D., Smeets D., Vardabasso C., Bönisch C., Zeng T., Xiang B., Zhang D.Y., et al. (2012). ATRX-mediated chromatin association of histone variant macroH2A1 regulates α-globin expression. Genes Dev 26, 433. 10.1101/GAD.179416.111. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 84.Drané P., Ouararhni K., Depaux A., Shuaib M., and Hamiche A. (2010). The death-associated protein DAXX is a novel histone chaperone involved in the replication-independent deposition of H3.3. Genes Dev 24, 1253. 10.1101/GAD.566910. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 85.Wang H., Jiang D., Axelsson E., Lorković Z.J., Montgomery S., Holec S., Pieters B.J.G.E., Al Temimi A.H.K., Mecinović J., and Berger F. (2018). LHP1 Interacts with ATRX through Plant-Specific Domains at Specific Loci Targeted by PRC2. Mol Plant 11, 1038–1052. 10.1016/J.MOLP.2018.05.004. [DOI] [PubMed] [Google Scholar]
- 86.Chittori S., Hong J., Bai Y., and Subramaniam S. (2019). Structure of the primed state of the ATPase domain of chromatin remodeling factor ISWI bound to the nucleosome. Nucleic Acids Res 47, 9400. 10.1093/NAR/GKZ670. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 87.Liu X., Yu C.W., Duan J., Luo M., Wang K., Tian G., Cui Y., and Wu K. (2012). HDA6 Directly Interacts with DNA Methyltransferase MET1 and Maintains Transposable Element Silencing in Arabidopsis. Plant Physiol 158, 119. 10.1104/PP.111.184275. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 88.To T.K., Kim J.M., Matsui A., Kurihara Y., Morosawa T., Ishida J., Tanaka M., Endo T., Kakutani T., Toyoda T., et al. (2011). Arabidopsis HDA6 regulates locus-directed heterochromatin silencing in cooperation with met1. PLoS Genet 7. 10.1371/journal.pgen.1002055. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 89.To T.K., Yamasaki C., Oda S., Tominaga S., Kobayashi A., Tarutani Y., and Kakutani T. (2022). Local and global crosstalk among heterochromatin marks drives DNA methylome patterning in Arabidopsis. Nat Commun 13. 10.1038/S41467-022-28468-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 90.To T.K., Nishizawa Y., Inagaki S., Tarutani Y., Tominaga S., Toyoda A., Fujiyama A., Berger F., and Kakutani T. (2020). RNA interference-independent reprogramming of DNA methylation in Arabidopsis. Nature Plants 2020 6:12 6, 1455–1467. 10.1038/s41477-020-00810-z. [DOI] [PubMed] [Google Scholar]
- 91.Reinders J., Mirouze M., Nicolet J., and Paszkowski J. (2013). Parent-of-origin control of transgenerational retrotransposon proliferation in Arabidopsis. EMBO Rep 14, 823–828. 10.1038/embor.2013.95. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 92.Murphy P.J., Wu S.F., James C.R., Wike C.L., and Cairns B.R. (2018). Placeholder Nucleosomes Underlie Germline-to-Embryo DNA Methylation Reprogramming. Cell 172, 993–1006.e13. 10.1016/J.CELL.2018.01.022. [DOI] [PubMed] [Google Scholar]
- 93.Heard E., and Martienssen R.A. (2014). Transgenerational Epigenetic Inheritance: myths and mechanisms. Cell 157, 95. 10.1016/J.CELL.2014.02.045. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 94.Takahashi Y., Morales Valencia M., Yu Y., Ouchi Y., Takahashi K., Shokhirev M.N., Lande K., Williams A.E., Fresia C., Kurita M., et al. (2023). Transgenerational inheritance of acquired epigenetic signatures at CpG islands in mice. Cell 186, 715–731.e19. 10.1016/J.CELL.2022.12.047. [DOI] [PubMed] [Google Scholar]
- 95.Ramirez F., Ryan D.P., Gruning B., Bhardwaj V., Kilpert F., Richter A.S., Heyne S., Dundar F., and Manke T. (2016). deepTools2: a next generation web server for deep-sequencing data analysis. Nucleic Acids Res 44, 160–165. 10.1093/nar/gkw257. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 96.Tegunov D., and Cramer P. (2019). Real-time cryo–EM data pre-processing with Warp. Nat Methods 16, 1146. 10.1038/S41592-019-0580-Y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 97.Punjani A., Rubinstein J.L., Fleet D.J., and Brubaker M.A. (2017). cryoSPARC: algorithms for rapid unsupervised cryo-EM structure determination. Nature Methods 2017 14:3 14, 290–296. 10.1038/nmeth.4169. [DOI] [PubMed] [Google Scholar]
- 98.Ashkenazy H., Abadi S., Martz E., Chay O., Mayrose I., Pupko T., and Ben-Tal N. (2016). ConSurf 2016: an improved methodology to estimate and visualize evolutionary conservation in macromolecules. Nucleic Acids Res 44, W344. 10.1093/NAR/GKW408. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 99.Madeira F., Park Y.M., Lee J., Buso N., Gur T., Madhusoodanan N., Basutkar P., Tivey A.R.N., Potter S.C., Finn R.D., et al. (2019). The EMBL-EBI search and sequence analysis tools APIs in 2019. Nucleic Acids Res 47, W636. 10.1093/NAR/GKZ268. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 100.Jurrus E., Engel D., Star K., Monson K., Brandi J., Felberg L.E., Brookes D.H., Wilson L., Chen J., Liles K., et al. (2018). Improvements to the APBS biomolecular solvation software suite. Protein Sci 27, 112. 10.1002/PRO.3280. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 101.Brown N.P., Leroy C., and Sander C. (1998). MView: a web-compatible database search or multiple alignment viewer. Bioinformatics 14, 380–381. 10.1093/BIOINFORMATICS/14.4.380. [DOI] [PubMed] [Google Scholar]
- 102.Ishida T., and Kinoshita K. (2007). PrDOS: prediction of disordered protein regions from amino acid sequence. Nucleic Acids Res 35, W460. 10.1093/NAR/GKM363. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 103.LeBlanc C., Zhang F., Mendez J., Lozano Y., Chatpar K., Irish V.F., and Jacob Y. (2018). Increased efficiency of targeted mutagenesis by CRISPR/Cas9 in plants using heat stress. The Plant Journal 93, 377–386. 10.1111/TPJ.13782. [DOI] [PubMed] [Google Scholar]
- 104.Ingouff M., Rademacher S., Holec S., Šoljić L., Xin N., Readshaw A., Foo S.H., Lahouze B., Sprunck S., and Berger F. (2010). Zygotic Resetting of the HISTONE 3 Variant Repertoire Participates in Epigenetic Reprogramming in Arabidopsis. Current Biology 20, 2137–2143. 10.1016/J.CUB.2010.11.012. [DOI] [PubMed] [Google Scholar]
- 105.Parent J.-S., Cahn J., Herridge R.P., Grimanelli D., and Martienssen R.A. (2021). Small RNAs guide histone methylation in Arabidopsis embryos. Genes Dev 35, 841–846. 10.1101/gad.343871.120. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 106.Lee S.C., Ernst E., Berube B., Borges F., Parent J.S., Ledon P., Schorn A., and Martienssen R.A. (2020). Arabidopsis retrotransposon virus-like particles and their regulation by epigenetically activated small RNA. Genome Res 30, 576–588. 10.1101/GR.259044.119/-/DC1. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 107.Martin M. (2011). Cutadapt removes adapter sequences from high-throughput sequencing reads. EMBnet J 17, 10. 10.14806/ej.17.1.200. [DOI] [Google Scholar]
- 108.Langmead B., and Salzberg S.L. (2012). Fast gapped-read alignment with Bowtie 2. Nat Methods 9, 357–359. 10.1038/nmeth.1923. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 109.Li H., Handsaker B., Wysoker A., Fennell T., Ruan J., Homer N., Marth G., Abecasis G., and Durbin R. (2009). The Sequence Alignment/Map format and SAMtools. Bioinformatics 25, 2078–2079. 10.1093/bioinformatics/btp352. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 110.Wickham H. (2016). ggplot2: Elegant Graphics for Data Analysis (Springer-Verlag New York; ) 10.1007/978-0-387-98141-3. [DOI] [Google Scholar]
- 111.Hahne F., and Ivanek R. (2016). Visualizing genomic data using Gviz and bioconductor. Methods in Molecular Biology 1418, 335–351. 10.1007/978-1-4939-3578-9_16/FIGURES/11. [DOI] [PubMed] [Google Scholar]
- 112.Krueger F., and Andrews S.R. (2011). Bismark: a flexible aligner and methylation caller for Bisulfite-Seq applications. Bioinformatics 27, 1571. 10.1093/BIOINFORMATICS/BTR167. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 113.Catoni M., Tsang J.M.F., Greco A.P., and Zabet N.R. (2018). DMRcaller: a versatile R/Bioconductor package for detection and visualization of differentially methylated regions in CpG and non-CpG contexts. Nucleic Acids Res 46, e114. 10.1093/NAR/GKY602. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 114.Fass E., Shahar S., Zhao J., Zemach A., Avivi Y., and Grafi G. (2002). Phosphorylation of Histone H3 at Serine 10 Cannot Account Directly for the Detachment of Human Heterochromatin Protein 1γ from Mitotic Chromosomes in Plant Cells. Journal of Biological Chemistry 277, 30921–30927. 10.1074/JBC.M112250200. [DOI] [PubMed] [Google Scholar]
- 115.Yelagandula R., Stroud H., Holec S., Zhou K., Feng S., Zhong X., Muthurajan U.M., Nie X., Kawashima T., Groth M., et al. (2014). The histone variant H2A.W defines heterochromatin and promotes chromatin condensation in arabidopsis. Cell 158, 98–109. 10.1016/j.cell.2014.06.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 116.Stanton B.Z., Hodges C., Crabtree G.R., and Zhao K. (2017). A General Non-Radioactive ATPase Assay for Chromatin Remodeling Complexes. Curr Protoc Chem Biol 9, 1. 10.1002/CPCH.16. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 117.Voigt P., LeRoy G., Drury W.J., Zee B.M., Son J., Beck D.B., Young N.L., Garcia B.A., and Reinberg D. (2012). Asymmetrically Modified Nucleosomes. Cell 151, 181. 10.1016/J.CELL.2012.09.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 118.Han Y., Reyes A.A., Malik S., and He Y. (2020). Cryo-EM structure of SWI/SNF chromatin remodeling complex with nucleosome. Nature 579, 452. 10.1038/S41586-020-2087-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 119.Jumper J., Evans R., Pritzel A., Green T., Figurnov M., Ronneberger O., Tunyasuvunakool K., Bates R., Žídek A., Potapenko A., et al. (2021). Highly accurate protein structure prediction with AlphaFold. Nature 596, 583. 10.1038/S41586-021-03819-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 120.Emsley P., Lohkamp B., Scott W.G., and Cowtan K. (2010). Features and development of Coot. Acta Crystallogr D Biol Crystallogr 66, 486. 10.1107/S0907444910007493. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 121.Terwilliger T.C., Sobolev O. V., Afonine P. V., Adams P.D., and Read R.J. (2020). Density modification of cryo-EM maps. Acta Crystallogr D Struct Biol 76, 912. 10.1107/S205979832001061X. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 122.Liebschner D., Afonine P. V., Baker M.L., Bunkoczi G., Chen V.B., Croll T.I., Hintze B., Hung L.W., Jain S., McCoy A.J., et al. (2019). Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix. Acta Crystallogr D Struct Biol 75, 861. 10.1107/S2059798319011471. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 123.Williams C.J., Headd J.J., Moriarty N.W., Prisant M.G., Videau L.L., Deis L.N., Verma V., Keedy D.A., Hintze B.J., Chen V.B., et al. (2018). MolProbity: More and better reference data for improved all-atom structure validation. Protein Sci 27, 293. 10.1002/PRO.3330. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 124.Pettersen E.F., Goddard T.D., Huang C.C., Meng E.C., Couch G.S., Croll T.I., Morris J.H., and Ferrin T.E. (2021). UCSF ChimeraX: Structure visualization for researchers, educators, and developers. Protein Sci 30, 70. 10.1002/PRO.3943. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 125.Holm L. (2020). DALI and the persistence of protein shape. Protein Science 29, 128–140. 10.1002/PRO.3749. [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Supplementary Materials
Data Availability Statement
ChIP-sequencing and Bisulfite-sequencing data have been deposited at GEO and are publicly available as of the date of publication. Accession numbers are listed in the key resources table (GEO study: GSE231563).
This paper also analyzes existing, publicly available data. These accession numbers for the datasets are listed in the key resources table.
Coordinates and the cryo-electron microscopy map for the DDM1-nucleosome complex have been deposited in the Protein Data Bank and are publicly available as of the date of publication. Accession numbers are listed in the key resources table. (PDB: 7UX9; EMD-26855).
All original code has been deposited at https://github.com/martienssenlab/DDM1-manuscript
Any additional information required to reanalyze the data reported in this paper is available from the lead contact upon request.