Abstract
Molecular mimicry, a phenomenon in which microbial or environmental antigens resemble host antigens, has been proposed as a potential trigger for autoimmune responses. In this study, we employed a bioinformatics approach to investigate the role of molecular mimicry in Clostridioides difficile-caused infections and the induction of autoimmune disorders due to this phenomenon. Comparing proteomes of host and pathogen, we identified 23 proteins that exhibited significant sequence homology and were linked to autoimmune disorders. The disorders included rheumatoid arthritis, psoriasis, Alzheimer’s disease, etc., while infections included viral and bacterial infections like HIV, HCV, and tuberculosis. The structure of the homologous proteins was superposed, and RMSD was calculated to find the maximum deviation, while accounting for rigid and flexible regions. Two sequence mimics (antigenic, non-allergenic, and immunogenic) of ≥10 amino acids from these proteins were used to design a vaccine construct to explore the possibility of eliciting an immune response. Docking analysis of the top vaccine construct C2 showed favorable interactions with HLA and TLR-4 receptor, indicating potential efficacy. The B-cell and T-helper cell activity was also simulated, showing promising results for effective immunization against C. difficile infections. This study highlights the potential of C. difficile to trigger autoimmunity through molecular mimicry and vaccine design based on sequence mimics that trigger a defensive response.
Keywords: Clostridioides difficile, molecular mimicry, autoimmunity, vaccine design, bioinformatics, immune response, docking, pathogenesis
1. Introduction
Molecular mimicry refers to the phenomenon in which microbial or environmental antigens share structural or sequence similarities with host antigens [1]. This similarity can lead to a cross-reactive immune response, in which the immune system mistakenly targets self-tissues, resulting in autoimmune disorders [2]. The onset of autoimmune disorders due to molecular mimicry by pathogenic proteins or antigens presents an intriguing research area that investigates the possible connection between microbial infections and the onset of autoimmune responses [3,4]. Understanding the mechanisms by which molecular mimicry contributes to autoimmune disorders is crucial for developing targeted therapies and preventive strategies [5,6,7]. Numerous studies have investigated the molecular mimicry between human proteins associated with autoimmune disorders and pathogen-derived proteins [8,9,10,11,12,13]. These investigations have revealed several mechanisms that contribute to the initiation and perpetuation of autoimmune responses [14,15,16]. Specific pathogen proteins have been found to share sequence motifs with host proteins involved in autoimmune disorders, enabling the activation of autoreactive T cells [14,17]. Streptococcus pyogenes has been implicated in autoimmune diseases, such as rheumatic fever [18], glomerulonephritis [19], and multiple sclerosis [20]. Epstein–Barr virus has been connected with molecular-mimicry-mediated autoimmune disorders [21], like systemic lupus erythematosus [22,23], hepatitis [24], and multiple sclerosis [25]. These pathogens possess proteins that mimic self-antigens, leading to cross-reactivity with host tissues. Additionally, molecular mimicry has been observed in viral infections, such as the hepatitis C virus, in which viral proteins share sequence homology with host proteins involved in autoimmune liver diseases [26].
Techniques that can be employed to study molecular-mimicking peptides include phage display [27], and bioinformatics approaches include sequence alignment and molecular modeling [28], etc. Sequence alignment algorithms can identify regions of similarity or shared motifs between the two protein sequences [29]. Homology modeling and comparative protein structure prediction can be used to analyze the three-dimensional structures [30] of pathogen and host proteins. By comparing the structural features and folding patterns, potential mimicking regions can be identified. Predictive algorithms, such as NetMHC [31] and the Immune Epitope Database (IEDB) [32], can be utilized to identify potential epitopes within pathogen proteins that resemble host epitopes associated with autoimmune disorders [33]. To validate the cross-reactivity of pathogen and host proteins, enzyme-linked immunosorbent assay (ELISA) assays [34], Western blotting [35], and flow cytometry [36], etc., can be employed. These methods measure the binding of antibodies or T cells to specific antigens and can confirm the presence of molecular mimicry. Apart from these, animal models, such as transgenic mice expressing human proteins associated with autoimmune disorders, can be used to study the effects of pathogen infections and evaluate the development of autoimmune responses [37,38]. Disease models, such as in vitro models of tissue inflammation can also be employed to investigate the consequences of molecular mimicry [8,39]. By utilizing a combination of these techniques, researchers can gain insights into the occurrence and mechanisms of molecular mimicry, contributing to a better understanding of its role in autoimmune disorders and potentially guiding the development of therapeutic interventions.
Bioinformatics is a swift approach to identifying and characterizing the molecular-mimicry interactions between human proteins and pathogens [40,41,42]. Various bioinformatics tools and databases are utilized to analyze protein sequences, identify shared motifs or structural similarities, and predict antigenicity and immunogenicity [43]. Comparative genomics and proteomics approaches are employed to identify pathogen proteins that mimic host antigens associated with autoimmune disorders [44,45,46]. Previous studies have utilized bioinformatics approaches to uncover potential molecular-mimicry mechanisms between pathogens and host proteins by employing sequence alignment algorithms, structural modeling, and epitope prediction tools to assess the extent of mimicry and the potential immunological consequences [15,41,47]. Additionally, database-mining techniques have been used to establish links between identified mimicry interactions and autoimmune disorders [9,48,49,50]. Herein, we analyzed mimicry prediction and association with autoimmune disorders in Clostridioides difficile using in silico methods. By integrating bioinformatics analyses with experimental validation, this information contributes to our understanding of the complex interactions between pathogens and the human immune system, shedding light on the role of molecular mimicry in the development and progression of autoimmune disorders.
2. Material and Methods
2.1. Homology Analysis
The entire set of proteins from the human and C. difficile S-0253 (reference strain ASM1888508v1) samples was obtained from Uniprot (https://www.uniprot.org/proteomes/UP000005640 (accessed on 31 May 2023)) and the NCBI database (GenBank accession: CP076401.1; accessed 31 May 2023), respectively. To identify potential homologous proteins, a local installation of BLAST was utilized, applying a threshold of ≥50% identity and ≥100-bit score to retain proteins for further analysis [16].
2.2. Mimic Region Identification
To identify potential regions involved in mimicry, the proteins were aligned to uncover regions of similarity with a minimum length of 10 amino acids [16]. RMSD was employed as a scoring metric to assess the structural similarity of the peptides. To obtain the 3D structures of these proteins, the state-of-the-art-predicted protein structures from the AlphaFold database were utilized [51,52]. To compare and align the obtained structures, both iPBA [53] and TM-align [54] algorithms were employed. These tools are widely recognized tools in the field of structural biology, known for their accuracy in comparing protein structures and determining alignment based on various structural features. iPBA is a sequence-independent method that uses a fragment-based approach (for capturing large protein fold changes) [53], while TM-align superimposes 3D coordinates and aligns protein structures by dynamic programming method (for capturing small fold changes) [54]. The superposed structures diagram was generated through the TM-align module of the RCSB PDB structural alignment tool (https://www.rcsb.org/alignment (accessed on 21 June 2023)).
2.3. Autoimmunity Elucidation
In order to identify homologous protein pathways associated with autoimmune disorders or infection, relevant databases, such as pathDIP [55] and PHAROS (https://pharos.nih.gov/targets/ (accessed on 15 June 2023)) [56], were surveyed, along with a thorough review of the literature. PHAROS provides preprocessed data from the Target Central Resource Database (TCRD) on the input of the human gene name, Uniprot ID, etc. Linked disorders can be manually checked for autoimmunity. For pathDIP, all databases were selected with a minimum confidence level set to 0.99. The data type selected was extended pathway associations. The protein interaction set considered for analysis included both experimentally detected and computationally predicted protein–protein interactions (PPIs) using the full IID dataset. pathDIP serves as a comprehensive reference for signaling cascades across various species, consolidating key pathways sourced from major curated pathway databases [57]. The associations in pathDIP are based on a combination of computational predictions, experimentally confirmed interactions, orthology mapping, and inference of physical protein interactions. This database provides a valuable resource for exploring and understanding signaling pathways associated with autoimmune disorders and infection. Apart from this, a literature search was conducted to identify infection or autoimmune pathways linked with these homologs. A BLAST search (≥90% homology) of epitopes was also carried out against IEDB [32], and the relevant literature was identified for the listed infection or autoimmune disorder in the database.
2.4. Mimic-Based Vaccine Design
Identified mimics were subjected to antigenic analysis using VaxiJen server [58]. Apart from this, properties like allergenicity, toxicity, and other parameters useful in finalizing peptides for vaccine design were studied. ProtParam was used for physicochemical profiling [59], while AllerCatPro (https://allercatpro.bii.a-star.edu.sg/, accessed on 16 June 2023) and ToxinPred (https://webs.iiitd.edu.in/raghava/toxinpred/multi_submit.php, accessed on 16 June 2023) were used for allergenicity and toxicity analysis, respectively. IEDB was used for immunogenicity prediction [32]. Mimics were prioritized for vaccine design based on these parameters, the ability to induce immune response, and conservation across the strains. Conservations was determined by the ConSurf webserver (https://consurf.tau.ac.il/consurf_index.php; accessed on 17 June 2023).
The vaccine construct was designed according to the previously described methodology [16], using suitable linkers, adjuvants, and binders. They were subjected to another round of evaluation according to properties like antigenicity, toxicity, allergenicity, etc. The best antigenic and non-allergenic, non-toxic construct was tested for immune reaction incitation and cloned in a pET-28(a)+ vector (available at https://www.snapgene.com/plasmids/pet_and_duet_vectors_(novagen)/pET-28a(%2B); accessed on 18 June 2023) after reverse translation and codon optimization through the JCat tool [60]. C-ImmSimm [61] was used for the simulation of immune reaction. The parameters were as follows: Simulation_volume = 10; Num_steps = 1000; HLA = A0101, A0102, B0702, B0704, DRB1_0101, DRB1_0102; No_of_injections = 3; Time of injection (in days) = 1, 30); Adjuvant = 100. The first two injections on day 1 and 30 were of the vaccine. At day 240, the proteins phosphoribosylaminoimidazolecarboxamide formyltransferase and adenylosuccinate lyase were injected to test the reaction.
2.5. Immune Receptor Binding Study
To elicit protection, the vaccine protein should bind the immune receptors with good affinity [62,63]. To analyze this property, we constructed a 3D model of the vaccine construct with SWISS-MODEL [64], AlphaFold [51], and I-TASSER [65]. The best model was selected based on Ramachandran plot statistics from the assess module of SWISS-MODEL (https://swissmodel.expasy.org/assess (accessed on 20 June 2023)) and energy-minimized using Molecular Operating Environment (MOE) v2016 software. It was then docked with immune receptors of importance like TLR-4 receptor (PDB ID: 3FXI), HLA-A (PDB ID: 3OX8), and HLA-B (PDB ID: 4JQX), using the ClusPro server [66]. ClusPro focuses on predicting the overall shape and orientation of the protein–protein complex [67]. Prodigy [68] was used to predict the thermodynamic properties and binding affinities of the obtained docked complexes. An experimentally determined protein–protein interacting complex (PDB ID:4GIQ) was employed as a control to compare predicted values. This comparison allowed us to assess whether the binding scores were superior or inferior to the control, providing valuable insights into the efficacy and specificity of our vaccine design approach.
3. Results
3.1. Homologous Sequence Identification
In total, 23 proteins were obtained with significant similarity between human and C. difficile. F0F1 ATP synthase subunit beta had the highest number of peptide mimics (n = 11), followed by F0F1 ATP synthase subunit alpha (n = 7) and heat-shock protein DnaK (n = 6) (Table 1). These were superposed (Figure 1), and RMSD after structural superposition varied between iPBA and TM-align prediction. A possible reason for this is the algorithm difference, in which iPBA is tailored for flexible proteins or regions within a protein. Thus, it gave overall lower RMSD values compared to TM-align. However, both servers gave the lowest RMSD of 0.51 for the ATP-dependent Clp endopeptidase proteolytic subunit ClpP. This suggests a high degree of structural similarity between the human and bacterial homologs of this protein.
Table 1.
RMSD of C. difficile homologs in humans. Molecular mimics with length ≥ 10 are also shown.
| Serial no. | Name | UniProt ID of Human Homolog | NCBI Accession of Bacterial Homolog | Bacterial Protein Structure AlphaFold ID | No. of Similar Peptides (Length ≥ 10) | Molecular Mimic Region (Length ≥ 10) | Superposed Protein RMSD (iPBA) |
TM-Align RMSD |
|---|---|---|---|---|---|---|---|---|
| 1 | Molecular chaperone DnaK | P38646 | QWS53804.1 | Q182E8 | 6 | GIDLGTTNSCVAV RTTPSVVAFT INEPTAAALAYG LLLDVTPLSLGIET RNTTIPTKKSQ PQIEVTFDIDANGIV |
1.13 | 2.0 |
| 2 | Translation elongation factor 4 | Q8N442 | QWS53810.1 | Q182F4 | 3 | DHGKSTLADRL LNLIDTPGHVDF VLAKCYGGDI |
1.25 | 1.55 |
| 3 | Uracil-DNA glycosylase | P13051 | QWS53824.1 | Q182G9 | 0 | - | 1.01 | 1.13 |
| 4 | Acetyl-CoA C-acetyltransferase | Q9BWD1 | QWS54012.1 | Q18AR0 | 1 | NASGINDGAA | 0.70 | 0.75 |
| 5 | 3-oxoacid CoA-transferase subunit B | E9PDW2 | QWS54014.1 | Q183B1 | 0 | - | 1.00 | 1.74 |
| 6 | UDP-glucose 4-epimerase GalE | Q14376 | QWS54050.1 | Q183E8 | 3 | GGAGYIGSHT VFSSSATVYG DGTGVRDYIHV |
0.79 | 0.79 |
| 7 | V-type proton ATPase subunit B | P21281 | QWS54278.1 | Q184E3 | 2 | YAEALREVSAA THPIPDLTGYITEGQI |
0.81 | 0.91 |
| 8 | V-type ATP synthase catalytic unit A | P38606 | QWS54279.1 | Q184E7 | 2 | MPVAAREASIYTGIT MADSTSRWAEALRE |
0.98 | 1.03 |
| 9 | Phosphopyruvate hydratase | P09104 | QWS54488.1 | Q181T5 | 3 | LDSRGNPTVEV QEFMILPVGA VGDEGGFAPN |
0.87 | 1.39 |
| 10 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Q16740 | QWS54701.1 | Q180F0 | 1 | VVEQTGRGER | 0.51 | 0.51 |
| 11 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Q16740 | QWS54730.1 | Q180J6 | 0 | - | 0.56 | 0.56 |
| 12 | F0F1 ATP synthase subunit beta | P06576 | QWS54823.1 | Q184E3 | 11 | TGIKVVDLLAPY KGGKIGLFGGAGVGKTVLI G VGERTREGNDLY GQMNEPPGAR DNIFRFTQAGSEVSALLGR PSAVGYQPTLAT TKKGSITSVQA YVPADDLTDPAPATTF LGIYPAVDPL LQDIIAILGMDELS RARKIQRFLSQ |
2.11 | 2.73 |
| 13 | F0F1 ATP synthase subunit alpha | P25705 | QWS54825.1 | Q184E7 | 7 | IKEGDIVKRTG PIGRGQRELIIGDRQTGKTSI CIYVAIGQKRST YTIVVSATAS YDDLSKQAVAYR MSLLLRRPPGREAYPGDVFYLHSRLLERAAK IETQAGDVSAYIPTNVISITDGQI |
1.52 | 2.69 |
| 14 | Elongation factor Tu | P49411 | QWS55098.1 | Q18CE4 | 3 | GTIGHVDHGKTTLTAAITK DCPGHADYVKNMITG DGPMPQTREH |
0.98 | 1.12 |
| 15 | Elongation factor Tu | P49411 | QWS55112.1 | Q18CE4 | 3 | GTIGHVDHGKTTLTAAITK DCPGHADYVKNMITG DGPMPQTREH |
0.98 | 1.12 |
| 16 | Methionine adenosyltransferase | P31153 | QWS55174.1 | Q18CL7 | 4 | EGHPDKICDQISD RFVIGGPQGD HGGGAFSGKD TKVDRSAAYAAR |
0.72 | 0.93 |
| 17 | Chaperonin GroEL | P10809 | QWS55239.1 | Q18CT5 | 3 | AGDGTTTATVLA VVAVKAPGFGD DALNATRAAVEEGIV |
1.22 | 3.61 |
| 18 | Isocitrate/isopropylmalate dehydrogenase family protein | P50213 | QWS55807.1 | Q18A33 | 5 | VTLIPGDGIGPE VMPNLYGDILSDL AGDGTTTATVLA VVAVKAPGFGD DALNATRAAVEEGIV |
0.89 | 1.48 |
| 19 | Phosphoribosylaminoimidazolecarboxamide formyltransferase | P31939 | QWS55813.1 | Q18A34 | 5 | WQLVKELKEA SFKHVSPAGAAVG REVSDGIIAPGY KYTQSNSVCYAK GAGQQSRIHCTRLAG |
0.73 | 1.23 |
| 20 | Acyl-CoA dehydrogenase | P16219 | QWS55947.1 | Q18AQ1 | 2 | LIFEDCRIPK ITEIYEGTSE |
0.72 | 0.99 |
| 21 | Acetyl-CoA C-acetyltransferase | Q9BWD1 | QWS55952.1 | Q18AR0 | 2 | NASGINDGAA | 0.70 | 0.75 |
| 22 | Fe-S cluster assembly scaffold protein NifU | Q9H1K1 | QWS56138.1 | Q18BE3 | 2 | GCGSAIASSS | 1.01 | 1.39 |
| 23 | Adenylosuccinate lyase | P30566 | QWS56192.1 | Q18BJ9 | 2 | RGVKGTTGTQASFL YKRNPMRSER |
0.81 | 0.94 |
Figure 1.
Superposed structures of the C. difficile and human homologous proteins. (A) Molecular chaperone DnaK; (B) Translation elongation factor 4; (C) Uracil-DNA glycosylase; (D) Acetyl-CoA C-acetyltransferase; (E) 3-oxoacid CoA-transferase subunit B; (F) UDP-glucose 4-epimerase GalE; (G) V-type proton ATPase subunit B; (H) V-type ATP synthase catalytic unit A; (I) Phosphopyruvate hydratase; (J) ATP-dependent Clp endopeptidase proteolytic subunit ClpP; (K) ATP-dependent Clp endopeptidase proteolytic subunit ClpP; (L) F0F1 ATP synthase subunit beta. Due to space constraints, the first 12 (Table 1) of the 23 proteins are shown here. Human homologs are shown in brown and bacterial proteins are shown in blue.
3.2. Autoimmunity Prediction
PHAROS and PATHDIP database scan revealed several autoimmune diseases linked with the human homologous sequences of C. difficile (Table 2). ATP-dependent Clp protease proteolytic subunit and elongation factor Tu had two copies, so homologs were removed from database mining. For the rest of the homologs, the most commonly identified infection was tuberculosis (for DnaK, V-type ATP synthase, and ClpP) and the most commonly identified autoimmune disease was rheumatoid arthritis (for chaperones DnaK and GroEL, elongation factor tu, Translation elongation factor 4, 3-oxoacid CoA-transferase subunit B, V-type proton ATPase, phosphopyruvate hydratase, Phosphoribosylaminoimidazolecarboxamide formyltransferase, and NifU).
Table 2.
Autoimmune pathways of the selected homologs.
| Serial no. | Protein Homolog | PHAROS | PATHDIP | Literature | ||||
|---|---|---|---|---|---|---|---|---|
| Autoimmunity Pathway | Infection Pathway | Autoimmune Pathway | Infection Pathway | Autoimmune Pathway | Infection Pathway | |||
| 1 | P38646 | Molecular chaperone DnaK | Autoimmune disease, Parkinson’s disease | Perinatal necrotizing enterocolitis, HIV, Tuberculosis | Parkinson’s disease, Huntington’s disease, Diabetes mellitus, Alzheimer’s | Tuberculosis, HIV, Papillomavirus, E. coli, Cytomegalovirus, Staphylococcus sp., Legionellosis, Chagas, Leishmaniasis, Measles | Guillain–Barré syndrome [69], Multiple sclerosis [70], Vitiligo [71], Systemic lupus erythematosus [72], Ankylosing spondylitis [73], Type I Diabetes mellitus [74], Rheumatoid arthritis [75] | Trypanosoma cruzi [76], Mycobacterium leprae [77] |
| 2 | Q8N442 | Translation elongation factor 4 | - | - | Tuberculosis, Rheumatoid arthritis | - | - | |
| 3 | P13051 | Uracil-DNA glycosylase | - | - | - | HIV, Viral carcinogenesis | - | - |
| 4 | Q9BWD1 | Acetyl-CoA C-acetyltransferase | - | - | - | HBV, Viral carcinogenesis | Systemic lupus erythematosus [78] | HCV [79] |
| 5 | E9PDW2 | 3-oxoacid CoA-transferase subunit B | Crohn’s disease | - | - | - | Rheumatoid arthritis [80] | - |
| 6 | Q14376 | UDP-glucose 4-epimerase GalE | Psoriasis, Interstitial cystitis | Tinea corporis, Tinea pedis | - | - | Type I Diabetes mellitus [81] | Hemophilus influenzae [82] |
| 7 | P21281 | V-type proton ATPase subunit B | IgA glomerulonephritis | - | Huntington’s disease, Rheumatoid arthritis | Helicobacter pylori infection, HPV, Tuberculosis, Viral carcinogenesis, Vibrio chloerae, HIV | - | Tuberculosis [83], SARS-CoV-2 [84] |
| 8 | P38606 | V-type ATP synthase catalytic unit A | Psoriasis, Myopathy | - | Alzheimer’s disease, Huntington’s disease, Parkinson’s disease, Rheumatoid arthritis, | HPV, H. pylori, Tuberculosis, Vibrio cholerae, Viral carcinogenesis, HIV | Thyroid eye disease [85] | Influenza H1N1 [86], Salmonellosis [87], Rabies virus [88], SARS-CoV-2 [89], Tuberculosis [90] |
| 9 | P09104 | Phosphopyruvate hydratase | Psoriasis | - | - | - | Autoimmune encephalomyelitis [91], Rheumatoid arthritis [92] | Cytomegalovirus [93] |
| 10 | Q16740 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Psoriasis | - | Alzheimer’s disease, Huntington’s disease, Parkinson’s disease | - | - | Tuberculosis [94] |
| 11 | P06576 | F0F1 ATP synthase subunit beta | - | - | Alzheimer’s, Huntington’s, Parkinson’s, Non-alcoholic fatty-acid liver diseases | Epstein–Barr virus infection, HBV, HCV, HPV, Measles, Legionellosis, E. coli | Autoimmune myocarditis [95] | MERS coronavirus [96], Echinococcus granulosus [97] |
| 12 | P25705 | F0F1 ATP synthase subunit alpha | Alzheimer’s disease | - | - | - | Sjogren’s syndrome [98], Crohn’s disease [98], Ankolysing spondolytis [73] | - |
| 13 | P49411 | Elongation factor Tu | - | - | Huntington’s, Parkinson’s | HCV, HBV, Legionellosis, E. coli, V. cholerae | Sjogren’s syndrome [99], Crohn’s disease [98], Ankolysing spondylitis [73] | Streptococcus pneumoniae [100], bacteria like Bacillus anthracis, Francisella talurensis, Staphylococcus sp., E. coli, H. pylori, etc. [101] |
| 14 | P31153 | Methionine adenosyltransferase | Type 2 diabetes mellitus, demyelinating diseases, MODY, Psoriasis, fatty liver, or non-alcoholic steatohepatitis | - | - | - | Rheumatoid arthritis [102], Uveitis [103] |
Herpes simplex type 1 [104], Poxvirus [105], West Nile virus [106] |
| 15 | P10809 | Chaperonin GroEL | Allergic rhinitis | Tuberculosis, HIV | - | - | Type I Diabetes [103], Juvenile chronic arthritis [107], Atherosclerosis [108], Crohn’s disease [109], Rheumatoid arthritis [110], Systemic lupus erythematosus [111], Sjogren syndrome [112], Hashimoto thyroiditis [113,114], and myasthenia gravis [115], Autism [116] |
H. pylori [117], P. aeruginosa and S. aureus [118] |
| 16 | P50213 | Isocitrate dehydrogenase [NAD] subunit alpha | Psoriasis | - | Huntington’s disease, Parkinson’s disease | Epstein–Barr virus, HCV, Legionellosis | Atherosclerosis [119], Type I diabetes [120] | H. pylori [117] |
| 17 | P31939 | Phosphoribosylaminoimidazolecarboxamide formyltransferase | Rheumatoid arthritis, Psoriatic arthritis, Erythrodermic psoriasis, Pustular psoriasis, Plaque psoriasis, Diabetes mellitus, Juvenile idiopathic arthritis | - | - | - | - | C. neoformans [121] |
| 18 | P16219 | Acyl-CoA dehydrogenase | Allergic rhinitis, Ulcerative colitis, Crohn’s disease | - | - | - | - | - |
| 19 | Q9BWD1 | Acetyl-CoA C-acetyltransferase | - | - | Parkinson’s disease | HBV, Viral carcinogenesis | - | - |
| 20 | Q9H1K1 | Fe-S cluster assembly scaffold protein NifU | - | - | Parkinson’s disease | Influenza, HIV | - | Human respiratory syncytial virus [122], SARS-CoV-1 [96] |
| 21 | P30566 | Adenylosuccinate lyase | Psoriasis | - | - | - | - | Schistosomiasis [123], Chlamydia sp. [124] |
3.3. Sequence Mimics and Vaccine Design
Out of 68 mimics ≥ 10 amino acids in length, 31 were antigenic (Table 3), with four being allergenic. Among the 31 antigenic sequences, 14 mimics were identified as IL-4 inducers (RTTPSVVAFT, DHGKSTLADRL, GGAGYIGSHT, DGTGVRDYIHV, LGIYPAVDPL, IKEGDIVKRTG, CIYVAIGQKRST, IETQAGDVSAYIPTNVISITDGQI, EGHPDKICDQISD, TKVDRSAAYAAR, GAGQQSRIHCTRLAG, GCGSAIASSS, RGVKGTTGTQASFL, YKRNPMRSER). Only three peptides (PQIEVTFDIDANGIV, CIYVAIGQKRST, GAGQQSRIHCTRLAG), belonging to DnaK, F0F1 ATP synthase subunit alpha, and Adenylosuccinate lyase, were predicted as non-inducers of IL-6, while all the rest were inducers. Mimics LLLDVTPLSLGIET, DGTGVRDYIHV, VGERTREGNDLY, EGHPDKICDQISD, and RGVKGTTGTQASFL, belonging to DnaK, GalE, F0F1 ATP synthase subunit beta, methionine adenosyltransferase, and adenylosuccinate lyase, respectively, were predicted as inducers of IL-10.
Table 3.
Immunogenicity, allergenicity, and other properties of the antigenic mimics.
| Serial no. | Antigenic Score | Sequence | Length | Immunogenicity Score | SVM Score for Toxicity | Hydrophobicity | Hydropathicity | Hydrophilicity | Charge | Mol Wt | Allergenicity |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 1. | 1.09 | GIDLGTTNSCVAV | 15 | 0.65 | 0.07 | 0.85 | −0.42 | −1 | 1249.59 | 0.07 | No |
| 2. | 0.58 | RTTPSVVAFT | 12 | 0.35 | −0.07 | 0.4 | −0.39 | 1 | 1078.36 | −0.07 | No |
| 3. | 0.89 | LLLDVTPLSLGIET | 12 | 0.31 | 0.15 | 1.18 | −0.49 | −2 | 1483.99 | 0.15 | yes |
| 4. | 1.39 | PQIEVTFDIDANGIV | 11 | 0.29 | 0.04 | 0.42 | −0.16 | −3 | 1631.04 | 0.04 | yes |
| 5. | 0.80 | DHGKSTLADRL | 12 | 0.26 | −0.33 | −1.01 | 0.66 | 0.5 | 1212.48 | −0.33 | No |
| 6. | 1.22 | NASGINDGAA | 12 | 0.26 | −0.05 | −0.22 | 0.04 | −1 | 889.02 | −0.05 | No |
| 7. | 0.65 | GGAGYIGSHT | 24 | 0.21 | 0.08 | −0.13 | −0.52 | 0.5 | 919.11 | 0.08 | No |
| 8. | 1.47 | DGTGVRDYIHV | 10 | 0.18 | −0.15 | −0.42 | 0.09 | −0.5 | 1231.49 | −0.15 | No |
| 9. | 1.20 | LDSRGNPTVEV | 10 | 0.18 | −0.23 | −0.57 | 0.39 | −1 | 1186.44 | −0.23 | yes |
| 10. | 1.48 | VVEQTGRGER | 11 | 0.14 | −0.42 | −1.26 | 0.88 | 0 | 1130.37 | −0.42 | No |
| 11. | 0.54 | TGIKVVDLLAPY | 10 | 0.12 | 0.1 | 0.91 | −0.47 | 0 | 1288.73 | 0.1 | No |
| 12. | 1.25 | VGERTREGNDLY | 11 | 0.12 | −0.41 | −1.48 | 0.77 | −1 | 1408.66 | −0.41 | No |
| 13. | 1.03 | PSAVGYQPTLAT | 10 | 0.11 | 0.03 | 0.08 | −0.58 | 0 | 1204.51 | 0.03 | No |
| 14. | 1.04 | TKKGSITSVQA | 14 | 0.11 | −0.19 | −0.38 | 0.2 | 2 | 1119.44 | −0.19 | no |
| 15. | 0.54 | LGIYPAVDPL | 10 | 0.09 | 0.19 | 0.97 | −0.67 | −1 | 1057.4 | 0.19 | yes |
| 16. | 0.65 | IKEGDIVKRTG | 10 | 0.06 | −0.29 | −0.69 | 0.86 | 1 | 1215.58 | −0.29 | No |
| 17. | 0.70 | CIYVAIGQKRST | 12 | 0.05 | −0.13 | 0.2 | −0.23 | 2 | 1338.76 | −0.13 | No |
| 18. | 0.53 | YTIVVSATAS | 10 | 0.02 | 0.14 | 1.22 | −0.83 | 0 | 1011.27 | 0.14 | No |
| 19. | 0.84 | IETQAGDVSAYIPTNVISITDGQI | 12 | 0.01 | 0.02 | 0.25 | −0.26 | −3 | 2506.13 | 0.02 | No |
| 20. | 0.56 | DGPMPQTREH | 13 | −0.05 | −0.41 | −2.06 | 0.7 | −0.5 | 1167.4 | −0.41 | No |
| 21. | 1.41 | EGHPDKICDQISD | 10 | −0.05 | −0.28 | −1.22 | 0.8 | −2.5 | 1456.73 | −0.28 | No |
| 22. | 1.22 | HGGGAFSGKD | 12 | −0.06 | −0.1 | −0.84 | 0.28 | 0.5 | 932.1 | −0.1 | No |
| 23. | 0.57 | TKVDRSAAYAAR | 15 | −0.12 | −0.35 | −0.65 | 0.51 | 2 | 1308.6 | −0.35 | No |
| 24. | 1.75 | AGDGTTTATVLA | 12 | −0.13 | 0.06 | 0.52 | −0.28 | −1 | 1077.32 | 0.06 | No |
| 25. | 1.07 | VTLIPGDGIGPE | 10 | −0.16 | 0.11 | 0.41 | −0.11 | −2 | 1167.51 | 0.11 | No |
| 26. | 1.76 | AGDGTTTATVLA | 14 | −0.17 | 0.06 | 0.52 | −0.28 | −1 | 1077.32 | 0.06 | No |
| 27. | 1.62 | GAGQQSRIHCTRLAG | 13 | −0.18 | −0.23 | −0.5 | 0.01 | 2.5 | 1554.97 | −0.23 | No |
| 28. | 1.22 | NASGINDGAA | 10 | −0.19 | −0.05 | −0.22 | 0.04 | −1 | 889.02 | −0.05 | No |
| 29. | 1.42 | GCGSAIASSS | 10 | −0.20 | 0.06 | 0.66 | −0.26 | 0 | 839.01 | 0.06 | No |
| 30. | 1.65 | RGVKGTTGTQASFL | 11 | −0.22 | −0.14 | −0.24 | −0.07 | 2 | 1422.81 | −0.14 | No |
| 31. | 0.55 | YKRNPMRSER | 11 | −0.25 | −0.77 | −2.62 | 1.19 | 3 | 1336.66 | −0.77 | No |
Two sequence mimics (GAGQQSRIHCTRLAG and RGVKGTTGTQASFL) belonging to the phosphoribosylaminoimidazolecarboxamide formyltransferase and adenylosuccinate lyase proteins, respectively, were selected for vaccine design based on antigenicity and other values. RGVKGTTGTQASFL was predicted as an inducer of IL-4, IL-6, and IL-10, while GAGQQSRIHCTRLAG was predicted as only an IL-4 inducer. Evolutionary analysis revealed majority of residues of both sequence mimics are highly conserved (Figure 2).
Figure 2.
Conservation of sequence mimics from (A) phosphoribosylaminoimidazolecarboxamide formyltransferase and (B) adenylosuccinate lyase used for vaccine design underlined by red (and star symbol). Yellow color indicates insufficient data for conservation inference.
Mimic-based vaccine design is an innovative approach that utilizes synthetic peptides or proteins to mimic specific antigens of pathogens [16]. By presenting these mimics to the immune system, it can generate targeted immune responses against the actual pathogen. Here, in total, nine constructs were made, and the non-allergenic ones were retained for analysis (Supplementary Table S1). Among these, a stable, highly antigenic one, i.e., construct C2 was chosen for further downstream processing. It was reverse-translated and cloned in a pET-28(a)+ vector (Figure 3).
Figure 3.
The 5083 bp cloned vector of the vaccine construct.
3.4. Immune Response Simulation
Immune response simulation analysis utilized Parker’s propensity scale to predict potential epitopes within the vaccine sequence [125], which may be recognized by the immune system, particularly by T cells. Six B-cell epitopes (EQIG, STRGRKCCRRKKEA, AGGGSRGVKGTTGT, AGGGSGAGQ, GGSHEY, AGGGS) were identified using the Parker propensity scale. For MHC-I, no binding epitope was present for the A0101 and B0702 allele, while two binding epitopes (IINTLQKYY and AGGGGSHEY) were identified for the A0102 allele and one (RVRGGRCAV) was identified for B0704. For MHC-II binding, seven epitopes were predicted for DRB1_0101 (YCRVRGGRC, FVAAWTLKA, WTLKAAAGG, LKAAAGGGS, VKGTTGTQA, FLGGGSAKF, LERAGAKFV) and two were predicted for DRB1_0102 (LKAAAGGGS and LERAGAKFV).
The IgM + IgG population was 140,000 cells/mm3, and only a slight difference was observed after the second injection (Figure 4A). This suggests that the primary immune response, characterized by the production of IgM antibodies followed by IgG antibodies [126,127], was already established after the first injection. The second injection did not result in a significant increase in the overall IgM + IgG population. IgG1 + IgG2 count was below 80,000 cells/mm3 but increased to more than 90,000 cells/mm3 after the second injection. This indicates that the secondary immune response, mediated by IgG antibodies [128], was robustly triggered by the second injection. The overall immune cell counts plateaued after around 200 days, indicating stabilization of the immune response. The B-cell population remained active after the vaccine injection, up to 100 cells/mm3 (Figure 4B). Their sustained presence suggests ongoing immune surveillance and the potential for long-term immune memory [129]. T-helper (TH) cells increased after each vaccine injection and remained active with a count of 4000 cells/mm3 even after 300 days (Figure 4C). TH cells play a crucial role in coordinating the immune response by facilitating communication between various immune cells, and their persistent presence indicates their continued involvement in supporting and regulating the immune response [130,131]. The count of cytotoxic T (TC) non-memory cells fluctuated, possibly indicating their active participation in eliminating target cells (Figure 4D). In contrast, TC memory cells remained consistently higher than 100 cells/mm3, suggesting the establishment of immunological memory. Memory cells enable a rapid and specific response upon re-exposure to the antigen, contributing to long-term immunity [132]. Natural killer (NK) cells have a role in innate immune defense [133], and their population remained at more than 300 cells/mm3 for the whole period (Figure 4E). No significant changes were observed in response to the stress of bacterial proteins. This suggests that the immune system reached a state of equilibrium and was no longer strongly influenced by the presence of bacterial proteins.
Figure 4.
Immune system cells released after the C2 vaccine and C. difficile protein (phosphoribosylaminoimidazolecarboxamide formyltransferase and adenylosuccinate lyase) stress, including (A) immunoglobulins, (B) B cells, (C) TH cells, (D) TC cells, and (E) NK cells.
3.5. Vaccine Interaction
The 3D structure of the vaccine construct was modeled using three tools, in which SWISS-MODEL achieved the highest percentage (89.60%), indicating a larger portion of residues in favorable conformation compared to I-TASSER (44.32%) and AlphaFold (62.75%) (Supplementary Table S2). The QMEANDisCo Global score was additionally used to assess the global quality of the protein structure, with a lower score suggesting better overall quality. This metric is used to estimate the quality of a protein tertiary structure by taking distance constraints into account [134]. Again, SWISS-MODEL achieved a score of 0.64 ± 0.07, followed by AlphaFold (0.35 ± 0.07) and I-TASSER (0.32 ± 0.07).
The best-modeled structure by SWISS-MODEL (Supplementary Figure S1A) was used to map interactions with HLA and TLR-4 receptor (Figure 5). Docking revealed that HLA-A and HLA-B complexes had relatively lower binding scores compared to the TLR-4 complex, implying stronger binding affinities between the vaccine construct and HLA receptors (Supplementary Table S3). The PRODIGY server [68] was used to map thermodynamic changes in these complexes, where ΔG (kcal mol−1) represents the change in free energy associated with the formation of the protein–protein complex, while Kd (M) provided the equilibrium dissociation constant at 25 °C. ΔG is studied to measure the stability of the complex, while Kd is studied to measure the binding affinity, with more negative values suggesting a stronger interaction [135,136]. ΔG and Kd are better predictors of binding than docking score [137] and were, therefore, employed for validation. HLA-B and TLR-4 had a highly negative ΔG value, indicating stable and stronger interaction compared to the control. TLR-4 indicated the lowest Kd value, suggesting a strong binding affinity and a favorable binding interaction in comparison with the control. This suggests that the interactions between the vaccine construct and TLR-4 receptor are likely to be more favorable and specific. This also shows that the ClusPro modeling method performed well in predicting the binding of the HLA and TLR-4 complex with vaccine construct and is a reliable approach to determine interactions.
Figure 5.
Vaccine construct (shown in green) interaction with (A) HLA-A, (B) HLA-B, and (C) TLR-4. Receptors are shown in cyan. (D) Control Tumor necrosis factor ligand superfamily member 11 (RANK-L) and 11A (RANK) from Mus musculus.
4. Discussion
C. difficile can cause infections, primarily in the colon or large intestine [138,139]. Infection usually occurs in the immunocompromised [140] and in people who have received antibiotic therapy, when the natural balance of bacteria in the colon is disrupted [138]. This allows the bacterium to multiply and produce toxins that cause inflammation and damage to the intestinal lining. Molecular mimicry allows C. difficile toxin A to bind glycosphingolipids [141]. Mindur et al. have reported cross-reactive epitopes of myelin basic protein in the surface layer protein of a sub-species of C. difficile [142]. Peptide EQSLITVEGDKASM from the toxin B protein of the species has also been implicated in an autoimmune disease, namely primary biliary cirrhosis. Alam et al. have reported a collagen triple-helix repeat family protein in C. difficile as a mimic of the type II collagen protein of humans [143]. The protein is implicated in reactive arthritis, septic arthritis, and rheumatic symptoms. However, the sequence identity was less than 45%. This is why this protein was missed by our analysis, as we followed stringent criteria of identity value ≥50%.
The molecular mimics at the whole proteome scale for C. difficile and their involvement in autoimmune disorders have not yet been mapped. A bioinformatics-based approach is a useful method to exploit the publicly available data for this purpose. Mapping the molecular-mimicry mechanism employed by C. difficile can provide insights into the virulence and pathogenesis, as well as offer potential targets for the development of therapeutic interventions, such as vaccines or drugs that can disrupt the interaction between the bacterial mimics and the host receptors, thereby preventing or reducing the severity of C. difficile infections. For this purpose, we obtained the proteome of the reference strain of C. difficile S-0253 (n = 3732 proteins). Among these, only 23 proteins were homologous to humans, having ≥50% sequence identity. The structural superposition of these proteins revealed several regions with organizational and fold similarity (Table 1). The ATP-dependent Clp endopeptidase proteolytic subunit ClpP exhibited the lowest RMSD value, indicating a high degree of structural similarity between the human and bacterial homologs. It plays a crucial role in maintaining protein homeostasis in conjunction with chaperones by degrading misfolded or damaged proteins. The peptide sequence QIERDTERDRFLSAPEAV of E. coli ClpP has been previously implicated in autoimmune biliary liver cirrhosis [144]. The highest number of peptide mimics were observed in energy-generating F0F1 ATP synthase and heat-shock protein DnaK. Zhang et al. have reported increased activity of ATP synthase in the autoimmune neuromyelitis optica spectrum disorder [145]. DnaK has previously been implicated in molecular mimicry of other pathogenic bacteria like Streptococcus pneumoniae [16] and Salmonella typhi [15]. DnaK and other molecular chaperones like GroEL have been implicated in multiple autoimmune disorders [116,146,147,148,149,150,151]. DnaK has been associated with autoimmune atrophic gastritis caused by H. pylori [152], while Qeshmi et al. have reported its presence in multiple sclerosis as well [153]. Overall, rheumatoid arthritis, Alzheimer’s disease, psoriasis, Huntington’s disease, and Parkinson’s disease emerged as the primary autoimmune disease associated with multiple homologs.
Among infectious disease mapping, tuberculosis was the most common infection linked to the homologous proteins of C. difficile, suggesting a potential role of these proteins in the immune response against mycobacterial infections. A varying fraction of C. difficile infection in tuberculosis patients has been reported previously, ranging from ~3 cases per 1000 adults in Korea [154] to ~70 cases per 1000 individuals in South Africa [155]. Obuch-Woszczatyński reported C. difficile-mediated diarrhea in tuberculosis patients when rifampicin was used as part of their treatment regimen [156]. Rifampicin can contribute to the development of resistance against this antibiotic in C. difficile, which in turn poses a risk to the effectiveness of tuberculosis treatment. The rate of C. difficile infection in tuberculosis patients tends to be higher in aged people compared to younger adults [157]. This bacterium has also been identified as one of the predominant pathogens causing diarrheal illness in HIV-seropositive individuals, with two times higher prevalence compared to HIV-seronegative people [158].
Mimic-based vaccine design is an innovative approach that utilizes synthetic peptides or proteins to mimic specific antigens of pathogens [16]. By presenting these mimics to the immune system, targeted immune responses against the actual pathogen can be generated [159,160]. Hence, a stable and highly antigenic vaccine construct was designed using two peptide mimics identified in this study. It was cloned into a pET-28(a)+ vector and immune response was assessed using in silico simulations. The primary immune response, characterized by IgM production followed by IgG production, was established after the first vaccine injection. The secondary immune response, mediated by IgG antibodies, was robustly triggered by the second injection. The immune cell counts plateaued after approximately 200 days, indicating stabilization of the immune response. B cells remained active, suggesting ongoing immune surveillance and potential long-term immune memory. TH cells increased after each vaccine injection and remained active even after 300 days, indicating their continued involvement in supporting and regulating the immune response. TC cells showed fluctuating counts, possibly indicating their active participation in eliminating target cells, while TC memory cells remained consistently higher, indicating the establishment of immunological memory. NK cells, involved in innate immune defense, maintained a stable population throughout the study. Hence, a dynamic and robust immune response occurred following the vaccine injections. The presence of specific antibody populations sustained B-cell activity, and a stable count of T cells, NK cells, and EP cells indicated an effective immune response against the target antigen. The establishment of immunological memory and the plateauing of immune cell counts suggests a stable and functional immune system capable of long-term protection. No significant changes were observed in response to bacterial protein stress, suggesting that the immune system reached an equilibrium state and was no longer strongly influenced by the presence of bacterial proteins. However, computational predictions are not without limitations, and although mimic-based vaccine design and immune response simulation helps accelerate the vaccine-development process, providing insights into immune responses and generating hypotheses for further experimental investigations, it also has limitations. The foremost limitation is their accuracy and adverse response mapping due to inadequate input of variables and complexities of the immune system [16]. The local tissue microenvironment and factors such as blood flow, physical barriers, and cellular interactions can influence immune responses but may be overlooked or simplified in simulations. Additionally, the pathogens tend to mutate, and they may not be workable in the real-world scenario due to the altered genetics of the microbe. To overcome this, we have tried to focus on conserved epitopes of the antigenic proteins, but the immune evasion mechanism may be altered with time and the epitope may fail to generate an immune response. Thus, the in silico vaccine design is a valuable tool for narrowing down potential candidates and reducing research costs and timelines, but it is just the initial step in the vaccine-development process. Real laboratory-based testing is essential to validate and refine these designs, ensuring that the vaccine candidates are safe and effective in a real-world setting. Moreover, the in silico outcomes may not necessarily mirror those in a real laboratory as they typically do not consider the environmental factors the laboratory experiments take into account and can be overly optimistic or pessimistic predictions. Biological systems can also have unexpected interactions and feedback loops that are difficult to predict computationally. These interactions may only become apparent through real-world experimentation. The limitations of in silico modeling highlight the need for a comprehensive and rigorous approach to vaccine development that combines computational methods with empirical testing.
In summary, using bacterial peptides as structural templates for vaccine design is a valid approach, but the risk of triggering an autoimmune reaction prevails [43]. It is crucial to assess the risk associated with the potential induction of autoimmune response after administering the vaccine. It is also important to acknowledge that factors such as prior exposure to antigens and the presence of known autoantibodies, genetic predisposition of individuals, and other variables may contribute to the initiation of cross-reactive responses [161]. However, the immune system is normally fortified with multiple layers of protective mechanisms, which work in concordance to prevent the occurrence of autoimmunity [162] in response to vaccines. The mammalian immune system has also evolved an intricate repertoire of mechanisms to discern self- from non-self-antigens, primarily through the establishment of central immune tolerance [163,164], thus acting as a safeguard against autoimmunity. Moreover, molecular mimics, such as those utilized in vaccine design, tend to confer a reduced risk of provoking autoimmune reactions. This reduced risk can be attributed to the relatively lower immunological pressure imposed by these mimics when compared to actual pathogens, which inherently exert additional immune pressure due to the manifestation of the disease itself.
The regulatory T cells (Tregs) also play a pivotal role in modulating the immune response on encountering the antigen (from the vaccine), ensuring its proportionality and averting the development of autoimmunity [161]. These regulatory processes are further reinforced by natural checkpoints orchestrated by cytokines and other signaling molecules. These checkpoints serve as crucial regulators, fine-tuning the intensity and duration of the immune response [165], thus mitigating the risk of overly aggressive reactions that could harm the body tissues, instead of just the pathogen. Furthermore, cells can release immunosuppressive signals, including TGF-beta and IL-10, effectively dampening immune responses and preventing unwarranted reactivity against self-antigens [166,167]. Antigen-presenting cells (APCs) are another player in the immune system that present foreign antigens to immune cells, while self-antigens are less likely to incite a response [168]. As a result, the potential for cross-reactivity leading to autoimmune triggers is notably diminished in the context of mimic-based vaccine design, thus underscoring the safety and efficacy of this approach.
Additionally, the prudent approach of pre-vaccination testing for genetically predisposed individuals and the adoption of nanocarriers as alternatives to lipid adjuvants hold promise in mitigating the risk of cross-reactivity and triggering autoimmunity [163,169]. Furthermore, comparative evaluations of diverse vaccine formulations, concerning their capacity to induce or exacerbate pathology in relevant models, can yield valuable baseline data about the efficacy and safety of these vaccines. The inclusion of comprehensive immunological investigations, including autoimmune serology, within phases I to III of clinical trials is warranted to holistically assess vaccine responses. Hence, mimic-based innovative vaccine design, alongside the risk assessment and consideration of the inherent protective mechanisms of the immune system, offers a promising pathway toward vaccines that can effectively combat pathogens while sparing the human self-tissues from harm.
5. Conclusions
Investigation of autoimmune pathways associated with the identified human homologs of C. difficile revealed interesting connections to autoimmune diseases. The identified associations with autoimmune diseases, particularly rheumatoid arthritis, warrant further investigation into the underlying mechanisms of autoimmunity and the specific roles of these homologous proteins in disease pathogenesis. The structural similarity between human and C. difficile homologs suggests the possibility of using these bacterial proteins as structural templates for vaccine design and development. Understanding the conserved regions and functional motifs in these proteins may also aid in the design of therapeutics targeting C. difficile and related human diseases. We fabricated a vaccine construct using conserved, safe, and immunogenic mimics. It demonstrated good response in silico, but computational predictions have limitations, and we imply experimental research to complement or refute our findings.
Acknowledgments
The authors are also thankful to the Deanship of Scientific Research at Najran University for funding this work, under the General Research Funding program grant code NU/DRP/MRC/12/5.
Supplementary Materials
The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/microorganisms11092300/s1, Figure S1: (A) 3D structure of vaccine construct using Swiss-Model (B) Ramachandran plot of the model; Table S1: Non-allergenic vaccine constructs against C. difficile; Table S2: 3D structure statistics of the vaccine construct, using various tools; Table S3: HLA and TLR receptor interaction statistics with the designed vaccine construct. Non-bonded contacts can involve attractive forces, such as van der Waals interactions and hydrophobic interactions, or repulsive forces, such as steric clashes. No disulphide bond was detected in any interaction.
Author Contributions
S.A., Z.B., M.M.M. and A.A. conceptualized the study. Z.B., M.A.A. and H.H.A. performed the experiments. N.A.A., M.M.M. and S.A. curated the data. S.A., Z.B., M.M.M. and A.A. wrote and edited the original draft. H.H.A., N.A.A. and M.A.A. reviewed and edited the draft. A.A., N.A.A. and M.A.A. visualized the study. S.A., Z.B., M.M.M. and H.H.A. obtained the funding. S.A., Z.B. and M.M.M. administered the project. M.M.M. supervised the study. All authors have read and agreed to the published version of the manuscript.
Data Availability Statement
All the data used or generated in this study are provided as an accession number or relevant information as tables in the manuscript.
Conflicts of Interest
The authors declare that they have no conflict of interest.
Funding Statement
This research was funded by the Deanship of Scientific Research at Najran University Research Support Program under the grant program code NU/DRP/MRC/12/5.
Footnotes
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
References
- 1.Martins Y.C., Jurberg A.D., Daniel-Ribeiro C.T.J.M. Visiting Molecular Mimicry Once More: Pathogenicity, Virulence, and Autoimmunity. Microorganisms. 2023;11:1472. doi: 10.3390/microorganisms11061472. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2.Hussein H.M., Rahal E.A. The role of viral infections in the development of autoimmune diseases. Crit. Rev. Microbiol. 2019;45:394–412. doi: 10.1080/1040841X.2019.1614904. [DOI] [PubMed] [Google Scholar]
- 3.Topi S., Bottalico L., Charitos I.A., Colella M., Di Domenico M., Palmirotta R., Santacroce L.J. Biomolecular Mechanisms of Autoimmune Diseases and Their Relationship with the Resident Microbiota: Friend or Foe? Pathophysiology. 2022;29:507–536. doi: 10.3390/pathophysiology29030041. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Guarneri F. Role of Microorganisms in Pathogenesis and Management of Autoimmune Diseases: Volume I: Liver, Skin, Thyroid, Rheumatic & Myopathic Diseases. Springer; Berlin/Heidelberg, Germany: 2022. The Concept of Infection-Triggered Autoimmunity; pp. 3–19. [Google Scholar]
- 5.Mobasheri L., Nasirpour M.H., Masoumi E., Azarnaminy A.F., Jafari M., Esmaeili S.-A. SARS-CoV-2 triggering autoimmune diseases. Cytokine. 2022;154:155873. doi: 10.1016/j.cyto.2022.155873. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Fugger L., Jensen L.T., Rossjohn J.J. Challenges, progress, and prospects of developing therapies to treat autoimmune diseases. Cell. 2020;181:63–80. doi: 10.1016/j.cell.2020.03.007. [DOI] [PubMed] [Google Scholar]
- 7.Burbelo P.D., Iadarola M.J., Keller J.M., Warner B.M. Autoantibodies targeting intracellular and extracellular proteins in autoimmunity. Front. Immunol. 2021;12:548469. doi: 10.3389/fimmu.2021.548469. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Cunningham M.W. Molecular mimicry, autoimmunity, and infection: The cross-reactive antigens of group A streptococci and their sequelae. Microbiol. Spectr. 2019;7:20. doi: 10.1128/microbiolspec.GPP3-0045-2018. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Adiguzel Y.J. Molecular mimicry between SARS-CoV-2 and human proteins. Autoimmun. Rev. 2021;20:102791. doi: 10.1016/j.autrev.2021.102791. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Venigalla S.S.K., Premakumar S., Janakiraman V. A possible role for autoimmunity through molecular mimicry in alphavirus mediated arthritis. Sci. Rep. 2020;10:938. doi: 10.1038/s41598-019-55730-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Joubert B., Dalmau J. The role of infections in autoimmune encephalitides. Rev. Neurol. 2019;175:420–426. doi: 10.1016/j.neurol.2019.07.004. [DOI] [PubMed] [Google Scholar]
- 12.Cuan-Baltazar Y., Soto-Vega E. Microorganisms associated to thyroid autoimmunity. Autoimmun. Rev. 2020;19:102614. doi: 10.1016/j.autrev.2020.102614. [DOI] [PubMed] [Google Scholar]
- 13.Youssefi M., Tafaghodi M., Farsiani H., Ghazvini K., Keikha M. Helicobacter pylori infection and autoimmune diseases. Is there an association with systemic lupus erythematosus, rheumatoid arthritis, autoimmune atrophy gastritis and autoimmune pancreatitis? A systematic review and meta-analysis study. J. Microbiol. Immunol. Infect. 2021;54:359–369. doi: 10.1016/j.jmii.2020.08.011. [DOI] [PubMed] [Google Scholar]
- 14.Begum S., Aiman S., Ahmad S., Samad A., Almehmadi M., Allahyani M., Aljuaid A., Afridi S.G., Khan A. Molecular Mimicry Analyses Unveiled the Human Herpes Simplex and Poxvirus Epitopes as Possible Candidates to Incite Autoimmunity. Pathogens. 2022;11:1362. doi: 10.3390/pathogens11111362. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Rahman N., Begum S., Khan A., Afridi S.G., Sahibzada M.U.K., Atwah B., Alhindi Z., Khan H. An insight in Salmonella typhi associated autoimmunity candidates’ prediction by molecular mimicry. Comput. Biol. Med. 2022;148:105865. doi: 10.1016/j.compbiomed.2022.105865. [DOI] [PubMed] [Google Scholar]
- 16.Mashraqi M.M., Alzamami A., Alturki N.A., Alshamrani S., Alshahrani M.M., Almasoudi H.H., Basharat Z. Molecular Mimicry Mapping in Streptococcus pneumoniae: Cues for Autoimmune Disorders and Implications for Immune Defense Activation. Pathogens. 2023;12:857. doi: 10.3390/pathogens12070857. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Gouttefangeas C., Klein R., Maia A. The good and the bad of T cell cross-reactivity: Challenges and opportunities for novel therapeutics in autoimmunity and cancer. Front. Immunol. 2023;14:1212546. doi: 10.3389/fimmu.2023.1212546. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Reynolds S., Rafeek R.A.M., Hamlin A., Lepletier A., Pandey M., Ketheesan N., Good M. Streptococcus pyogenes vaccine candidates do not induce autoimmune responses in a rheumatic heart disease model. NPJ Vaccines. 2023;8:9. doi: 10.1038/s41541-023-00604-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Burova L.A., Suvorov A.N., Pigarevsky P.V., Totolian A.A. Autoimmune streptococcal glomerulonephritis: The problem of nephritogenicity of Streptococcus pyogenes. Russ. J. Infect. Immun. 2023;13:409–429. doi: 10.15789/2220-7619-ASG-8491. [DOI] [Google Scholar]
- 20.Cutforth T., De Mille M.M., Agalliu I., Agalliu D.J. CNS autoimmune disease after Streptococcus pyogenes infections: Animal models, cellular mechanisms and genetic factors. Future Neurol. 2016;11:63–76. doi: 10.2217/fnl.16.4. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Draborg A.H., Duus K., Houen G. Epstein-Barr virus in systemic autoimmune diseases. Clin. Dev. Immunol. 2013;2013:535738. doi: 10.1155/2013/535738. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22.Poole B.D., Scofield R.H., Harley J.B., James J. Epstein-Barr virus and molecular mimicry in systemic lupus erythematosus. Autoimmunity. 2006;39:63–70. doi: 10.1080/08916930500484849. [DOI] [PubMed] [Google Scholar]
- 23.Jog N.R., James J.A. Epstein Barr virus and autoimmune responses in systemic lupus erythematosus. Front. Immunol. 2021;11:623944. doi: 10.3389/fimmu.2020.623944. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Chiba T., Goto S., Yokosuka O., Imazeki F., Tanaka M., Fukai K., Takahashi Y., Tsujimura H., Saisho H. Fatal chronic active Epstein–Barr virus infection mimicking autoimmune hepatitis. Eur. J. Gastroenterol. Hepatol. 2004;16:225–228. doi: 10.1097/00042737-200402000-00017. [DOI] [PubMed] [Google Scholar]
- 25.Lünemann J.D., Münz C. Epstein-Barr virus and multiple sclerosis. Nat. Rev. Microbiol. 2007;7:253–258. doi: 10.1007/s11910-007-0038-y. [DOI] [PubMed] [Google Scholar]
- 26.Paroli M., Iannucci G., Accapezzato D. Hepatitis C virus infection and autoimmune diseases. Int. J. Gen. Med. 2012;5:903–907. doi: 10.2147/IJGM.S37580. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27.Dudak F.C., Boyaci I.H., Orner B.P. The discovery of small-molecule mimicking peptides through phage display. Molecules. 2011;16:774–789. doi: 10.3390/molecules16010774. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Trela M., Nelson P.N., Rylance P.B. The role of molecular mimicry and other factors in the association of Human Endogenous Retroviruses and autoimmunity. Apmis. 2016;124:88–104. doi: 10.1111/apm.12487. [DOI] [PubMed] [Google Scholar]
- 29.Zhou L., Feng T., Xu S., Gao F., Lam T.T., Wang Q., Wu T., Huang H., Zhan L., Li L. ggmsa: A visual exploration tool for multiple sequence alignment and associated data. Brief. Bioinform. 2022;23:bbac222. doi: 10.1093/bib/bbac222. [DOI] [PubMed] [Google Scholar]
- 30.Silva L., Antunes A. Homology Modeling: Methods and Protocols. Springer; Berlin/Heidelberg, Germany: 2023. Omics and Remote Homology Integration to Decipher Protein Functionality; pp. 61–81. [DOI] [PubMed] [Google Scholar]
- 31.Lundegaard C., Lamberth K., Harndahl M., Buus S., Lund O., Nielsen M. NetMHC-3.0: Accurate web accessible predictions of human, mouse and monkey MHC class I affinities for peptides of length 8–11. Nucleic Acids Res. 2008;36:W509–W512. doi: 10.1093/nar/gkn202. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.Vita R., Mahajan S., Overton J.A., Dhanda S.K., Martini S., Cantrell J.R., Wheeler D.K., Sette A., Peters B. The immune epitope database (IEDB): 2018 update. Nucleic Acids Res. 2019;47:D339–D343. doi: 10.1093/nar/gky1006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Morsy S., Morsy A. Epitope mimicry analysis of SARS-CoV-2 surface proteins and human lung proteins. J. Mol. Graph. Model. 2021;105:107836. doi: 10.1016/j.jmgm.2021.107836. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 34.Lunemann J.D., Jelcic I., Roberts S., Lutterotti A., Tackenberg B., Martin R., Munz C. EBNA1-specific T cells from patients with multiple sclerosis cross react with myelin antigens and co-produce IFN-gamma and IL-2. J. Exp. Med. 2008;205:1763–1773. doi: 10.1084/jem.20072397. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 35.Ou X., Liu Y., Lei X., Li P., Mi D., Ren L., Guo L., Guo R., Chen T., Hu J. Characterization of spike glycoprotein of SARS-CoV-2 on virus entry and its immune cross-reactivity with SARS-CoV. Nat. Commun. 2020;11:1620. doi: 10.1038/s41467-020-15562-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 36.Kyrklund M., Bildo M., Akhi R., Nissinen A.E., Pussinen P., Hörkkö S., Wang C. Humoral immune response to heat shock protein 60 of Aggregatibacter actinomycetemcomitans and cross-reactivity with malondialdehyde acetaldehyde-modified LDL. PLoS ONE. 2020;15:e0230682. doi: 10.1371/journal.pone.0230682. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Lawson C.M. Evidence for mimicry by viral antigens in animal models of autoimmune disease including myocarditis. Cell. Mol. Life Sci. 2000;57:552–560. doi: 10.1007/PL00000717. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38.Benvenga S., Guarneri F. Molecular mimicry and autoimmune thyroid disease. Rev. Endocr. Metab. Disord. 2016;17:485–498. doi: 10.1007/s11154-016-9363-2. [DOI] [PubMed] [Google Scholar]
- 39.Amedei A., Bergman M.P., Appelmelk B.J., Azzurri A., Benagiano M., Tamburini C., van der Zee R., Telford J.L., Vandenbroucke-Grauls C.M., D’Elios M. Molecular mimicry between Helicobacter pylori antigens and H+, K+—adenosine triphosphatase in human gastric autoimmunity. J. Exp. Med. 2003;198:1147–1156. doi: 10.1084/jem.20030530. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40.Nora T., Lomma M., Gomez-Valero L., Buchrieser C. Molecular mimicry: An important virulence strategy employed by Legionella pneumophila to subvert host functions. Future Microbiol. 2009;4:691–701. doi: 10.2217/fmb.09.47. [DOI] [PubMed] [Google Scholar]
- 41.Tanim T.M. In Silico Identification of Molecular Mimicry Between T-Cell Epitopes of Borrelia Burgdorferi and the Human Proteome: Implications for Autoimmune Response in Lyme Disease. Brac University; Dhaka, Bangladesh: 2022. [Google Scholar]
- 42.Gkoutzourelas A., Barmakoudi M., Bogdanos D. A bioinformatics analysis reveals novel pathogens as molecular mimicry triggers of systemic sclerosis. Mediterr. J. Rheumatol. 2020;31:50. doi: 10.31138/mjr.31.1.50. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Pahari S., Chatterjee D., Negi S., Kaur J., Singh B., Agrewala J. Morbid sequences suggest molecular mimicry between microbial peptides and self-antigens: A possibility of inciting autoimmunity. Front. Microbiol. 2017;8:1938. doi: 10.3389/fmicb.2017.01938. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44.Vardhini D., Suneetha S., Ahmed N., Joshi D., Karuna S., Magee X., Vijayalakshmi D., Sridhar V., Karunakar K., Archelos J., et al. Comparative proteomics of the Mycobacterium leprae binding protein myelin P0: Its implication in leprosy and other neurodegenerative diseases. Infect. Genet. Evol. 2004;4:21–28. doi: 10.1016/j.meegid.2003.11.001. [DOI] [PubMed] [Google Scholar]
- 45.Ludin P., Nilsson D., Mäser P. Genome-wide identification of molecular mimicry candidates in parasites. PLoS ONE. 2011;6:e17546. doi: 10.1371/journal.pone.0017546. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46.Dreyfus D.H., Farina A., Farina G. Molecular mimicry, genetic homology, and gene sharing proteomic “molecular fingerprints” using an EBV (Epstein-Barr virus)-derived microarray as a potential diagnostic method in autoimmune disease. Immunol. Res. 2018;66:686–695. doi: 10.1007/s12026-018-9045-0. [DOI] [PubMed] [Google Scholar]
- 47.Repac J., Mandić M., Lunić T., Božić B., Božić Nedeljković B. Mining the capacity of human-associated microorganisms to trigger rheumatoid arthritis—A systematic immunoinformatics analysis of T cell epitopes. PLoS ONE. 2021;16:e0253918. doi: 10.1371/journal.pone.0253918. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 48.Garg A., Kumari B., Kumar R., Kumar M. miPepBase: A database of experimentally verified peptides involved in molecular mimicry. Front. Microbiol. 2017;8:2053. doi: 10.3389/fmicb.2017.02053. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 49.Martínez Y.A., Guo X., Portales-Pérez D.P., Rivera G., Castañeda-Delgado J.E., García-Pérez C.A., Enciso-Moreno J.A., Lara-Ramírez E. The analysis on the human protein domain targets and host-like interacting motifs for the MERS-CoV and SARS-CoV/CoV-2 infers the molecular mimicry of coronavirus. PLoS ONE. 2021;16:e0246901. doi: 10.1371/journal.pone.0246901. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50.Tayal S., Bhatia V., Mehrotra T., Bhatnagar S. ImitateDB: A database for domain and motif mimicry incorporating host and pathogen protein interactions. Amino Acids. 2022;54:923–934. doi: 10.1007/s00726-022-03163-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 51.Jumper J., Evans R., Pritzel A., Green T., Figurnov M., Tunyasuvunakool K., Ronneberger O., Bates R., Žídek A., Bridgland A., et al. AlphaFold 2. 2020. [(accessed on 14 June 2023)]. Available online: https://predictioncenter.org/casp14/doc/presentations/2020_12_01_TS_predictor_AlphaFold2.pdf.
- 52.David A., Islam S., Tankhilevich E., Sternberg M. The AlphaFold database of protein structures: A biologist’s guide. J. Mol. Biol. 2022;434:167336. doi: 10.1016/j.jmb.2021.167336. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53.Gelly J.-C., Joseph A.P., Srinivasan N., de Brevern A. iPBA: A tool for protein structure comparison using sequence alignment strategies. Nucleic Acids Res. 2011;39:W18–W23. doi: 10.1093/nar/gkr333. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54.Zhang Y., Skolnick J. TM-align: A protein structure alignment algorithm based on the TM-score. Nucleic Acids Res. 2005;33:2302–2309. doi: 10.1093/nar/gki524. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 55.Rahmati S., Abovsky M., Pastrello C., Kotlyar M., Lu R., Cumbaa C.A., Rahman P., Chandran V., Jurisica I. pathDIP 4: An extended pathway annotations and enrichment analysis resource for human, model organisms and domesticated species. Nucleic Acids Res. 2020;48:D479–D488. doi: 10.1093/nar/gkz989. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 56.Nguyen D.-T., Mathias S., Bologa C., Brunak S., Fernandez N., Gaulton A., Hersey A., Holmes J., Jensen L.J., Karlsson A. Pharos: Collating protein information to shed light on the druggable genome. Nucleic Acids Res. 2017;45:D995–D1002. doi: 10.1093/nar/gkw1072. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 57.Rahmati S., Abovsky M., Pastrello C., Jurisica I. pathDIP: An annotated resource for known and predicted human gene-pathway associations and pathway enrichment analysis. Nucleic Acids Res. 2017;45:D419–D426. doi: 10.1093/nar/gkw1082. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 58.Doytchinova I.A., Flower D. VaxiJen: A server for prediction of protective antigens, tumour antigens and subunit vaccines. BMC Bioinform. 2007;8:1–7. doi: 10.1186/1471-2105-8-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 59.Gasteiger E., Hoogland C., Gattiker A., Duvaud S.e., Wilkins M.R., Appel R.D., Bairoch A. Protein Identification and Analysis Tools on the ExPASy Server. Springer; Berlin/Heidelberg, Germany: 2005. [Google Scholar]
- 60.Grote A., Hiller K., Scheer M., Münch R., Nörtemann B., Hempel D.C., Jahn D. JCat: A novel tool to adapt codon usage of a target gene to its potential expression host. Nucleic Acids Res. 2005;33:W526–W531. doi: 10.1093/nar/gki376. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 61.Castiglione F., Bernaschi M. C-immsim: Playing with the immune response; Proceedings of the Sixteenth International Symposium on Mathematical Theory of Networks and Systems (MTNS2004); KU Leuven, Belgium. 5–9 July 2004. [Google Scholar]
- 62.Jiang S., Bottazzi M.E., Du L., Lustigman S., Tseng C.-T.K., Curti E., Jones K., Zhan B., Hotez P. Roadmap to developing a recombinant coronavirus S protein receptor-binding domain vaccine for severe acute respiratory syndrome. Expert Rev. Vaccines. 2012;11:1405–1413. doi: 10.1586/erv.12.126. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 63.Delgado M.F., Coviello S., Monsalvo A.C., Melendi G.A., Hernandez J.Z., Batalle J.P., Diaz L., Trento A., Chang H.-Y., Mitzner W. Lack of antibody affinity maturation due to poor Toll-like receptor stimulation leads to enhanced respiratory syncytial virus disease. Nat. Med. 2009;15:34–41. doi: 10.1038/nm.1894. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 64.Waterhouse A., Bertoni M., Bienert S., Studer G., Tauriello G., Gumienny R., Heer F.T., de Beer T.A.P., Rempfer C., Bordoli L. SWISS-MODEL: Homology modelling of protein structures and complexes. Nucleic Acids Res. 2018;46:W296–W303. doi: 10.1093/nar/gky427. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 65.Zhang Y. I-TASSER server for protein 3D structure prediction. BMC Bioinform. 2008;9:1–8. doi: 10.1186/1471-2105-9-40. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 66.Kozakov D., Hall D.R., Xia B., Porter K.A., Padhorny D., Yueh C., Beglov D., Vajda S. The ClusPro web server for protein–protein docking. Nat. Protoc. 2017;12:255–278. doi: 10.1038/nprot.2016.169. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 67.Comeau S.R., Gatchell D.W., Vajda S., Camacho C. ClusPro: A fully automated algorithm for protein–protein docking. Nucleic Acids Res. 2004;32:W96–W99. doi: 10.1093/nar/gkh354. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 68.Xue L.C., Rodrigues J.P., Kastritis P.L., Bonvin A.M., Vangone A.J.B. PRODIGY: A web server for predicting the binding affinity of protein–protein complexes. Bioinformatics. 2016;32:3676–3678. doi: 10.1093/bioinformatics/btw514. [DOI] [PubMed] [Google Scholar]
- 69.Loshaj-Shala A., Regazzoni L., Daci A., Orioli M., Brezovska K., Panovska A.P., Beretta G., Suturkova L. Guillain Barré syndrome (GBS): New insights in the molecular mimicry between C. jejuni and human peripheral nerve (HPN) proteins. J. Neuroimmunol. 2015;289:168–176. doi: 10.1016/j.jneuroim.2015.11.005. [DOI] [PubMed] [Google Scholar]
- 70.Yokota S.-i., Chiba S., Furuyama H., Fujii N. Cerebrospinal fluids containing anti-HSP70 autoantibodies from multiple sclerosis patients augment HSP70-induced proinflammatory cytokine production in monocytic cells. J. Neuroimmunol. 2010;218:129–133. doi: 10.1016/j.jneuroim.2009.10.009. [DOI] [PubMed] [Google Scholar]
- 71.Mosenson J.A., Zloza A., Nieland J.D., Garrett-Mayer E., Eby J.M., Huelsmann E.J., Kumar P., Denman C.J., Lacek A.T., Kohlhapp F. Mutant HSP70 reverses autoimmune depigmentation in vitiligo. Sci. Transl. Med. 2013;5:174ra128. doi: 10.1126/scitranslmed.3005127. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 72.Lemos J., Giambiagi-Demarval M., Castro A. Expression of heat-shock proteins in Streptococcus pyogenes and their immunoreactivity with sera from patients with streptococcal diseases. J. Med. Microbiol. 1998;47:711–715. doi: 10.1099/00222615-47-8-711. [DOI] [PubMed] [Google Scholar]
- 73.Shraibman B., Barnea E., Kadosh D.M., Haimovich Y., Slobodin G., Rosner I., López-Larrea C., Hilf N., Kuttruff S., Song C., et al. Identification of tumor antigens among the HLA peptidomes of glioblastoma tumors and plasma. Mol. Cell. Proteom. 2018;17:2132–2145. doi: 10.1074/mcp.RA118.000792. [DOI] [PMC free article] [PubMed] [Google Scholar] [Retracted]
- 74.Sudhir P.-R., Lin T.-D., Zhang Q. HLA allele-specific quantitative profiling of type 1 diabetic b lymphocyte immunopeptidome. J. Proteome Res. 2021;21:250–264. doi: 10.1021/acs.jproteome.1c00842. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 75.Shoda H., Hanata N., Sumitomo S., Okamura T., Fujio K., Yamamoto K. Immune responses to Mycobacterial heat shock protein 70 accompany self-reactivity to human BiP in rheumatoid arthritis. Sci. Rep. 2016;6:22486. doi: 10.1038/srep22486. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 76.Requena J.M., Soto M., Guzman F., Maekelt A., Noya O., Patarroyo M.E., Alonso C. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals. Mol. Immunol. 1993;30:1115–1121. doi: 10.1016/0161-5890(93)90158-8. [DOI] [PubMed] [Google Scholar]
- 77.Adams E., Britton W., Morgan A., Sergeantson S., Basten A. Individuals from Different Populations Identify Multiple and Diverse T-Cell Determinants on Mycobacterial HSP70. Scand. J. Immunol. 1994;39:588–596. doi: 10.1111/j.1365-3083.1994.tb03417.x. [DOI] [PubMed] [Google Scholar]
- 78.Sigdel K.R., Cheng A., Wang Y., Duan L., Zhang Y. The emerging functions of long noncoding RNA in immune cells: Autoimmune diseases. J. Immunol. Res. 2015;2015:848790. doi: 10.1155/2015/848790. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 79.Read S.A., Tay E., Shahidi M., George J., Douglas M. Hepatitis C virus infection mediates cholesteryl ester synthesis to facilitate infectious particle production. J. Gen. Virol. 2014;95:1900–1910. doi: 10.1099/vir.0.065300-0. [DOI] [PubMed] [Google Scholar]
- 80.Li Y., Leung E.L.-H., Pan H., Yao X., Huang Q., Wu M., Xu T., Wang Y., Cai J., Li R. Identification of potential genetic causal variants for rheumatoid arthritis by whole-exome sequencing. Oncotarget. 2017;8:111119. doi: 10.18632/oncotarget.22630. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 81.Dudek N.L., Tan C.T., Gorasia D.G., Croft N.P., Illing P.T., Purcell A. Constitutive and inflammatory immunopeptidome of pancreatic β-cells. Diabetes. 2012;61:3018–3025. doi: 10.2337/db11-1333. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 82.Wong S.M., Jackson M.D., Akerley B. Suppression of alternative lipooligosaccharide glycosyltransferase activity by UDP-galactose epimerase enhances murine lung infection and evasion of serum IgM. Front. Cell. Infect. Microbiol. 2019;9:160. doi: 10.3389/fcimb.2019.00160. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 83.Maji A., Misra R., Kumar Mondal A., Kumar D., Bajaj D., Singhal A., Arora G., Bhaduri A., Sajid A., Bhatia S. Expression profiling of lymph nodes in tuberculosis patients reveal inflammatory milieu at site of infection. Sci. Rep. 2015;5:15214. doi: 10.1038/srep15214. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 84.Zhang Z. Genomic biomarker heterogeneities between SARS-CoV-2 and COVID-19. Vaccines. 2022;10:1657. doi: 10.3390/vaccines10101657. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 85.Hu J., Zhou S., Guo W. Construction of the coexpression network involved in the pathogenesis of thyroid eye disease via bioinformatics analysis. Hum. Genom. 2022;16:1–15. doi: 10.1186/s40246-022-00412-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 86.Peng S., Wang J., Wei S., Li C., Zhou K., Hu J., Ye X., Yan J., Liu W., Gao G. Endogenous cellular microRNAs mediate antiviral defense against influenza A virus. Mol. Ther. Nucleic Acids. 2018;10:361–375. doi: 10.1016/j.omtn.2017.12.016. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 87.Huang T., Huang X., Yao M. miR-143 inhibits intracellular salmonella growth by targeting ATP6V1A in macrophage cells in pig. Res. Vet. Sci. 2018;117:138–143. doi: 10.1016/j.rvsc.2017.12.006. [DOI] [PubMed] [Google Scholar]
- 88.Liu X., Li F., Zhang J., Wang L., Wang J., Wen Z., Wang Z., Shuai L., Wang X., Ge J. The ATPase ATP6V1A facilitates rabies virus replication by promoting virion uncoating and interacting with the viral matrix protein. J. Biol. Chem. 2021;296 doi: 10.1074/jbc.RA120.014190. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 89.Grodzki M., Bluhm A.P., Schaefer M., Tagmount A., Russo M., Sobh A., Rafiee R., Vulpe C.D., Karst S.M., Norris M. Genome-scale CRISPR screens identify host factors that promote human coronavirus infection. Genome Med. 2022;14:1–18. doi: 10.1186/s13073-022-01013-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 90.Blischak J.D., Tailleux L., Mitrano A., Barreiro L.B., Gilad Y. Mycobacterial infection induces a specific human innate immune response. Sci. Rep. 2015;5:16882. doi: 10.1038/srep16882. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 91.Raphael I., Webb J., Gomez-Rivera F., Chase Huizar C.A., Gupta R., Arulanandam B.P., Wang Y., Haskins W.E., Forsthuber T. Serum neuroinflammatory disease-induced central nervous system proteins predict clinical onset of experimental autoimmune encephalomyelitis. Front. Immunol. 2017;8:812. doi: 10.3389/fimmu.2017.00812. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 92.Gerstner C., Dubnovitsky A., Sandin C., Kozhukh G., Uchtenhagen H., James E.A., Ronnelid J., Ytterberg A.J., Pieper J., Reed E. Functional and Structural Characterization of a Novel HLA-DRB1* 04: 01-Restricted alpha-Enolase T Cell Epitope in Rheumatoid Arthritis. Front. Immunol. 2016;7:494. doi: 10.3389/fimmu.2016.00494. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 93.Moreno I., Jr., Rodríguez-Sánchez I., Schafer X., Munger J. Human cytomegalovirus induces neuronal enolase to support virally mediated metabolic remodeling. Proc. Natl. Acad. Sci. USA. 2022;119:e2205789119. doi: 10.1073/pnas.2205789119. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 94.Gaseitsiwe S., Valentini D., Mahdavifar S., Magalhaes I., Hoft D.F., Zerweck J., Schutkowski M., Andersson J., Reilly M., Maeurer M. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis. PLoS ONE. 2008;3:e3840. doi: 10.1371/journal.pone.0003840. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 95.Zhao M., Wu J., Li X., Gao Y. Urinary candidate biomarkers in an experimental autoimmune myocarditis rat model. J. Proteom. 2018;179:71–79. doi: 10.1016/j.jprot.2018.02.032. [DOI] [PubMed] [Google Scholar]
- 96.Mishra N., Huang X., Joshi S., Guo C., Ng J., Thakkar R., Wu Y., Dong X., Li Q., Pinapati R. Immunoreactive peptide maps of SARS-CoV-2. Commun. Biol. 2021;4:225. doi: 10.1038/s42003-021-01743-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 97.González-Sapienza G., Cachau R. Identification of critical residues of an immunodominant region of Echinococcus granulosus antigen B. J. Biol. Chem. 2003;278:20179–20184. doi: 10.1074/jbc.M212724200. [DOI] [PubMed] [Google Scholar]
- 98.Zhang P., Minardi L.M., Todd Kuenstner J., Zekan S.M., Zhu F., Hu Y., Kruzelock R. Cross—Reactivity of antibodies against microbial proteins to human tissues as basis of Crohn’s disease and other autoimmune diseases. bioRxiv. 2017:116574. [Google Scholar]
- 99.Zhang P., Minardi L.M., Kuenstner J.T., Zekan S.M., Kruzelock R.J.B. Seroprevalence of anti-microbial antibodies in the normal healthy population with implications in chronic diseases. bioRxiv. 2019:693655. [Google Scholar]
- 100.Syed S., Viazmina L., Mager R., Meri S., Haapasalo K. Streptococci and the complement system: Interplay during infection, inflammation and autoimmunity. FEBS Lett. 2020;594:2570–2585. doi: 10.1002/1873-3468.13872. [DOI] [PubMed] [Google Scholar]
- 101.Harvey K.L., Jarocki V.M., Charles I.G., Djordjevic S. The diverse functional roles of elongation factor Tu (EF-Tu) in microbial pathogenesis. Front. Microbiol. 2019;10:2351. doi: 10.3389/fmicb.2019.02351. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 102.Lo K.C., Sullivan E., Bannen R.M., Jin H., Rowe M., Li H., Pinapati R.S., Cartwright A.J., Tan J.C., Patel J., et al. Comprehensive profiling of the rheumatoid arthritis antibody repertoire. Arthritis Rheumatol. 2020;72:242–250. doi: 10.1002/art.41089. [DOI] [PubMed] [Google Scholar]
- 103.Venema W.J., Hiddingh S., de Boer J.H., Claas F.H., Mulder A., den Hollander A.I., Stratikos E., Sarkizova S., van der Veken L.T., Janssen G. ERAP2 increases the abundance of a peptide submotif highly selective for the birdshot uveitis-associated HLA-A29. Front. Immunol. 2021;12:634441. doi: 10.3389/fimmu.2021.634441. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 104.Caradonna S.J., Cheng Y. Induction of uracil-DNA glycosylase and dUTP nucleotidohydrolase activity in herpes simplex virus-infected human cells. J. Biol. Chem. 1981;256:9834–9837. doi: 10.1016/S0021-9258(19)68704-1. [DOI] [PubMed] [Google Scholar]
- 105.Stuart D., Upton C., Higman M., Niles E., McFadden G. A poxvirus-encoded uracil DNA glycosylase is essential for virus viability. J. Virol. 1993;67:2503–2512. doi: 10.1128/jvi.67.5.2503-2512.1993. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 106.James E.A., Gates T.J., LaFond R.E., Yamamoto S., Ni C., Mai D., Gersuk V.H., O’Brien K., Nguyen Q.-A., Zeitner B. Neuroinvasive West Nile infection elicits elevated and atypically polarized T cell responses that promote a pathogenic outcome. PLoS Pathog. 2016;12:e1005375. doi: 10.1371/journal.ppat.1005375. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 107.Life P., Hassell A., Williams K., Young S., Bacon P., Southwood T., Gaston J. Responses to gram negative enteric bacterial antigens by synovial T cells from patients with juvenile chronic arthritis: Recognition of heat shock protein HSP60. J. Rheumatol. 1993;20:1388–1396. [PubMed] [Google Scholar]
- 108.Ford P., Gemmell E., Hamlet S., Hasan A., Walker P., West M., Cullinan M., Seymour G. Cross-reactivity of GroEL antibodies with human heat shock protein 60 and quantification of pathogens in atherosclerosis. Oral Microbiol. Immunol. 2005;20:296–302. doi: 10.1111/j.1399-302X.2005.00230.x. [DOI] [PubMed] [Google Scholar]
- 109.Rodolico V., Tomasello G., Zerilli M., Martorana A., Pitruzzella A., Marino Gammazza A., David S., Zummo G., Damiani P., Accomando S., et al. Hsp60 and Hsp10 increase in colon mucosa of Crohn’s disease and ulcerative colitis. Cell Stress Chaperones. 2010;15:877–884. doi: 10.1007/s12192-010-0196-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 110.De Jong H., Lafeber F.F., de Jager W., Haverkamp M.H., Kuis W., Bijlsma J.W., Prakken B.J., Albani S. PAN–DR-Binding Hsp60 self epitopes induce an interleukin-10–mediated immune response in rheumatoid arthritis. Arthritis Rheum. 2009;60:1966–1976. doi: 10.1002/art.24656. [DOI] [PubMed] [Google Scholar]
- 111.Dieudé M., Senécal J.L., Raymond Y. Induction of endothelial cell apoptosis by heat-shock protein 60–reactive antibodies from anti–endothelial cell autoantibody–positive systemic lupus erythematosus patients. Arthritis Rheum. 2004;50:3221–3231. doi: 10.1002/art.20564. [DOI] [PubMed] [Google Scholar]
- 112.Aragona P., Magazzu G., Macchia G., Bartolone S., Di Pasquale G., Vitali C., Ferreri G. Presence of antibodies against Helicobacter pylori and its heat-shock protein 60 in the serum of patients with Sjögren’s syndrome. J. Rheumatol. 1999;26:1306–1311. [PubMed] [Google Scholar]
- 113.Jones D.B., Coulson A.F., Duff G. Sequence homologies between hsp60 and autoantigens. Immunol. Today. 1993;14:115–118. doi: 10.1016/0167-5699(93)90210-C. [DOI] [PubMed] [Google Scholar]
- 114.Marino Gammazza A., Rizzo M., Citarrella R., Rappa F., Campanella C., Bucchieri F., Patti A., Nikolic D., Cabibi D., Amico G., et al. Elevated blood Hsp60, its structural similarities and cross-reactivity with thyroid molecules, and its presence on the plasma membrane of oncocytes point to the chaperonin as an immunopathogenic factor in Hashimoto’s thyroiditis. Cell Stress Chaperones. 2014;19:343–353. doi: 10.1007/s12192-013-0460-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 115.Francesco C., Everly C., Alberto J. HSPD1 (heat shock 60 kDa protein 1) Atlas Genet. Cytogenet. Oncol. Haematol. 2015;19:575–585. [Google Scholar]
- 116.Vojdani A., Bazargan M., Vojdani E., Samadi J., Nourian A.A., Eghbalieh N., Cooper E. Heat shock protein and gliadin peptide promote development of peptidase antibodies in children with autism and patients with autoimmune disease. Clin. Vaccine Immunol. 2004;11:515–524. doi: 10.1128/CDLI.11.3.515-524.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 117.Gonciarz W., Matusiak A., Rudnicka K., Rechciński T., Chałubiński M., Czkwianianc E., Broncel M., Gajewski A., Chmiela M. Autoantibodies to a specific peptide epitope of human Hsp60 (ATVLA) with homology to Helicobacter pylori HspB in H. pylori-infected patients. APMIS J. Pathol. Microbiol. Immunol. 2019;127:139–149. doi: 10.1111/apm.12925. [DOI] [PubMed] [Google Scholar]
- 118.Lopez J.A.M., Cordero J.F.B., Russo U.D.B., Villarreal M.A.G., Hernández F.A.T., Bonilla J.A.A., Amaya G.P.B., Dumaguala M.R.J., Valencia C.C.R. Molecular Mimetism between Cystic Fibrosis and P. aeruginosa and S. aureus, Possible Cause of Autoimmunity? In-Silico Analysis. J. Biomed. Sci. 2022;4:2066–2072. [Google Scholar]
- 119.Perschinka H., Mayr M., Millonig G., Mayerl C., van der Zee R., Morrison S.G., Morrison R.P., Xu Q., Wick G. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis. Arterioscler. Thromb. Vasc. Biol. 2003;23:1060–1065. doi: 10.1161/01.ATV.0000071701.62486.49. [DOI] [PubMed] [Google Scholar]
- 120.Abulafia-Lapid R., Elias D., Raz I., Keren-Zur Y., Atlan H., Cohen I. T cell proliferative responses of type 1 diabetes patients and healthy individuals to human hsp60 and its peptides. J. Autoimmun. 1999;12:121–129. doi: 10.1006/jaut.1998.0262. [DOI] [PubMed] [Google Scholar]
- 121.Wizrah M.S., Chua S.M., Luo Z., Manik M.K., Pan M., Whyte J.M., Robertson A.A., Kappler U., Kobe B., Fraser J. AICAR transformylase/IMP cyclohydrolase (ATIC) is essential for de novo purine biosynthesis and infection by Cryptococcus neoformans. J. Biol. Chem. 2022;298:102453. doi: 10.1016/j.jbc.2022.102453. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 122.Guvenel A., Jozwik A., Ascough S., Ung S.K., Paterson S., Kalyan M., Gardener Z., Bergstrom E., Kar S., Habibi M. Epitope-specific airway-resident CD4+ T cell dynamics during experimental human RSV infection. J. Clin. Investig. 2020;130:523–538. doi: 10.1172/JCI131696. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 123.Cagnazzo T.d.O., Nogueira C.T., Castro C.A.d., Neris D.M., Fattori A.C.M., Correia R.d.O., Albuquerque Y.R., Fragelli B.D.d.L., Mendes T.M.F., Allegretti S. Investigating Immunization With Nucleotide Enzymes of Schistosoma Mansoni: Nucleoside Diphosphate Kinase and Adenylosuccinate Lyase as New Antigenic Targets Against Schistosomiasis. Front. Immunol. 2020;11:569988. doi: 10.3389/fimmu.2020.569988. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 124.Rahman K.S., Darville T., Russell A.N., O’Connell C.M., Wiesenfeld H.C., Hillier S.L., Chowdhury E.U., Juan Y.-C., Kaltenboeck B. Discovery of human-specific immunodominant Chlamydia trachomatis B cell epitopes. mSphere. 2018;3 doi: 10.1128/mSphere.00246-18. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 125.Lin S.Y.-H., Cheng C.-W., Su E. Prediction of B-cell epitopes using evolutionary information and propensity scales. BMC Bioinformatics. 2013;14:S10. doi: 10.1186/1471-2105-14-S2-S10. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 126.Chauvin A., Bouvet G., Boulard C. Humoral and cellular immune responses to Fasciola hepatica experimental primary and secondary infection in sheep. Int. J. Parasitol. 1995;25:1227–1241. doi: 10.1016/0020-7519(95)00039-5. [DOI] [PubMed] [Google Scholar]
- 127.Boes M. Role of natural and immune IgM antibodies in immune responses. Mol. Immunol. 2000;37:1141–1149. doi: 10.1016/S0161-5890(01)00025-6. [DOI] [PubMed] [Google Scholar]
- 128.Coutelier J.-P., Van Der Logt J., Heessen F. IgG subclass distribution of primary and secondary immune responses concomitant with viral infection. J. Immunol. 1991;147:1383–1386. doi: 10.4049/jimmunol.147.4.1383. [DOI] [PubMed] [Google Scholar]
- 129.Guillerey C., Nakamura K., Vuckovic S., Hill G.R., Smyth M. Immune responses in multiple myeloma: Role of the natural immune surveillance and potential of immunotherapies. Cell. Mol. Life Sci. 2016;73:1569–1589. doi: 10.1007/s00018-016-2135-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 130.Round J.L., O’Connell R.M., Mazmanian S. Coordination of tolerogenic immune responses by the commensal microbiota. J. Autoimmun. 2010;34:J220–J225. doi: 10.1016/j.jaut.2009.11.007. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 131.Nikolich-Žugich J. The twilight of immunity: Emerging concepts in aging of the immune system. Nat. Immunol. 2018;19:10–19. doi: 10.1038/s41590-017-0006-x. [DOI] [PubMed] [Google Scholar]
- 132.Siegrist C. Vaccine Immunology. [(accessed on 16 June 2023)];2008 Volume 5:17–36. Available online: http://www.who.int/immunization/documents/Elsevier_Vaccine_immunology.pdf. [Google Scholar]
- 133.Souza-Fonseca-Guimaraes F., Adib-Conquy M., Cavaillon J. Natural killer (NK) cells in antibacterial innate immunity: Angels or devils? Mol. Med. 2012;18:270–285. doi: 10.2119/molmed.2011.00201. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 134.Studer G., Rempfer C., Waterhouse A.M., Gumienny R., Haas J., Schwede T. QMEANDisCo—Distance constraints applied on model quality estimation. Bioinformatics. 2020;36:1765–1771. doi: 10.1093/bioinformatics/btz828. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 135.Monirinasab H., Zakariazadeh M., Kohestani H., Kouhestani M., Fathi F. Study of β-lactam-based drug interaction with albumin protein using optical, sensing, and docking methods. J. Biol. Phys. 2022;48:177–194. doi: 10.1007/s10867-021-09599-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 136.Holler P.D., Kranz D. Quantitative analysis of the contribution of TCR/pepMHC affinity and CD8 to T cell activation. Immunity. 2003;18:255–264. doi: 10.1016/S1074-7613(03)00019-0. [DOI] [PubMed] [Google Scholar]
- 137.Vangone A., Bonvin A. Contacts-based prediction of binding affinity in protein–protein complexes. eLife. 2015;4:e07454. doi: 10.7554/eLife.07454. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 138.Czepiel J., Dróżdż M., Pituch H., Kuijper E.J., Perucki W., Mielimonka A., Goldman S., Wultańska D., Garlicki A., Biesiada G., et al. Clostridium difficile infection. Eur. J. Clin. Microbiol. Infect. Dis. 2019;38:1211–1221. doi: 10.1007/s10096-019-03539-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 139.Balsells E., Shi T., Leese C., Lyell I., Burrows J., Wiuff C., Campbell H., Kyaw M.H., Nair H. Global burden of Clostridium difficile infections: A systematic review and meta-analysis. J. Glob. Health. 2019;9:010407. doi: 10.7189/jogh.09.010407. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 140.Revolinski S.L., Munoz-Price L. Clostridium difficile in immunocompromised hosts: A review of epidemiology, risk factors, treatment, and prevention. Clin. Infect. Dis. 2019;68:2144–2153. doi: 10.1093/cid/ciy845. [DOI] [PubMed] [Google Scholar]
- 141.Teneberg S., Lönnroth I., López J.F.T., Galili U., Halvarsson M.Ö., Ångström J., Karlsson K. Molecular mimicry in the recognition of glycosphingolipids by Galα3Galβ4GlcNAcβ-binding Clostridium difficile toxin A, human natural anti α-galactosyl IgG and the monoclonal antibody Gal-13: Characterization of a binding-active human glycosphingolipid, non-identical with the animal receptor. Glycobiology. 1996;6:599–609. doi: 10.1093/glycob/6.6.599. [DOI] [PubMed] [Google Scholar]
- 142.Mindur J.E., Yadav S.K., Ito N., Senoh M., Kato H., Dhib-Jalbut S., Ito K. Surface layer protein a expressed in Clostridioides difficile DJNS06-36 possesses an encephalitogenic mimotope of myelin basic protein. Microorganisms. 2020;9:34. doi: 10.3390/microorganisms9010034. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 143.Alam J., Kim Y.C., Choi Y. Potential role of bacterial infection in autoimmune diseases: A new aspect of molecular mimicry. Immune Netw. 2014;14:7–13. doi: 10.4110/in.2014.14.1.7. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 144.Mayo I., Arizti P., Parés A., Oliva J., Doforno R.A., de Sagarra M.R., Rodés J., Castaño J. Antibodies against the COOH-terminal region of E. coli ClpP protease in patients with primary biliary cirrhosis. J. Hepatol. 2000;33:528–536. doi: 10.1034/j.1600-0641.2000.033004528.x. [DOI] [PubMed] [Google Scholar]
- 145.Zhang C., Zhang T.-X., Liu Y., Jia D., Zeng P., Du C., Yuan M., Liu Q., Wang Y., Shi F. B-cell compartmental features and molecular basis for therapy in autoimmune disease. Neurol. Neuroimmunol. Neuroinflamm. 2021;8:e1070. doi: 10.1212/NXI.0000000000001070. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 146.Mansilla M.J., Montalban X., Espejo C. Heat shock protein 70: Roles in multiple sclerosis. Mol. Med. 2012;18:1018–1028. doi: 10.2119/molmed.2012.00119. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 147.Fouani M., Basset C.A., Mangano G.D., Leone L.G., Lawand N.B., Leone A., Barone R. Heat shock proteins alterations in rheumatoid arthritis. Int. J. Mol. Sci. 2022;23:2806. doi: 10.3390/ijms23052806. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 148.Lucchese G., Flöel A. Chaperones. SARS-CoV-2 and Guillain-Barré syndrome: Molecular mimicry with human heat shock proteins as potential pathogenic mechanism. Cell Stress Chaperones. 2020;25:731–735. doi: 10.1007/s12192-020-01145-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 149.Tukaj S. Heat shock protein 70 as a double agent acting inside and outside the cell: Insights into autoimmunity. Int. J. Mol. Sci. 2020;21:5298. doi: 10.3390/ijms21155298. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 150.Yamamoto T., Eguchi T. Heat Shock Proteins in Inflammatory Diseases. Springer; Berlin/Heidelberg, Germany: 2020. Heat Shock Proteins and Periodontitis–Cross-Reaction Between Bacterial and Human HSP in Periodontal Infection Linking with Cardiovascular Diseases; pp. 19–32. [Google Scholar]
- 151.Malik J.A., Lone R. Heat shock proteins with an emphasis on HSP 60. Mol. Biol. Rep. 2021;48:6959–6969. doi: 10.1007/s11033-021-06676-4. [DOI] [PubMed] [Google Scholar]
- 152.Repetto O., Zanussi S., Casarotto M., Canzonieri V., De Paoli P., Cannizzaro R., De Re V. Differential proteomics of Helicobacter pylori associated with autoimmune atrophic gastritis. Mol. Med. 2014;20:57–71. doi: 10.2119/molmed.2013.00076. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 153.Qeshmi S.A., Dabbagh F., Haghighi A.B., Ghasemi Y. Bioinformatics evaluation of the possibility of heat shock proteins as autoantigens in multiple sclerosis based on molecular mimicry hypothesis. J. Neuroimmunol. 2016;295:100–121. doi: 10.1016/j.jneuroim.2016.03.018. [DOI] [PubMed] [Google Scholar]
- 154.Lee Y.M., Huh K.C., Yoon S.M., Jang B.I., Shin J.E., Koo H.S., Jung Y., Kim S.H., Moon H.S., Lee S., et al. Incidence and clinical outcomes of Clostridium difficile infection after treatment with tuberculosis medication. Gut Liver. 2016;10:250. doi: 10.5009/gnl14435. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 155.Kullin B.R., Reid S., Abratt V. Clostridium difficile in patients attending tuberculosis hospitals in Cape Town, South Africa, 2014–2015. Afr. J. Lab. Med. 2018;7:1–9. doi: 10.4102/ajlm.v7i2.846. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 156.Obuch-Woszczatyński P., Dubiel G., Harmanus C., Kuijper E., Duda U., Wultańska D., Van Belkum A., Pituch H. Emergence of Clostridium difficile infection in tuberculosis patients due to a highly rifampicin-resistant PCR ribotype 046 clone in Poland. Eur. J. Clin. Microbiol. Infect. Dis. 2013;32:1027–1030. doi: 10.1007/s10096-013-1845-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 157.Chang K., Leung C., Yew W., Lam F., Ho P., Chau C., Cheng V., Yuen K. Analyses of fluoroquinolones and Clostridium difficile-associated diarrhoea in tuberculosis patients. Int. J. Tuberc. Lung Dis. 2009;13:341–346. [PubMed] [Google Scholar]
- 158.Collini P.J., Kuijper E., Dockrell D. Clostridium difficile infection in patients with HIV/AIDS. Curr. HIV/AIDS Rep. 2013;10:273–282. doi: 10.1007/s11904-013-0162-z. [DOI] [PubMed] [Google Scholar]
- 159.Clem A. Fundamentals of vaccine immunology. J. Glob. Infect. Dis. 2011;3:73. doi: 10.4103/0974-777X.77299. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 160.Irvine D.J., Swartz M.A., Szeto G. Engineering synthetic vaccines using cues from natural immunity. Nat. Mater. 2013;12:978–990. doi: 10.1038/nmat3775. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 161.Vadalà M., Poddighe D., Laurino C., Palmieri B. Vaccination and autoimmune diseases: Is prevention of adverse health effects on the horizon? EPMA J. 2017;8:295–311. doi: 10.1007/s13167-017-0101-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 162.Horwitz D.A., Fahmy T.M., Piccirillo C.A., La Cava A. Rebalancing immune homeostasis to treat autoimmune diseases. Trends Immunol. 2019;40:888–908. doi: 10.1016/j.it.2019.08.003. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 163.Dangkoub F., Sankian M., Tafaghodi M., Jaafari M.R., Badiee A. The impact of nanocarriers in the induction of antigen-specific immunotolerance in autoimmune diseases. J. Control. Release. 2021;339:274–283. doi: 10.1016/j.jconrel.2021.09.037. [DOI] [PubMed] [Google Scholar]
- 164.Divangahi M., Aaby P., Khader S.A., Barreiro L.B., Bekkering S., Chavakis T., van Crevel R., Curtis N., DiNardo A.R., Dominguez-Andres J. Trained immunity, tolerance, priming and differentiation: Distinct immunological processes. Nat. Immunol. 2021;22:2–6. doi: 10.1038/s41590-020-00845-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 165.Chong C.R., Park V.J., Cohen B., Postow M.A., Wolchok J.D., Kamboj M. Safety of inactivated influenza vaccine in cancer patients receiving immune checkpoint inhibitors. Clin. Infect. Dis. 2020;70:193–199. doi: 10.1093/cid/ciz202. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 166.Ke Y., Jiang G., Sun D., Kaplan H.J., Shao H. Anti-CD3 antibody ameliorates experimental autoimmune uveitis by inducing both IL-10 and TGF-β dependent regulatory T cells. Clin. Immunol. 2011;138:311–320. doi: 10.1016/j.clim.2010.12.016. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 167.Wraith D. Therapeutic peptide vaccines for treatment of autoimmune diseases. Immunol. Lett. 2009;122:134–136. doi: 10.1016/j.imlet.2008.11.013. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 168.Ishina I.A., Zakharova M.Y., Kurbatskaia I.N., Mamedov A.E., Belogurov A.A., Jr., Gabibov A. MHC Class II Presentation in Autoimmunity. Cells. 2023;12:314. doi: 10.3390/cells12020314. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 169.Liu J., Liu Z., Pang Y., Zhou H. The interaction between nanoparticles and immune system: Application in the treatment of inflammatory diseases. J. Nanobiotechnol. 2022;20:1–25. doi: 10.1186/s12951-022-01343-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Supplementary Materials
Data Availability Statement
All the data used or generated in this study are provided as an accession number or relevant information as tables in the manuscript.





