Skip to main content
NCBI home page
ACS AuthorChoice logoLink to ACS AuthorChoice
. 2024 Jan 17;96(4):1767–1773. doi: 10.1021/acs.analchem.3c04958

Facile Method for Determining Lanthipeptide Stereochemistry

Youran Luo †, Shuyun Xu †, Autumn M Frerk †,‡, Wilfred A van der Donk †,‡,§,*
PMCID: PMC10831782  PMID: 38232355

Abstract

graphic file with name ac3c04958_0006.jpg

Lanthipeptides make up a large group of natural products that belong to the ribosomally synthesized and post-translationally modified peptides (RiPPs). Lanthipeptides contain lanthionine and methyllanthionine bis-amino acids that have varying stereochemistry. The stereochemistry of new lanthipeptides is often not determined because current methods require equipment that is not standard in most laboratories. In this study, we developed a facile, efficient, and user-friendly method for detecting lanthipeptide stereochemistry, utilizing advanced Marfey’s analysis with detection by liquid chromatography coupled with mass spectrometry (LC-MS). Under optimized conditions, 0.05 mg of peptide is sufficient to characterize the stereochemistry of five (methyl)lanthionines of different stereochemistry using a simple liquid chromatography setup, which is a much lower detection limit than current methods. In addition, we describe methods to readily access standards of the three different methyllanthionine stereoisomers and two different lanthionine stereoisomers that have been reported in known lanthipeptides. The developed workflow uses a commonly used nonchiral column system and offers a scalable platform to assist antimicrobial discovery. We illustrate its utility with an example of a lanthipeptide discovered by genome mining.

Lanthipeptides comprise one of the largest classes of ribosomally synthesized and post-translationally modified peptides (RiPPs).1 These peptides possess various biological functions, including antibacterial, antiviral, antifungal, and morphogenetic activities.2−4 Lanthipeptides are conformationally restrained to recognize their biological targets through thioether cross-links called lanthionine (Lan) and methyllanthionine (MeLan). These structures are formed by the enzymatic dehydration of Ser and Thr residues followed by the Michael-type addition of the thiols of Cys residues to the dehydrated amino acids (Figure 1).5 Lanthipeptides owe their various bioactivities to the intricate stereochemistry embedded in their three-dimensional geometry.

Figure 1.

Figure 1

Open in a new tab

(A) Lanthipeptide synthases catalyze the formation of lanthionines and methyllanthionines by dehydrating serine/threonine residues to generate dehydroalanine (Dha) and dehydrobutyrine (Dhb), followed by the thiol–Michael addition of l-cysteine onto the Dha/Dhb moieties. (B) Theoretical diastereomers of two lanthionines (Lan) and four methyllanthionines (MeLan). Five bolded diastereomers have been detected in lanthipeptides; l-allo-l-MeLan has thus far not been reported in natural lanthipeptides. (C) Structures of l-FDAA and l-FDLA.

Presently, researchers have identified five (Me)Lan diastereomers in characterized lanthipeptides, comprising two configurations of Lan, (2S,6R) and (2R,6R), and three stereoisomers of MeLan, (2S,3S,6R), (2R,3R,6R), and (2S,3S,6R).6−10 These isomers have been named dl- and ll-Lan, and dl-, ll-, and d-allo-l-MeLan, respectively (Figure 1). Their configurations were determined by first hydrolyzing the peptides to their individual amino acids and then chemically manipulating them to obtain volatile derivatives. These compounds were then analyzed by gas chromatography (GC) monitored by mass spectrometry using a column with a chiral stationary phase (CP-chirasil-l-Val) and compared to synthetic standards obtained by a multistep process.8,11 These methods have been successful but require relatively large amounts of material (∼1–2 mg for a typical lanthipeptide), a gas chromatograph, a chiral column, and chemical synthesis of standards of defined stereochemistry. Furthermore, in our hands, the chemical derivatization of the amino acids and subsequent injection onto the GC column damages the column that has a considerable price tag (∼$1400) such that its use is severely shortened (typically about 1 year of use). An alternative method that has been used is chemical desulfurization of Lan/MeLan residues and determination of the stereochemistry of the resulting Ala and 2-aminobutyric acid,12 but this strategy will not report on the stereochemistry on carbon 3 of MeLan.

Altering the stereochemistry of the (Me)Lan residues in the lanthipeptide lacticin 481 lead to the abolishment of its bioactivity.13 This observation underscores the critical role of stereochemistry in the biological function of lanthipeptides. Whereas it was once assumed that lanthipeptides all contained Lan/MeLan with the DL stereochemistry, recent studies have demonstrated that the stereochemistry of these residues in natural lanthipeptides is much more diverse and not always readily predicted.9,10,14−18 Investigating the structural diversity and the interplay of stereochemistry in lanthipeptides holds significant importance in understanding their mechanism of action and exploring their application. However, the stereochemistry of the Lan and MeLan residues of the great majority of newly reported lanthipeptides is not determined. Therefore, as more and more lanthipeptides are discovered by genome mining,19−46 a convenient method for determining their stereochemistry that is accessible to most laboratories would be valuable. We report here such a method including access to standards that use biochemical approaches that are complementary to chemical synthesis and methods available in most if not all laboratories studying lanthipeptides or RiPPs.

Marfey’s reagent, 1-fluoro-2,4-dinitrophenyl-5-l-alanine amide (l-FDAA, Figure 1C), has been widely used in peptide structure determination due to its ability to provide a robust and reliable method for analyzing the stereochemistry of amino acids in complex mixtures.47,48 The process involves hydrolysis of the peptide sample under acidic conditions followed by derivatization of the amino groups with l-FDAA to form diastereomers. Subsequently, these diastereomers are separated by high-performance liquid chromatography (HPLC). By analysis of the elution order and retention time and comparison with synthetic standards, the absolute stereochemistry of the hydrolyzed fragments in the peptide sample can be determined.

The increase in the number of possible derivatizations originating from multiple reactive groups such as amino, hydroxyl, and thiol groups in an amino acid analog can pose a challenge to Marfey’s analysis.48 Given that Lan and MeLan are bis(amino acids), they contain two sites of derivatization (Figure 1). The resulting problem was exemplified in the determination of the stereochemistry of d-allo-l methyllanthionine.10 In this case, bis-derivatization of the two amino groups with l-FDAA resulted in the overlap of the peaks of derivatized dl-MeLan and d-allo-l-MeLan in extracted ion chromatography (EIC).10 One possible explanation for this overlap is the limited interaction of FDAA with diastereomers that differ only in the stereochemistry at position 3 (Figure 1). We hypothesized that increasing the steric effect on the derivatization reagent might lead to full separation of the peaks of such diastereomers. In this regard, 1-fluoro-2,4-dinitrophenyl-5-l-leucine amide (l-FDLA, Figure 1C) has been used as a more robust reagent for amino acid characterization.49 Use of FDLA is often referred to as advanced Marfey’s analysis. We show herein that FDLA can distinguish the five known stereoisomers of (Me)Lan, and we describe how standards of these isomers can be obtained using publicly available resources. We illustrate the use of the methods with a lanthipeptide discovered by genome mining.

Experimental Section

Lan and MeLan Standard Preparation

Nisin

Nisin was obtained by extraction from a Sigma-Aldrich product that contains about 5% nisin from Lactococcus lactis. The process involved suspending 100 mg of the commercial product in 10 mL of extraction solvent consisting of 80% acetonitrile (MeCN)/20% H2O + 0.1% trifluoroacetic acid (TFA) in a 50 mL conical tube, followed by vigorous vortexing. After centrifuging at 4000g for 10 min, the supernatant was collected, and the extraction of the insoluble material was repeated twice with 10 mL of the same solvent. The combined supernatant was then filtered using a 10 K Amicon Ultra-15 Centrifugal Filter, and the resulting flowthrough was collected. The solution was frozen with liquid nitrogen and lyophilized. The resulting dry solid was redissolved in 10% MeCN/90% H2O + 0.1% TFA, filtered, and injected onto an Agilent preparative HPLC system for purification using a Phenomenex Luna C5 column (10 μm, 250 × 10 mm2). The following gradient conditions were used for the purification process: flow rate of 4 mL/min; solvent A H2O + 0.1% TFA, solvent B MeCN + 0.1% TFA; 0–5 min with 2% B, 5–15 min using a gradient of 2–40% B, and 15–30 min using a gradient of 40–100% B, with nisin eluting at approximately 20–22 min, corresponding to around 40% solvent B.

mCylLL and mCylLS

The modified cytolysin L precursor peptide (mCylLL) was expressed in Escherichia coli BL21 (DE3) cells using the plasmid pRSFDuet-1/CylLL/CylM-2 (Addgene ID #208759), following a previously reported method.9 For the preparation of lanthionine standard, 1 L of expression of mCylLL in LB medium was typically sufficient.

Purification was modified to ensure sample purity and to prevent protease digestion. After immobilized metal affinity chromatography (IMAC) purification, the elution was subjected to further purification using an Agilent preparative HPLC with a Phenomenex Luna C5 column (5 μm, 250 × 10 mm2). The following gradient conditions were used for the purification process: flow rate 4 mL/min, solvent A H2O + 0.1% TFA, solvent B MeCN + 0.1% TFA; 0–5 min with 2% B, 5–15 min using a gradient of 2–50% B, 15–30 min using a gradient of 50–60% B, 30–35 min using a gradient of 60–100% B. mCylLL eluted at 20–24 min, corresponding to 46–47% B.

The collected fractions were lyophilized to dryness and then redissolved in 10% MeCN/90% H2O + 0.1% TFA before injection onto an Agilent analytical HPLC system for purification using a Thermo Scientific C8 Hypersil GOLD column (5 μm, 4.6 × 250 mm2). The following gradient conditions were used for the purification process: flow rate of 1.0 mL/min, solvent A H2O + 0.1% TFA, solvent B MeCN + 0.1% TFA. The gradient profile was as follows: 0–2 min with 2% B, 2–10 min using a gradient of 2–30% B, 10–15 min using a gradient of 30–40% B, and 15–20 min using a gradient of 40–100% B. mCylLL eluted at 11–12 min, corresponding to 32–35% B. To ensure purity, only fractions showing significant absorption at wavelengths of 254 and 280 nm on a diode-array detector were collected and lyophilized for further usage. This method is also applicable to the expression and purification of mCylLS (plasmid available at Addgene ID #208760).

mCoiA1

The modified mCoiA1 was expressed in E. coli BL21 (DE3) cells using the plasmids pRSFDuet-1 His6-SUMO-CoiA1_CoiB and pETDuet-1 Coi_CoiSA(ED) (Addgene ID #208761 and #208762), following a previously reported method.10 For the preparation of the methyllanthionine standard, 1 L of expression of mCoiA1 in the TB medium was typically sufficient.

To ensure the purity of mCoiA1, the lyophilized elution from preparative HPLC purification was redissolved in 10% MeCN/90% H2O + 0.1% TFA and subjected to Agilent analytical HPLC purification using a Vydac C18 column (5 μm, 250 mm, No. 218TP54). The following gradient conditions were used for the purification process: flow rate of 1.0 mL/min, solvent A H2O + 0.1% TFA, solvent B MeCN + 0.1% TFA. The gradient profile was as follows: 0–2 min with 2% B, 2–10 min using a gradient of 2–60% B, 10–15 min using a gradient of 60–80% B, and 15–20 min using a gradient of 80–100% B. mCoiA1 eluted at 13–15 min, corresponding to 70–80% B. To ensure purity, only fractions showing significant absorption at 254 nm were collected and lyophilized for further usage.

mBuvA

Plasmids were constructed and used to transform E. coli using a previously reported method.30 Single colonies were selected and amplified in 5 mL of starter cultures in LB containing 50 μg/mL of kanamycin overnight. The starter culture was introduced into 1 L of LB medium containing 50 μg/mL of kanamycin and incubated at 37 °C with continuous shaking at 220 rpm until it reached an OD600 of approximately 0.8. Subsequently, the cultures were cooled on ice for approximately 15 min before the addition of isopropylthio-β-galactoside (IPTG) to a final concentration of 0.5 mM. Following this, the cultures were shaken overnight at 180 rpm at 18 °C. Cells were harvested by centrifugation at 6000g for 15 min at 4 °C. The supernatant was discarded, and the pellet was stored at −80 °C before purification.

The purification method was identical to that described for mCylLL, followed by an Agilent preparative HPLC step using a Phenomenex Luna C5 column (5 μm, 250 × 10 mm2). The following gradient conditions were used for the purification process: flow rate of 4 mL/min, solvent A H2O + 0.1% TFA, solvent B MeCN + 0.1% TFA; 0–5 min with 2% B, 5–35 min using a gradient of 2–80% B, and 35–40 min using a gradient of 80–100% B. mBuvA eluted at 27–32 min, corresponding to 62–72% B.

Peptide Hydrolysis and Derivatization of Amino Acids

The peptide sample (0.02–0.1 mg) was added to PYREX 25 mL screw cap culture tubes with phenolic caps (20 mm × 125 mm, No. 9825-20, Fisher Scientific), followed by 0.8 mL of 6 M DCl in D2O. N2 was bubbled through the solution for 1 min, and then the tube was sealed with the cap, and the mixture was stirred at 120 °C for 20 h or 155 °C for 3 h (see Figure S1). The high walls of the tube serve to condense the liquid, keeping it at reflux. For an alternative hydrolysis procedure that uses a heat block and no stirring, see the Supporting Information. The resulting mixture was dried using a rotary evaporator with the water bath at 80 °C, subsequently redissolved in deionized water, and dried twice more. Next, 0.6 mL of 0.8 M NaHCO3 (in H2O) and 0.4 mL of 10 mg/mL l-FDLA or d-FDLA (in MeCN) were added. Following stirring in the dark at 67 °C for 3 h, 0.1 mL of 6 M HCl was gently added, and the mixture was vortexed vigorously. The mixture was then frozen by using liquid nitrogen and lyophilized in the dark until dry. The dried solid was redissolved in 1 mL of MeCN and vortexed vigorously. The suspension was carefully transferred into 1.5 mL Eppendorf tubes using a long glass pipet and centrifuged at 16,000g for 15 min. Afterward, the resulting supernatant was transferred to screw vials for LC-MS analysis. For samples with a low peak intensity of (methyl)lanthionines, the extraction solution was further concentrated up to 5-fold before reanalysis.

LC-MS Analysis

LC-MS analysis was performed on an Agilent 6545 LC/Q-TOF instrument. A Kinetex F5 Core–Shell HPLC column (1.7 μm F5 100 Å, LC Column 100 mm × 2.1 mm) was used to analyze reactions of Lan/MeLan with l-FDLA and d-FDLA. During the analysis, the temperature of all columns was maintained at 45 °C. HPLC parameters were as follows: flow rate 0.40 mL/min and the use of two mobile phases (A: H2O+0.1% formic acid; B: acetonitrile). The gradient was set as 2%–30% B over 0–2.5 min, 30%–80% B over 2.5–10 min, 80%–100% B over 10–10.5 min, 100%–2% B over 10.5–11 min, and then 2% B re-equilibrium for 2.5 min. The mass spectrometer was set to ion polarity (negative mode), dual AJS ESI (gas temperature 325 °C, drying gas 10 L/min, nebulizer 35 psi, sheath gas temperature 375 °C, sheath gas flow rate 11 L/min, VCap 3500 V, nozzle voltage 0 V), MS TOF (Fragmenter 125 V, skimmer 65 V, Oct 1 TF Vpp 750 V), and acquisition parameters (automatic MS/MS mode, mass range 50–1700 m/z). A volume of 2–5 μL per injection is recommended. To avoid potential contamination of the ion source by large amounts of unreacted l-FDLA, the liquid chromatography stream was injected into the mass spectrometry starting at 7.0 min as l-FDLA eluted around 6.5 min. Any remaining LC eluent was then directed into the waste without further MS analysis.

Results and Discussion

Advanced Marfey’s Analysis of Lanthionine

To validate the effectiveness of FDLA and optimize the method, we initially selected two representative and easily accessible lanthipeptides, nisin and cytolysin L. Nisin is a commercially available antibacterial peptide derived from L. lactis and is commonly used as a food preservative (Figure 2A).50−52 It contains one dl-Lan and three dl-MeLan.6,11 We obtained a commercial nisin extract from L. lactis and purified it using HPLC. After acidic hydrolysis, the results of FDLA derivatization showed the expected product peaks by EIC that were observed in significantly higher intensity (approximately 5–10-fold) compared to the FDAA treatment of the same sample (Figure 2A).

Figure 2.

Figure 2

Open in a new tab

(A) Nisin structure and comparison of extracted ion chromatograms after derivatization of hydrolyzed nisin with either l-FDLA or l-FDAA. The masses monitored were dl-Lan (l-DAA)2 at [M – H]−m/z = 711.1434 Da, dl-MeLan (l-DAA)2 at [M – H]−m/z = 725.1591 Da, dl-Lan (l-DLA)2 at [M – H]−m/z = 795.2373 Da, and dl-MeLan-(l-DLA)2 at [M – H]−m/z = 809.2530 Da. (B) Structures of Lan-(l-DAA)2, MeLan-(l-DAA)2, Lan-(l-DLA)2, and MeLan-(l-DLA)2.

Next, we chose the lanthipeptide cytolysin L (CylLL″),53 a compound that can be produced in E. coli,9 and for which we deposited the plasmid at Addgene (ID #208759). Modified cytolysin L precursor peptide (mCylLL) comprises a three (Me)Lan system including one dl-Lan, one ll-Lan, and one ll-MeLan (Figure 3A).9 Production of mCylLL in E. coli as a His-tagged peptide, purification using nickel affinity chromatography, and acid hydrolysis provided a mixture of amino acids. l-FDAA derivatization did not lead to full separation of the two peaks of dl- and ll-Lan, while l-FDLA successfully produced two well-separated peaks of dl- and ll-Lan-FDLA adducts with an evenly distributed peak area (Figure 3B). This observation indicates the advantages of l-FDLA over standard Marfey’s analysis and gives the possibility for quantitative analysis of (methyl)lanthionine. Using nisin’s single dl-Lan as a standard, we elucidated the order of elution of the two diastereomers of derivatized dl- and ll-Lan (Figure 3B).

Figure 3.

Figure 3

Open in a new tab

l-FDAA and l-FDLA derivatization of hydrolyzed mCylLL. (A) Structure of CylLL. (B) LC-MS analysis of FDAA and FDLA-derivatized mCylLL using a Kinetex F5 Core–Shell HPLC column. EIC monitoring of the following species: dl-Lan (l-DAA)2 at [M – H]−m/z = 711.1434 Da, dl-MeLan (l-DAA)2 at [M – H]−m/z = 725.1591 Da, dl-Lan (l-DLA)2 at [M – H]−m/z = 795.2373 Da, and dl-MeLan (l-DLA)2 at [M – H]−m/z = 809.2530 Da. Leader peptide with a 6xHis-tag sequence: MGSSHHHHHH-SQDPNSENLSVVPSFEELSVEEMEAIQGSGDVQAE.

Unlike most amino acids, Lan and MeLan have multiple chiral centers and therefore have a higher chance of kinetic resolution during derivatization. Derivatization with l-FDLA did not result in such resolution. The choice of MeCN/H2O and NaHCO3 as a base in the derivatization solution proved critical to obtaining the optimal intensity of the derivatized Lan/MeLan. Other derivatization conditions commonly used (e.g., acetone-triethylamine) resulted in lower peak intensities. To reduce the occurrence of the [M + Na]+ form, which would require integration over multiple EICs, negative mode ionization was chosen, which also resulted in the intensity of the relevant ions being consistently about 5–10 times higher compared to the analysis of [M + H]+/[M + Na]+ in the same sample.

Advanced Marfey’s Analysis of Methyllanthionine

Next, we analyzed the three previously established natural diastereomers of MeLan: dl-, ll-, and d-allo-l-MeLan. As the MeLan standard, we selected mCoiA1, a modified precursor peptide that contains all three known MeLan diastereomers (Figure 4A).18 Once again, the standard was prepared by expression of the His-tagged peptide in E. coli using plasmids deposited at Addgene (ID #208761 and #208762). The mCoiA1 was purified by nickel affinity chromatography, and the peptide was hydrolyzed in acid. After derivatization with l-FDLA, LC mass spectrometry analysis showed three separate peaks (Figure 4B). To assign the stereochemistry of each peak, we introduced two site-directed mutations, mCoiA1-T43S (to remove ll-MeLan) and mCoiA1-T50S (to remove dl-MeLan).10 After applying identical treatment and analysis, the two mutations eliminated one of the three peaks each, thus assigning the stereochemistry of the corresponding MeLan and establishing the elution order of the three derivatized diastereomers. Therefore, the full-length mCoiA1 peptide proved to be an effective standard for characterizing all three methyllanthionine isomers (Figure 4).

Figure 4.

Figure 4

Open in a new tab

l-FDLA derivatization of hydrolyzed mCoiA1 and its variants. (A) Structure of mCoiA1. (B) LC-MS analysis using a Kinetex F5 Core–Shell HPLC column, EIC monitoring of MeLan (l-DLA)2 at [M – H]−m/z = 809.2530 Da. For derivatization with d-FDLA, see Figure S3. Leader peptide derived sequence: GMNANTIKGQAHSPAATAGGDAFDLDISVLE.

Optimization and Determination of the Detection Limit

Hydrolysis of peptides in acid at 120 °C for 20 h is usually the standard condition for Marfey’s analysis, but a previous study showed that increasing the hydrolysis temperature to 150 °C for 3 h improved efficiency without leading to breakdown or oxidation of specific residues such as Trp and Cys.54 Therefore, we tested these hydrolysis conditions with 0.05 mg of nisin, mCylLL, and mCoiA1 and obtained similar results to those observed after hydrolysis at 120 °C for 20 h (Figure S1), thus significantly decreasing the time required for the analysis.

We next focused on determining the detection limit of the advanced Marfey method for determining the Lan and MeLan stereochemistry. We used the modified precursor peptide of cytolysin S (mCylLs) as a model sample. This well-characterized 8 kDa, 78 amino acid sequence contains two rings, one ll-MeLan and one dl-Lan, and serves as a representative structure of a lanthipeptide genome mining exercise in that its leader peptide is still attached to the modified core peptide after expression in E. coli.55 Experimentally, we analyzed the limit of detection of mCylLs by serial dilution starting from 0.2 mg. The results suggested that 0.026 mg of the sample was sufficient to produce distinct LC-MS peaks with minimal background noise (Figure S2). This sensitivity is a major improvement over the amount of material required by using the GC-MS method. We also evaluated commercially available d-FDLA as a derivatization agent instead of l-FDLA. The separation of the diastereomers formed upon the reaction of d-FDLA with LL and dl-Lan was better than with l-FDLA, but the diastereomers formed upon the reaction of d-FDLA with ll-, dl-, and allo-dl-MeLan provided a mixture in which two of the isomers coeluted (Figure S3). Hence, l-FDLA is the reagent of choice for the analysis of lanthipeptides of unknown stereochemistry.

To enhance the general applicability of our approach, we also conducted hydrolysis of the mCylLL and mCoiA1 standards using a commonly used dry/bath block heater. LC-MS results showed no significant differences when comparing samples heated using a hot plate stirrer and those using the dry bath heater (Figure S4).

Application of the Method to a New Lanthipeptide

A previously established system known as FAST-RiPPs (Fast, Automated, Scalable, high-Throughput pipeline for RiPPs discovery) combines RODEO,56 a tool for mining genomes to identify specific RiPP biosynthetic gene clusters (BGCs) of interest, with an automated pathway refactoring platform57 and employs E. coli for heterologous RiPP expression.30 FAST-RiPPs was successful in producing a large number of novel lanthipeptides, but the stereochemistry was determined for only a subset of them because of the aforementioned need of 1–2 mg of purified final product, which could not always be obtained. In this study, we chose one such compound for which the stereochemistry is not known, LanII-21. This compound is the product of the buv BGC identified in the genome of Butyrivibrio sp. VCD2006, butyrate-producing bacteria inhabiting the rumens of ruminant animals. The buv BGC encodes multiple proteins, including an rSAM BuvX (WP_026528692.1), a class II lanthipeptide synthetase BuvM (WP_081674439.1), a cyclase BuvC (WP_081674440.1), and a precursor peptide BuvA (WP_026528694.1). These genes were incorporated into a pET28a plasmid backbone for heterologous expression and post-translational modification in E. coli (Figure 5A). After purification, 0.05 mg of mBuvA was hydrolyzed at 150 °C for 3 h, followed by derivatization with l-FDLA and LC-MS analysis. The result shows a single dl-Lan peak compared to the Lan-standard obtained from mCylLL, as confirmed by coelution upon coinjection with the standard (Figure 5B). No significant MeLan (l-DLA)2 peak was obtained. This observation suggests that mBuvA forms a 5-membered dl-Lan ring at the C-terminus since that is the only location to form a Lan. To further confirm this structure, we digested mBuvA with AspN and performed tandem ESI-MS analysis, which resulted in no fragments being observed within the proposed lanthionine ring (Figure 5C), consistent with our assignment.

Figure 5.

Figure 5

Open in a new tab

(A) buv BGC. The producing organism, gene diagram, and precursor peptide sequence with the predicted structure based on the result of stereochemical and LC-MS/MS analysis are listed. Leader peptide with a 6× His-tag sequence: MHHHHHHAMTIKDFYDKAAGDDAMKKKIAEMTKAGKSLEDFIAEFGIEGTVDDLKAYAETLSQEGKLDKSQL. (B) l-FDLA derivatization of hydrolyzed mBuvA using the standard treatment procedure used herein. (C) Tandem ESI-MS of mBuvA after proteolysis with AspN (resulting in the modified peptide shown in bold font in panel (A)). For theoretical and observed m/z, see Table S1.

Conclusions

In this study, we used l-FDLA as a derivatization reagent for establishing the stereochemistry of the bis-amino acids lanthionine and methyllanthionine. We used two sets of plasmids that we deposited in a publicly accessible plasmid collection to make two samples that contain Lan and MeLan with all five previously reported configurations. Using these standards, we report the elution order of all isomers bis-derivatized with l-FDLA and d-FDLA using LC-MS. We show that as little as 0.05 mg of a lanthipeptide with its leader peptide still attached is sufficient for determining the stereochemistry of its Lan and MeLan, which is a considerable improvement over the GC-MS method that we and others have used. This approach is advantageous for cases in which limited material is available and for laboratories that have molecular biology expertise but not synthetic chemistry capabilities. As such, this work provides a method that is complementary to GC-MS with synthetic standards.

Acknowledgments

This study was supported by a grant from the National Institutes of Health (Grant R01 AI144967 to W.A.v.d.D.) and the Howard Hughes Medical Institute. This study is subject to the Open Access to Publications policy of the Howard Hughes Medical Institute (HHMI). HHMI laboratory heads have previously granted a nonexclusive CC BY 4.0 license to the public and a sublicensable license to HHMI in their research articles. Pursuant to those licenses, the author-accepted manuscript of this article can be made freely available under a CC BY 4.0 license immediately upon publication.

Supporting Information Available

The Supporting Information is available free of charge at https://pubs.acs.org/doi/10.1021/acs.analchem.3c04958.

  • Experimental details of the method; Figures S1–S4 showing hydrolysis at different temperatures, limit of detection, d-FDLA derivatization, and hydrolysis using a dry/bath block heater; and Table S1 with tandem MS data (PDF)

Author Contributions

Y.L., S.X., and A.M.F.: experimental data acquisition. Y.L. and W.A.v.d.D.: conceptualization and manuscript writing. All authors have given approval to the final version of the manuscript.

The authors declare no competing financial interest.

Supplementary Material

ac3c04958_si_001.pdf (799.9KB, pdf)

References

  1. Montalbán-López M.; Scott T. A.; Ramesh S.; Rahman I. R.; van Heel A. J.; Viel J. H.; Bandarian V.; Dittmann E.; Genilloud O.; Goto Y.; Grande Burgos M. J.; Hill C.; Kim S.; Koehnke J.; Latham J. A.; Link A. J.; Martínez B.; Nair S. K.; Nicolet Y.; Rebuffat S.; Sahl H.-G.; Sareen D.; Schmidt E. W.; Schmitt L.; Severinov K.; Süssmuth R. D.; Truman A. W.; Wang H.; Weng J.-K.; van Wezel G. P.; Zhang Q.; Zhong J.; Piel J.; Mitchell D. A.; Kuipers O. P.; van der Donk W. A. New developments in RiPP discovery, enzymology and engineering. Nat. Prod. Rep. 2021, 38, 130–239. 10.1039/D0NP00027B. [DOI] [PMC free article] [PubMed] [Google Scholar]
  2. Li Y.; Rebuffat S. The manifold roles of microbial ribosomal peptide-based natural products in physiology and ecology. J. Biol. Chem. 2020, 295, 34–54. 10.1074/jbc.REV119.006545. [DOI] [PMC free article] [PubMed] [Google Scholar]
  3. Cao L.; Do T.; Link A. J. Mechanisms of action of ribosomally synthesized and posttranslationally modified peptides (RiPPs). J. Ind. Microbiol. Biotechnol. 2021, 48, kuab005 10.1093/jimb/kuab005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  4. Ongpipattanakul C.; Desormeaux E. K.; DiCaprio A.; van der Donk W. A.; Mitchell D. A.; Nair S. K. Mechanism of action of ribosomally synthesized and post-translationally modified peptides. Chem. Rev. 2022, 122, 14722–14814. 10.1021/acs.chemrev.2c00210. [DOI] [PMC free article] [PubMed] [Google Scholar]
  5. Repka L. M.; Chekan J. R.; Nair S. K.; van der Donk W. A. Mechanistic understanding of lanthipeptide biosynthetic enzymes. Chem. Rev. 2017, 117, 5457–5520. 10.1021/acs.chemrev.6b00591. [DOI] [PMC free article] [PubMed] [Google Scholar]
  6. Gross E.; Morell J. L. The structure of nisin. J. Am. Chem. Soc. 1971, 93, 4634–4635. 10.1021/ja00747a073. [DOI] [PubMed] [Google Scholar]
  7. Chatterjee C.; Paul M.; Xie L.; van der Donk W. A. Biosynthesis and mode of action of lantibiotics. Chem. Rev. 2005, 105, 633–684. 10.1021/cr030105v. [DOI] [PubMed] [Google Scholar]
  8. Liu W.; Chan A. S. H.; Liu H.; Cochrane S. A.; Vederas J. C. Solid supported chemical syntheses of both components of the lantibiotic lacticin 3147. J. Am. Chem. Soc. 2011, 133, 14216–14219. 10.1021/ja206017p. [DOI] [PubMed] [Google Scholar]
  9. Tang W.; van der Donk W. A. The sequence of the enterococcal cytolysin imparts unusual lanthionine stereochemistry. Nat. Chem. Biol. 2013, 9, 157–159. 10.1038/nchembio.1162. [DOI] [PMC free article] [PubMed] [Google Scholar]
  10. Sarksian R.; Hegemann J. D.; Simon M. A.; Acedo J. Z.; van der Donk W. A. Unexpected methyllanthionine stereochemistry in the morphogenetic lanthipeptide SapT. J. Am. Chem. Soc. 2022, 144, 6373–6382. 10.1021/jacs.2c00517. [DOI] [PMC free article] [PubMed] [Google Scholar]
  11. Küsters E.; Allgaier H.; Jung G.; Bayer E. Resolution of sulphur-containing amino acids by chiral phase gas chromatography. Chromatographia 1984, 18, 287–293. 10.1007/BF02259079. [DOI] [Google Scholar]
  12. Mohr K. I.; Volz C.; Jansen R.; Wray V.; Hoffmann J.; Bernecker S.; Wink J.; Gerth K.; Stadler M.; Müller R. Pinensins: the first antifungal lantibiotics. Angew. Chem., Int. Ed. 2015, 54, 11254–11258. 10.1002/anie.201500927. [DOI] [PubMed] [Google Scholar]
  13. Knerr P. J.; van der Donk W. A. Chemical synthesis of the lantibiotic lacticin 481 reveals the importance of lanthionine stereochemistry. J. Am. Chem. Soc. 2013, 135, 7094–7097. 10.1021/ja4014024. [DOI] [PMC free article] [PubMed] [Google Scholar]
  14. Lohans C. T.; Li J. L.; Vederas J. C. Structure and biosynthesis of carnolysin, a homologue of enterococcal cytolysin with D-amino acids. J. Am. Chem. Soc. 2014, 136, 13150–13153. 10.1021/ja5070813. [DOI] [PubMed] [Google Scholar]
  15. Tang W.; Jiménez-Osés G.; Houk K. N.; van der Donk W. A. Substrate control in stereoselective lanthionine biosynthesis. Nat. Chem. 2015, 7, 57–64. 10.1038/nchem.2113. [DOI] [PMC free article] [PubMed] [Google Scholar]
  16. Acedo J. Z.; Bothwell I. R.; An L.; Trouth A.; Frazier C.; van der Donk W. A. O-methyltransferase-mediated incorporation of a β-amino acid in lanthipeptides. J. Am. Chem. Soc. 2019, 141, 16790–16801. 10.1021/jacs.9b07396. [DOI] [PMC free article] [PubMed] [Google Scholar]
  17. Bothwell I. R.; Caetano T.; Sarksian R.; Mendo S.; van der Donk W. A. Structural analysis of class I lanthipeptides from Pedobacter lusitanus NL19 reveals an unusual ring pattern. ACS Chem. Biol. 2021, 16, 1019–1029. 10.1021/acschembio.1c00106. [DOI] [PMC free article] [PubMed] [Google Scholar]
  18. Sarksian R.; van der Donk W. A. Divergent evolution of lanthipeptide stereochemistry. ACS Chem. Biol. 2022, 17, 2551–2558. 10.1021/acschembio.2c00492. [DOI] [PMC free article] [PubMed] [Google Scholar]
  19. Velásquez J. E.; van der Donk W. A. Genome mining for ribosomally synthesized natural products. Curr. Opin. Chem. Biol. 2011, 15, 11–21. 10.1016/j.cbpa.2010.10.027. [DOI] [PMC free article] [PubMed] [Google Scholar]
  20. van Heel A. J.; Kloosterman T. G.; Montalbán-López M.; Deng J.; Plat A.; Baudu B.; Hendriks D.; Moll G. N.; Kuipers O. P. Discovery, production and modification of five novel lantibiotics using the promiscuous nisin modification machinery. ACS Synth. Biol. 2016, 5, 1146–1154. 10.1021/acssynbio.6b00033. [DOI] [PubMed] [Google Scholar]
  21. Hetrick K. J.; van der Donk W. A. Ribosomally synthesized and post-translationally modified peptide natural product discovery in the genomic era. Curr. Opin. Chem. Biol. 2017, 38, 36–44. 10.1016/j.cbpa.2017.02.005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  22. Kloosterman A. M.; Cimermancic P.; Elsayed S. S.; Du C.; Hadjithomas M.; Donia M. S.; Fischbach M. A.; van Wezel G. P.; Medema M. H. Expansion of RiPP biosynthetic space through integration of pan-genomics and machine learning uncovers a novel class of lanthipeptides. PLoS Biol. 2020, 18, e3001026 10.1371/journal.pbio.3001026. [DOI] [PMC free article] [PubMed] [Google Scholar]
  23. Zhong Z.; He B.; Li J.; Li Y. X. Challenges and advances in genome mining of ribosomally synthesized and post-translationally modified peptides (RiPPs). Synth. Syst. Biotechnol. 2020, 5, 155–172. 10.1016/j.synbio.2020.06.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  24. Hegemann J. D.; Süssmuth R. D. Matters of class: coming of age of class III and IV lanthipeptides. RSC Chem. Biol. 2020, 1, 110–127. 10.1039/D0CB00073F. [DOI] [PMC free article] [PubMed] [Google Scholar]
  25. Singh M.; Chaudhary S.; Sareen D. Roseocin, a novel two-component lantibiotic from an actinomycete. Mol. Microbiol. 2020, 113, 326–337. 10.1111/mmi.14419. [DOI] [PubMed] [Google Scholar]
  26. Bösch N. M.; Borsa M.; Greczmiel U.; Morinaka B. I.; Gugger M.; Oxenius A.; Vagstad A. L.; Piel J. Landornamides: Antiviral ornithine-containing ribosomal peptides discovered through genome mining. Angew. Chem., Int. Ed. 2020, 59, 11763–11768. 10.1002/anie.201916321. [DOI] [PubMed] [Google Scholar]
  27. Walker M. C.; Eslami S. M.; Hetrick K. J.; Ackenhusen S. E.; Mitchell D. A.; van der Donk W. A. Precursor peptide-targeted mining of more than one hundred thousand genomes expands the lanthipeptide natural product family. BMC Genomics 2020, 21, 387. 10.1186/s12864-020-06785-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  28. Grigoreva A.; Andreeva J.; Bikmetov D.; Rusanova A.; Serebryakova M.; Garcia A. H.; Slonova D.; Nair S. K.; Lippens G.; Severinov K.; Dubiley S. Identification and characterization of andalusicin: N-terminally dimethylated class III lantibiotic from Bacillus thuringiensis sv. andalousiensis. iScience 2021, 24, 102480 10.1016/j.isci.2021.102480. [DOI] [PMC free article] [PubMed] [Google Scholar]
  29. Kloosterman A. M.; Medema M. H.; van Wezel G. P. Omics-based strategies to discover novel classes of RiPP natural products. Curr. Opin. Biotechnol. 2021, 69, 60–67. 10.1016/j.copbio.2020.12.008. [DOI] [PubMed] [Google Scholar]
  30. Ayikpoe R. S.; Shi C.; Battiste A. J.; Eslami S. M.; Ramesh S.; Simon M. A.; Bothwell I. R.; Lee H.; Rice A. J.; Ren H.; Tian Q.; Harris L. A.; Sarksian R.; Zhu L.; Frerk A. M.; Precord T. W.; van der Donk W. A.; Mitchell D. A.; Zhao H. A scalable platform to discover antimicrobials of ribosomal origin. Nat. Commun. 2022, 13, 6135 10.1038/s41467-022-33890-w. [DOI] [PMC free article] [PubMed] [Google Scholar]
  31. Vermeulen R.; Van Staden A. D. P.; van Zyl L. J.; Dicks L. M. T.; Trindade M. Unusual class I lanthipeptides from the marine bacteria Thalassomonas viridans. ACS Synth. Biol. 2022, 11, 3608–3616. 10.1021/acssynbio.2c00480. [DOI] [PMC free article] [PubMed] [Google Scholar]
  32. Zhang S. S.; Xiong J.; Cui J. J.; Ma K. L.; Wu W. L.; Li Y.; Luo S.; Gao K.; Dong S. H. Lanthipeptides from the same core sequence: characterization of a class II lanthipeptide synthetase from Microcystis aeruginosa NIES-88. Org. Lett. 2022, 24, 2226–2231. 10.1021/acs.orglett.2c00573. [DOI] [PubMed] [Google Scholar]
  33. Pei Z.-F.; Zhu L.; Sarksian R.; van der Donk W. A.; Nair S. K. Class V lanthipeptide cyclase directs the biosynthesis of a stapled peptide natural product. J. Am. Chem. Soc. 2022, 144, 17549–17557. 10.1021/jacs.2c06808. [DOI] [PMC free article] [PubMed] [Google Scholar]
  34. Xue D.; Older E. A.; Zhong Z.; Shang Z.; Chen N.; Dittenhauser N.; Hou L.; Cai P.; Walla M. D.; Dong S. H.; Tang X.; Chen H.; Nagarkatti P.; Nagarkatti M.; Li Y. X.; Li J. Correlational networking guides the discovery of unclustered lanthipeptide protease-encoding genes. Nat. Commun. 2022, 13, 1647 10.1038/s41467-022-29325-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
  35. Han Y.; Wang X.; Zhang Y.; Huo L. Discovery and characterization of marinsedin, a new class II lanthipeptide derived from marine bacterium Marinicella sediminis F2(T). ACS Chem. Biol. 2022, 17, 785–790. 10.1021/acschembio.2c00021. [DOI] [PubMed] [Google Scholar]
  36. Rosenbergová Z.; Oftedal T. F.; Ovchinnikov K. V.; Thiyagarajah T.; Rebroš M.; Diep D. B. Identification of a novel two-peptide lantibiotic from Vagococcus fluvialis. Microbiol. Spectr. 2022, 10, e00954-22 10.1128/spectrum.00954-22. [DOI] [PMC free article] [PubMed] [Google Scholar]
  37. Chaudhary S.; Kishen S.; Singh M.; Jassal S.; Pathania R.; Bisht K.; Sareen D. Phylogeny-guided genome mining of roseocin family lantibiotics to generate improved variants of roseocin. AMB Express 2023, 13, 34. 10.1186/s13568-023-01536-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
  38. Xue D.; Shang Z.; Older E. A.; Zhong Z.; Pulliam C.; Peter K.; Nagarkatti M.; Nagarkatti P.; Li Y. X.; Li J. Refactoring and heterologous expression of class III lanthipeptide biosynthetic gene clusters lead to the discovery of N,N-dimethylated lantibiotics from Firmicutes. ACS Chem. Biol. 2023, 18, 508–517. 10.1021/acschembio.2c00849. [DOI] [PMC free article] [PubMed] [Google Scholar]
  39. Fernandez-Cantos M. V.; Garcia-Morena D.; Yi Y.; Liang L.; Gómez-Vázquez E.; Kuipers O. P. Bioinformatic mining for RiPP biosynthetic gene clusters in Bacteroidales reveals possible new subfamily architectures and novel natural products. Front. Microbiol. 2023, 14, 1219272 10.3389/fmicb.2023.1219272. [DOI] [PMC free article] [PubMed] [Google Scholar]
  40. Liang H.; Song Z. M.; Zhong Z.; Zhang D.; Yang W.; Zhou L.; Older E. A.; Li J.; Wang H.; Zeng Z.; Li Y. X. Genomic and metabolic analyses reveal antagonistic lanthipeptides in archaea. Microbiome 2023, 11, 74. 10.1186/s40168-023-01521-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
  41. Wang X.; Chen X.; Wang Z. J.; Zhuang M.; Zhong L.; Fu C.; Garcia R.; Müller R.; Zhang Y.; Yan J.; Wu D.; Huo L. Discovery and characterization of a myxobacterial lanthipeptide with unique biosynthetic features and anti-inflammatory activity. J. Am. Chem. Soc. 2023, 145, 16924–16937. 10.1021/jacs.3c06014. [DOI] [PubMed] [Google Scholar]
  42. Saito K.; Mukai K.; Kaweewan I.; Nakagawa H.; Hosaka T.; Kodani S. Heterologous production and structure determination of a new lanthipeptide sinosporapeptin using a cryptic gene cluster in an actinobacterium Sinosporangium siamense. J. Microbiol. 2023, 61, 641–648. 10.1007/s12275-023-00059-z. [DOI] [PubMed] [Google Scholar]
  43. Li L.; Zhang J.; Zhou L.; Shi H.; Mai H.; Su J.; Ma X.; Zhong J. The first lanthipeptide from Lactobacillus iners, inecin L, exerts high antimicrobial activity against human vaginal pathogens. Appl. Environ. Microbiol. 2023, 89, e02123-22 10.1128/aem.02123-22. [DOI] [PMC free article] [PubMed] [Google Scholar]
  44. Fernández-Fernández R.; Elsherbini A. M. A.; Lozano C.; Martínez A.; de Toro M.; Zarazaga M.; Peschel A.; Krismer B.; Torres C. Genomic analysis of bacteriocin-producing staphylococci: High prevalence of lanthipeptides and the micrococcin P1 biosynthetic gene clusters. Probiotics Antimicrob. Proteins 2023, 62, 106965. 10.1007/s12602-023-10119-w. [DOI] [PMC free article] [PubMed] [Google Scholar]
  45. He Y.; Fan A.; Han M.; Li H.; Li M.; Fan H.; An X.; Song L.; Zhu S.; Tong Y. Mammalian commensal streptococci utilize a rare family of class VI lanthipeptide synthetases to synthesize miniature lanthipeptide-type ribosomal peptide natural products. Biochemistry 2023, 62, 462–475. 10.1021/acs.biochem.2c00534. [DOI] [PubMed] [Google Scholar]
  46. King A. M.; Zhang Z.; Glassey E.; Siuti P.; Clardy J.; Voigt C. A. Systematic mining of the human microbiome identifies antimicrobial peptides with diverse activity spectra. Nat. Microbiol. 2023, 8, 2420–2434. 10.1038/s41564-023-01524-6. [DOI] [PubMed] [Google Scholar]
  47. Marfey P. Determination of D-amino acids. II. Use of a bifunctional reagent, 1,5-difluoro-2,4-dinitrobenzene. Carlsberg Res. Commun. 1984, 49, 591–596. 10.1007/BF02908688. [DOI] [Google Scholar]
  48. Ayon N. J.; Sharma A. D.; Gutheil W. G. LC-MS/MS-based separation and quantification of Marfey’s reagent derivatized proteinogenic amino acid DL-stereoisomers. J. Am. Soc. Mass Spectrom. 2019, 30, 448–458. 10.1007/s13361-018-2093-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
  49. Harada K.-i.; Fujii K.; Hayashi K.; Suzuki M.; Ikai Y.; Oka H. Application of d,l-FDLA derivatization to determination of absolute configuration of constituent amino acids in peptide by advanced Marfey’s method. Tetrahedron Lett. 1996, 37, 3001–3004. 10.1016/0040-4039(96)00484-4. [DOI] [Google Scholar]
  50. Delves-Broughton J.; Blackburn P.; Evans R. J.; Hugenholtz J. Applications of the bacteriocin, nisin. Antonie van Leeuwenhoek 1996, 69, 193–202. 10.1007/BF00399424. [DOI] [PubMed] [Google Scholar]
  51. Lubelski J.; Rink R.; Khusainov R.; Moll G. N.; Kuipers O. P. Biosynthesis, immunity, regulation, mode of action and engineering of the model lantibiotic nisin. Cell. Mol. Life Sci. 2008, 65, 455–476. 10.1007/s00018-007-7171-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
  52. Gharsallaoui A.; Oulahal N.; Joly C.; Degraeve P. Nisin as a food preservative: Part 1: physicochemical properties, antimicrobial activity, and main uses. Crit. Rev. Food Sci. Nutr. 2016, 56, 1262–1274. 10.1080/10408398.2013.763765. [DOI] [PubMed] [Google Scholar]
  53. Coburn P. S.; Pillar C. M.; Jett B. D.; Haas W.; Gilmore M. S. Enterococcus faecalis senses target cells and in response expresses cytolysin. Science 2004, 306, 2270–2272. 10.1126/science.1103996. [DOI] [PubMed] [Google Scholar]
  54. Goodlett D. R.; Abuaf P. A.; Savage P. A.; Kowalski K. A.; Mukherjee T. K.; Tolan J. W.; Corkum N.; Goldstein G.; Crowther J. B. Peptide chiral purity determination: hydrolysis in deuterated acid, derivatization with Marfey’s reagent and analysis using high-performance liquid chromatography-electrospray ionization-mass spectrometry. J. Chromatogr. A 1995, 707, 233–244. 10.1016/0021-9673(95)00352-N. [DOI] [PubMed] [Google Scholar]
  55. Shi Y.; Yang X.; Garg N.; van der Donk W. A. Production of lantipeptides in Escherichia coli. J. Am. Chem. Soc. 2011, 133, 2338–2341. 10.1021/ja109044r. [DOI] [PMC free article] [PubMed] [Google Scholar]
  56. Tietz J. I.; Schwalen C. J.; Patel P. S.; Maxson T.; Blair P. M.; Tai H. C.; Zakai U. I.; Mitchell D. A. A new genome-mining tool redefines the lasso peptide biosynthetic landscape. Nat. Chem. Biol. 2017, 13, 470–478. 10.1038/nchembio.2319. [DOI] [PMC free article] [PubMed] [Google Scholar]
  57. HamediRad M.; Chao R.; Weisberg S.; Lian J.; Sinha S.; Zhao H. Towards a fully automated algorithm driven platform for biosystems design. Nat. Commun. 2019, 10, 5150 10.1038/s41467-019-13189-z. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

ac3c04958_si_001.pdf (799.9KB, pdf)

Articles from Analytical Chemistry are provided here courtesy of American Chemical Society

RESOURCES