Skip to main content
International Journal of Molecular Sciences logoLink to International Journal of Molecular Sciences
. 2024 Feb 7;25(4):2027. doi: 10.3390/ijms25042027

Are TaNAC Transcription Factors Involved in Promoting Wheat Yield by cis-Regulation of TaCKX Gene Family?

Adnan Iqbal 1,*, Joanna Bocian 1, Mateusz Przyborowski 1, Wacław Orczyk 1, Anna Nadolska-Orczyk 1,*
Editor: Tomotsugu Koyama1
PMCID: PMC10889182  PMID: 38396706

Abstract

NAC transcription factors (TFs) are one of the largest TF families in plants, and TaNACs have been known to participate in the regulation of the transcription of many yield-regulating genes in bread wheat. The TaCKX gene family members (GFMs) have already been shown to regulate yield-related traits, including grain mass and number, leaf senescence, and root growth. The genes encode cytokinin (CK) degrading enzymes (CKXs) and are specifically expressed in different parts of developing wheat plants. The aim of the study was to identify and characterize TaNACs involved in the cis-regulation of TaCKX GFMs. After analysis of the initial transcription factor data in 1.5 Kb cis-regulatory sequences of a total of 35 homologues of TaCKX GFMs, we selected five of them, namely TaCKX1-3A, TaCKX22.1-3B, TaCKX5-3D, TaCKX9-1B, and TaCKX10, and identified five TaNAC genes: TaNACJ-1, TaNAC13a, TaNAC94, TaNACBr-1, and TaNAC6D, which are potentially involved in the cis-regulation of selected TaCKX genes, respectively. Protein feature analysis revealed that all of the selected TaNACs have a conserved NAC domain and showed a stable tertiary structure model. The expression profile of the selected TaNACs was studied in 5 day-old seedling roots, 5–6 cm inflorescences, 0, 4, 7, and 14 days-after-pollination (DAP) spikes, and the accompanying flag leaves. The expression pattern showed that all of the selected TaNACs were preferentially expressed in seedling roots, 7 and 14 DAP spikes, and flag leaves compared to 5–6 cm inflorescence and 0 and 4 DAP spikes and flag leaves in Kontesa and Ostka spring wheat cultivars (cvs.). In conclusion, the results of this study highlight the potential role of the selected TaNACs in the regulation of grain productivity, leaf senescence, root growth, and response to various stresses.

Keywords: TaNACs, TaCKX GFMs, bread wheat, yield-related traits, cis-regulation, transcription factors

1. Introduction

Bread wheat (Triticum aestivum L.) is the third most important cereal crop grown around the world after maize and rice. It has a complex allohexaploid (AABBDD) genome, which contains three: A, B, and D diploid subgenomes [1,2,3]. The complexity of the bread wheat genome is challenging in molecular and genetic research and breeding; however, on the other hand, it is a large reservoir of homoeologous genes, which can be targeted for breeding [4]. As the world’s population grows, the demand for high yielding wheat cultivars (cvs.) is increasing [5]. However, climate change, biotic, and abiotic stresses pose a parallel challenge to the productivity of wheat crop [6,7]. Therefore, functional characterization of yield-related genes could be a way to address this challenge.

Cytokinins (CKs) belong to the group of plant hormones that have direct implications on plant growth and development [8,9]. They have also been known to respond to biotic and abiotic stresses, including maintaining mineral nutrition and leaf senescence [10,11,12]. The primary role of cytokinins is to promote cell division and that of auxins is to promote cell expansion, while the balance between the concentrations of cytokinins and auxins controls the growth of the root and shoot [13] A reduced concentration of cytokinins promotes tillering, while inhibited by auxins [14,15]. In a recent review cytokinin was indicated as a key factor of seed yield [8]. The phytohormone is produced locally in the roots and aerial parts of the plants or is transported from the roots to the shoots [16,17]. The cytokinin content in the wheat spikes directly contributes to grain yield and thousand-grain weight (TGW), as well as the chlorophyll content in flag leaves and the seedling root weight [15,18,19,20,21].

CKX gene family members (GFMs) encode an enzyme named oxidase/dehydrogenase that irreversibly degrades cytokinin and hence regulates the content and functions of cytokinin in various parts of the plant [14]. According to the most recent numbering, there are 13 basic numbers of TaCKX GFMs in allohexaploid bread wheat. Eleven of them have homoeologous genes in the three subgenomes (A, B, D) and two are located exclusively in subgenome D. Therefore, the final number of all homoeologous genes is 35 [14]. The results of the study conducted by Ogonowska et al. (2019) [22] showed that the expression of TaCKX GFMs is developmentally and organ-specific. For example, considering the new numbering of TaCKX GFMs, the expression of TaCKX7, 8, and 10 (previously 9) was highly specific to seedling roots; expression of TaCKX4, 5, and 9 (previously 11) was specific to leaves. However, expression of TaCKX1, TaCKX2 genes was specific to inflorescences and spikes, and finally TaCKX3 (previously 6), 8 (previously 11), and 11 (previously 3), were expressed at various levels in all of the organs tested. The results of several studies have shown that TaCKX GFMs influence the tiller number, weight of seedling roots, grain size, thousand-grain weight (TGW), spike phenotype, and phytohormonal homeostasis in bread wheat [18,19,20,21,23,24]. Expression of a single TaCKX is co-regulated by the other TaCKX GFMs or genes encoding TFs; for example, RNA interference-based silencing (RNAi) of TaCKX1 downregulated the expression of TaCKX2 genes and upregulated the expression of TaCKX5 and TaNAC2-5A [18]. Similarly, RNAi silencing of TaCKX2 coregulated the expression of TaCKX1 antagonistically by downregulation of TaCKX1, but upregulation of TaCKX5 and TaNAC2-5A [18]. Similarly, strong silencing of TaCKX2.2.2 slightly reduced the expression of TaCKX2.2.1 and greatly decreased the expression of TaCKX5, and TaCKX11; however, the expression of TaCKX1, TaCKX2.1, and TaCKX9 remained unchanged [20]. The coregulation of TaCKX GFMs and the expression pattern also influenced phytohormonal homeostasis and yield-related traits in wheat crops, such as grain size, thousand-grain weight (TGW), and chlorophyll content in flag leaves [18,19,20]. The role of TaCKX GFMs in yield-related traits is well documented; however, the transcription regulation of this gene family by transcription factors is still largely unknown. Recently, it has been reported that TaCKX GFMs have been found to coregulate the expression of gene encoding transcription factor containing the NAC domain [25]. The RNAi silencing of TaCKX2 genes upregulated the expression of a TaNAC2-5A [18].

Transcription factors play an important role in gene networking to control plant growth, development, and adaptation to the environment [26]. NAC TFs (NAM, ATAF, and CUC) are among the largest TF families which are known to regulate genes by interacting with DNA binding sites in promoter sequences or upstream sequences to the promoter sequences, called cis-regulatory sequences. There are 263 TaNAC TFs in bread wheat and these TFs have been known to control biotic and abiotic stresses along with senescence, morphogenesis, and phytohormonal homeostasis by cis-regulation of various genes, as reviewed by Iqbal et al. (2022) [25].

Seed storage proteins (SSPs) are important for the elasticity of wheat flour. TaNAC77 TF binds to the promoter sites of the SSP encoding genes and regulates gene transcription. Additionally, silencing of the TaNAC77 reduced 24% of the expression of SSP encoding gene [23]. Similarly, TaSPR is a novel NAC domain transcription factor from common wheat (Triticum aestivum). Overexpression of TuSPR reduced the total content of SSPs up to 15.97% in Triticum urartu and knock-down of TaSPR increased the SSP content up to 20.34% [27]. TaNAC100 also interacts with the cis-element of TaGBSS1 and TaSUS2 and regulates the synthesis of seed proteins and starch. Overexpression of TaNAC100 significantly reduced the total seed proteins including SSPs [28]. Leaf senescence is another important yield and crop productivity-related trait, which affects the gain-filling trait of the crop. The NAC domain containing NAM-1 alleles is involved in delayed leaf senescence that causes an extended grain filling time [29]. Rice OsNAC2 TF modulates root development by cis-regulation of two auxin-regulating genes (GH3.6 and GH3.8) and one cytokinin-related gene (OsCKX4), and knock-down of OsNAC2 significantly improved root hairs and length [30]. TaNAC2-5A has been reported to be a nitrate-inducible transcription factor, and overexpression of TaNAC2-5A positively influenced root growth, higher concentration of nitrogen in grains, and overall grain yield [31]. Furthermore, TaNAC2-5A has been reported to interact with the TaNRT2.5-3B promoter region and help establish seed vigor [32].

Taking into account the significant role of TaCKX GFMs in controlling yield-related traits in wheat and the possible role of TaNAC genes in the regulation of these genes, we performed research on the identification and characterization of these TaNACs that interact with selected TaCKX GFMs. The research was conducted on two wheat cultivars (cvs.), Kontesa and Ostka. The results of this study suggest that selected TaNACs could be candidate genes for the regulation of plant growth and development, yield-related traits, and stress management.

2. Results

2.1. Identification of TaNAC Transcription Factor Binding Sites in TaCKX GFMs cis-Regulatory Sequences

We retrieved 1.5 kb upstream cis-regulatory sequences of 35 TaCKX GFMs, listed in Table S3, from the wheat ensemble database (wheat EnsemblPlants v2.1). The sequences were analyzed to identify TF binding sites from the PlantTFDB v5.0 plant transcription factor database.

After running TF data, the results of all transcription factor binding sites on our given cis-regulatory sequences of TaCKX GFMs were downloaded and compiled as a raw FIMO file (Folder S1). From the raw FIMO files of the plant transcription factors, we identified and sorted TaNAC transcription factors and their cis-regulatory binding sites on TaCKX GFM sequences. The results were summarized in an Excel sheet and, due to space constraints, the results were provided as File S1. Based on the highest score, the lowest p′ and q′ values of TaNAC transcription factors, and our previous experience with TaCKX GFMs for their role in improving wheat yield [18,19,20,21,22,24], we selected five TaCKX GFMs; these being, TaCKX1-3A, TaCKX2.2.1-3B, TaCKX5-3D, TaCKX9-1B, and TaCKX10-7B.

2.2. Sequencing of Selected TaCKX GFM cis-Regulatory Regions from Kontesa and Ostka Cultivars

The PCR fragments of five selected TaCKX GFMs, i.e., TaCKX1-3A, TaCKX22.1-3B, TaCKX5-3D, TaCKX9-1B, and TaCKX10-7B, were amplified as 1500 bp, 1561 bp, 1549 bp, 1401 bp, and 1538 bp, respectively, from the total genomic DNA of the Kontesa and Ostka cultivars (cvs.) (Figure 1A–C). The amplicons were cloned into easy pGEMT vectors and sequenced. The sequences were deposited in the NCBI database under the accession numbers PP078647, PP078649, PP078651, PP078653, PP078655 and PP078648, PP078650, PP078652, PP078654, and PP078656 belonging to the TaCKX1-3A, TaCKX22.1-3B, TaCKX5-3D, TaCKX9-1B, and TaCKX10-7B of the Kontesa and Ostka cvs., respectively. These sequences were further analyzed for conserved motif analysis and TaNAC TF identification.

Figure 1.

Figure 1

PCR amplification analysis of the selected TaCKX GFM cis-regulatory sequences. (A) M: 1 kb plus marker; Lanes 1 and 2: TaCKX1-3A Kontesa and Ostka, respectively; Lane 3: positive control from previously optimized PCR; Lane 4: negative control (H2O); Lanes 5 and 6: TaCKX5-3D Kontesa and Ostka, respectively; Lane 7: positive control from previously optimized PCR; Lanes 8 and 9: TaCKX 2.2.1-3B Kontesa and Ostka, respectively; Lane 10: positive control from previously optimized PCR. (B) M: 100 bp plus marker; Lanes 1 and 2 TaCKX10-7B Kontesa and Ostka, respectively; Lane 3: positive control from previously optimized PCR; Lane 4: negative control (H2O); Lanes 5 and 6: empty. (C) M: 100 bp plus marker; Lanes 1–2 and 3–4 TaCKX9-1B Kontesa and Ostka, respectively; Lane 5: positive control from previously optimized PCR; Lane 6: negative control (H2O); Lanes 7 and 8: empty.

2.3. Mapping of Conserved Motifs in the Kontesa and Ostka Cultivars

To identify such features in promoter and cis-regulatory sequences amplified from selected TaCKX GFMs, we performed the motif conservation analysis using MEME Suite v5.4.1. The aim was to compare the cis-regulatory sequences, which were found in the three homologues of selected TaCKX GFMs based on the reference genome with that in our selected Kontesa and Ostka cvs. A conservation analysis of three maximum motif levels was performed. The p-value among all the motifs was recorded as 10−44 to 10−77, which shows that all the motifs discovered have a high confidence level and each of the motif widths was 50 base pairs, as shown in Figure 2. Comparative motif analysis among all reference genomes and our cvs. revealed that all sequences have at least three conserved motifs; however, there was a difference in their distribution and location level. For example, motifs 1-GSCGBYTWTMYATASGSKSYGCMMCYCYGAVGAGCAWMACAM-MAMWSGAY, 2-SCAGCAGMYMMTSRTMAYMRSATTARCRSRSCGAGSTAKSTARRC-GCG, and 3-GCVTCYHDKMGMVWTWMMGSMTRCGYWWMTGTTGSRMMGGSCGATCS-RTS of TaCKX1-3A (Figure 2A) in the reference genome are closely located compared to upstream sequences from the Kontesa and Ostka cvs. A similar trend of occurrence of motifs was observed in the upstream cis-regulatory sequences of TaCKX2.2.1 in the Kontesa and Ostka cvs. compared to the reference genome sequences for three conserved motifs, i.e., motif 1- CAMMCYCAAGWMSTCKGTMGYRCCRYCTASMTASCTMRSTYKKCT, motif 2-YGCGTKKGW-KKCWTAGCTWGAGTRWTCKATVGWKYSAYCTM, and motif 3-YGCBSSSGTTWTTYMWWRSSCWCCVYCCSCMWGASRAGMRTCACAAAAAY (Figure 2B). However, motif 1 is located on the negative strand in the Kontesa and Ostka cvs., while motif 2 is located on the positive strand in the reference genome. Furthermore, three motifs of TaCKX5 1-CTTTAAGAATTCCGCTCCAAAGCTCGCCGCACATGGCACGCAGGATGAAA, 2-GAGTCGTGA-CGCGCCTCCGGATTTGTTTATTCTTGGGCGGCCCCAGCGGT, and 3-CGCGATCCACTAATTCT-GACAGGGGAATTAAGAGGCCGCCGGCCCGCGAC were found to be most conserved at base-pair level compared to the reference genome (Figure 2C).

Figure 2.

Figure 2

Comparison of the conservative motifs of the TaCKX1-3A (A), TaCKX22.1-3B (B), TaCKX5-3D (C), TaCKX9-1B (D), and TaCKX10-7B (E) GFMs from the Kontesa and Ostka cultivars to that identified in the wheat reference genome. (A = Adenine, C = Cytosine, G = Guanine, T = Thymine, U = Uracil, R = Guanine/Adenine (purine), Y = Cytosine/Thymine (pyrimidine), K = Guanine/Thymine, M = Adenine/Cytosine, S = Guanine/Cytosine, W = Adenine/Thymine, B = Guanine/Thymine/Cytosine, D = Guanine/Adenine/Thymine, H = Adenine/Cytosine/Thymine, V = Guanine/Cytosine/Adenine, N = Adenine/Guanine/Cytosine/Thymine).

The motifs of TaCXK9, i.e., 1-GAGGGATCAAGTGGGCCTGCTCGATAGCAATCAGGTTTGCCACTTGAATC, 2-GATTCCCCTT-TTCATGGAGTTCCCGGTTATCCACAGGATTGTCGCGTATG, and 3-CCATGTGGGCAAAGGGA-TTCTACAATATCAAGCTAAAGCTCCTGACCACT showed a pattern of motif conservation and distribution similar to TaCKX5 (Figure 2D). Furthermore, among the three motifs of TaCKX10, i.e., motif 1-ATRMWTMTWTGAWTSTRTWTAGAMMAATAAMCAWWKAGGKSTT-CYGYRSA, motif 2-CSSCACY-GWYMKCYSBWCCCARCAGYTRMSCWGCMTKAATKRSGAR-TGGA, and motif 3-TRGSAAMACCCB-GSYSYTRCCSRMMTTWRTCRSCTYKHRGYRCATCSCCS (Figure 2E), motif 2 and 3 are located on the negative strand compared to the reference genome. The MEME suite GOMO tool v5.4.1 suggested that all selected motifs have a gene regulatory function.

2.4. Identification of TaNAC Transcription Factor Binding Sites in Selected TaCKX GFMs cis-Regulatory Sequences of Kontesa and Ostka cvs. and Selection of TaNAC Genes

However, the MEME suite provides information about the presence of common conserved motifs, to identify the TaNAC TFs and their binding sites on the cis-regulatory sequences of the selected TaCKX GFMs from the Kontesa and Ostka cvs. we again analyzed our sequences on the PlantTFDB v5.0 database. All parameters were the same as described in the previous section “Identification of TaNAC transcription factor binding sites of TaCKX GFMs cis-regulatory regions”. FIMO files containing details of all the transcription factors and their binding sites on the selected TaCKX GFMs are provided as Supplementary Folder S2. We identified and sorted the TaNAC transcription factors and their binding sites from the retrieved FIMO files and tabulated the results in Table 1. Based on the highest score and lowest p’ and q’ values of transcription factor binding sites in the cis-regulatory regions of each selected TaCKX GFM of the Kontesa and Ostka cvs., we selected one transcription factor per each basic TaCKX gene, which has been highlighted as blue in Table 2, for further analysis and characterization. Transcription factor binding site analysis of the selected TaCKX GFMs showed that TaNAC TF “Traes_5DL_0924913F8” is identified as the transcription factor JUNGBRUNNEN 1-like [Triticum aestivum] in the NCBI database. The TF binds to the “TACCGTCTTGATCCCGTC” sites of TaCKX1-3A gene cis-regulatory sites. Similarly, TaNAC TFs “Traes_1AL_C4FA8404A”, “Traes_2BL_209C14A8F”, “Traes_2BL_209C14A8F”, and “Traes_1AL_C4FA8404A” were identified in NCBI as NAC domain-containing protein 13-like [Triticum aestivum], putative NAC domain-containing protein 94 [Triticum aestivum], protein BEARSKIN1-like [Triticum aestivum], and NAC domain-containing protein 13-like [Triticum aestivum] and bind to the cis-regulatory sites “TGTAACTTGGGAGACAAGACA”, “TGCCGTATCTTGACCGGC”, “GGATGCTTAAAACATAAGCCA”, and “GAAAACTTGCTGATCACTACT” of the TaCKX2.2.1-3B, TaCKX5-3D, TaCKX9-1B, and TaCKX10-7B genes, respectively. In the case of TaCKX2.2.1-3B and TaCKX10-7B, a common TF (Traes_1AL_C4FA8404A) NAC domain-containing protein 13-like [Triticum aestivum] was identified to have binding interaction with the highest scores of 18.7576 and 12.7273, respectively. Therefore, for TaCKX10-7B, we also included the second TF “TRAES3BF002300010CFD_t1” identified as NAC domain-containing protein 48-like [Triticum aestivum] in NCBI for further analysis. The inclusion of a second TF for TaCKX10-7B allowed us to select at least one specific TaNAC for one selected TaCKX GFM, apart from the selection of common TaNACs involved in the regulation of more than one selected TaCKX genes.

Table 1.

Summary of identified TaNAC transcription factors and their binding sites in cis-regulatory regions of selected TaCKX GFMs.

Selected TaCKX TaNAC TF ID Family Start Stop Strand Score p-Value q-Value Transcription Factor Binding Sites
TaCKX1
(Threshold p-value 10−4)
TaCKX1-3A (TraesCS3A02G109500)
Traes_5DL_0924913F8 NAC 552 571 + 14.4721 3.05 × 105 0.0668 TACCGTCTTGATCCCGTC
Traes_6BL_A169A3ECB NAC 707 724 + 14.1667 1.04 × 105 0.0402 TACCGTCTTGATCCCGTC
Traes_6AL_0D7866801 NAC 707 724 + 14.1667 1.04 × 105 0.0402 TACCGTCTTGATCCCGTC
TRAES3BF114300070CFD_t1 NAC 1492 1510 11.8333 4.54 × 105 0.173 CTTCTCCGGTAGGGCACCC
TaCKX2.2.1
(Threshold p-value 10−4)
TaCKX2.2.1-3B (TraesCS3B02G161000)
Traes_1AL_C4FA8404A NAC 1113 1133 + 18.7576 3.38 × 107 0.00133 TGTAACTTGGGAGACAAGACA
Traes_4BL_D592DBAAF NAC 1115 1130 16.4545 1.45 × 106 0.00573 CTTGTCTCCCAAGTTA
Traes_4AS_B95A1C3A1 NAC 1115 1135 + 15.8636 2.57 × 106 0.0101 TAACTTGGGAGACAAGACATT
Traes_1AL_C4FA8404A NAC 1115 1135 14.3182 4.29 × 106 0.00848 AATGTCTTGTCTCCCAAGTTA
Traes_4BS_373BDBA94 NAC 1115 1130 14.9242 5.50 × 106 0.0218 CTTGTCTCCCAAGTTA
Traes_5BL_657BF1497 NAC 1115 1132 + 14.4394 6.70 × 106 0.0265 TAACTTGGGAGACAAGAC
Traes_1BL_8925B27BC NAC 1116 1130 + 14.3333 8.20 × 106 0.0325 AACTTGGGAGACAAG
Traes_7AL_46F73E667 NAC 1113 1133 + 13.7727 9.26 × 106 0.0366 TGTAACTTGGGAGACAAGACA
Traes_2BL_209C14A8F NAC 1113 1133 + 12.6061 1.61 × 105 0.0636 TGTAACTTGGGAGACAAGACA
Traes_4AS_B95A1C3A1 NAC 1113 1133 11.7273 1.84 × 105 0.0364 TGTCTTGTCTCCCAAGTTACA
Traes_4BS_373BDBA94 NAC 1118 1133 + 12.5 2.39 × 105 0.0474 CTTGGGAGACAAGACA
Traes_5DL_B69423A67 NAC 1116 1132 + 12.7121 2.47 × 105 0.0979 AACTTGGGAGACAAGAC
Traes_4AL_99942CBEA NAC 1115 1131 + 12.0758 3.72 × 105 0.147 TAACTTGGGAGACAAGA
TaCKX5
(Threshold p-value 10−4)
TaCKX5-3D (TraesCS3D02G310200)
Traes_6BL_A169A3ECB NAC 1213 1230 14.2273 9.92 × 106 0.0386 TGCCGTATCTTGACCGGC
Traes_6AL_0D7866801 NAC 1213 1230 14.2273 9.92 × 106 0.0386 TGCCGTATCTTGACCGGC
Traes_5DL_0924913F8 NAC 1211 1230 13.7727 1.16 × 105 0.0445 TGCCGTATCTTGACCGGCTT
Traes_5BL_39FF03C5D NAC 1211 1230 13.7727 1.16 × 105 0.0445 TGCCGTATCTTGACCGGCTT
TaCKX9
(Threshold p-value 10−4)
TaCKX9-1B (TraesCS1B02G248700)
Traes_2BL_209C14A8F NAC 1197 1217 + 16.4394 1.71 × 106 0.00463 GGATGCTTAAAACATAAGCCA
Traes_7AL_46F73E667 NAC 1197 1217 + 16.2424 1.94 × 106 0.00536 GGATGCTTAAAACATAAGCCA
Traes_4AL_99942CBEA NAC 1199 1215 + 14.8939 5.19 × 106 0.0142 ATGCTTAAAACATAAGC
Traes_4AL_99942CBEA NAC 1201 1217 14.0606 1.01 × 105 0.0142 TGGCTTATGTTTTAAGC
Traes_2AL_82C3E7E14 NAC 1200 1214 13.3485 1.80 × 105 0.0328 CTTATGTTTTAAGCA
Traes_6AL_8BA1FF8B2 NAC 882 893 11.798 2.03 × 105 0.062 GGACAAGCCAAG
Traes_2AL_82C3E7E14 NAC 1202 1216 + 12.9848 2.32 × 105 0.0328 CTTAAAACATAAGCC
TaCKX10
(Threshold p-value 10−4)
TaCKX10-7B (TraesCS7B02G264400)
Traes_1AL_C4FA8404A NAC 468 488 + 12.7273 9.05 × 106 0.0318 GAAAACTTGCTGATCACTACT
TRAES3BF002300010CFD_t1 NAC 406 427 12.5152 2.33 × 105 0.0856 TTCGTGTTTGTATTGGCCACGT
TRAES3BF114300070CFD_t1 NAC 160 178 + 12.2576 3.46 × 105 0.133 CCTGTATTTCACGGAGTCG
Traes_5DL_0924913F8 NAC 1023 1042 11.5455 4.64 × 105 0.178 CTCCGTTTTATTTACTCCGC
Traes_5BL_39FF03C5D NAC 1023 1042 11.5455 4.64 × 105 0.178 CTCCGTTTTATTTACTCCGC
Traes_2DS_5DF921ABB NAC 1527 1534 12.0303 6.67 × 105 0.258 TACGTAAT
* TaCKX2.1 (Threshold p-value 10−4)
TaCKX2.1-3D TraesCS3D02G143600
Traes_5DL_0924913F8 NAC 653 672 + 12.2727 3.05 × 105 0.0668 CGTCGTGCTCATCCCGGAGC
Traes_6BL_A169A3ECB NAC 653 670 + 12.5152 3.10 × 105 0.0952 CGTCGTGCTCATCCCGGA
Traes_5DL_0924913F8 NAC 537 556 + 11.697 4.26 × 105 0.0668 CGGCGTGGGCGTCAGGGCAC
* TaCKX11 (Threshold p-value 10−4)
TaCKX11-7B TraesCS7B02G455000
Traes_2BL_209C14A8F NAC 687 707 9.48485 6.29 × 105 0.115 CATAAATTCAAATTTAATCAA
Traes_2BL_209C14A8F NAC 685 705 + 8.98485 7.61 × 105 0.115 AATTGATTAAATTTGAATTTA

* according to sequences from the EnsemblPlants database, RefSeq v2.1.

Table 2.

Summary of various attributes of selected TaNAC genes.

Attributes Selected TaNACs
Transcription Factor JUNGBRUNNEN 1-like [Triticum aestivum] NAC Domain-Containing Protein 13-like
[Triticum aestivum]
Putative NAC Domain-Containing Protein 94 [Triticum aestivum] Protein BEARSKIN1-like [Triticum aestivum] NAC Domain-Containing Protein 48-like
[Triticum aestivum]
TaCKX GFMs Regulated by TaNACs TaCKX1-3A TraesCS3A02G109500
TaCKX2.1-3D
TraesCS3D02G143600
TaCKX5-3D TraesCS3D02G310200
TaCKX 2.2.1-3B TraesCS3B02G161000
TaCKX10-7B TraesCS7B02G264400
TaCKX5-3D TraesCS3D02G310200
TaCKX1-3A TraesCS3A02G109500
TaCKX2.1-3D
TraesCS3D02G143600
TaCKX9-1B TraesCS1B02G248700
TaCKX 2.2.1-3B TraesCS3B02G161000
TaCKX11-7B
TraesCS7B02G455000
TaCKX10-7B TraesCS7B02G264400
Rename of selected TaNACs TaNAC JUNGBRUNNEN-1 (TaNAC J-1) TaNAC13a TaNAC94 TaNAC BEARSKIN-1
(TaNAC Br-1)
TaNAC6D
TaNAC TF ID Traes_5DL_0924913F8 Traes_1AL_C4FA8404A Traes_6BL_A169A3ECB Traes_2BL_209C14A8F TRAES3BF002300010CFD_t1
TaNAC Protein ID XP_044402035.1 XP_044450494.1 XP_044416817.1 XP_044328275.1 XP_044358948.1
Protein size 341 aa 429 aa 390 aa 336 aa 299 aa
NAC domain size 35-194 aa 6-156 aa 16-175 aa 10-161 aa 9-159 aa
NCBI Gene ID XM_044546100.1 XM_044594559.1 XM_044560882.1 XM_044472340 XM_044503013.1
Ensemble Gene ID TraesCS5D02G421100 TraesCS1D02G266500 TraesCS6D02G286300 TraesCS2D02G309800 TraesCS3D02G401200
Gene Description at Plant Ensemble n/a n/a n/a n/a NAC6D
Gene Ontology Analysis
  • Regulation of transcription, DNA-templated

  • Trehalose biosynthetic process

  • Proline biosynthetic process

  • Anthocyanin-containing compound biosynthetic process

  • Camalexin biosynthetic process

  • Hyperosmotic salinity response

  • Negative regulation of leaf senescence

  • Cellular component-nucleus

  • Molecular function-DNA binding

  • Regulation of transcription, DNA-templated

  • Cellular component-nucleus

  • Molecular function-DNA binding

  • Regulation of transcription, DNA-templated

  • Response to auxin

  • Positive regulation of asymmetric cell division

  • Somatic stem cell division

  • Root cap development

  • Cellular component-nucleus

  • Molecular function-DNA binding

  • Regulation of transcription, DNA-templated

  • Plant-type secondary cell wall biogenesis

  • Root cap development

  • Cellular component-nucleus

  • Molecular function-DNA binding

  • Regulation of transcription, DNA-templated

  • Response to wounding

  • Negative regulation of abscisic acid-activated signaling pathway

  • Cellular component-nucleus

  • Molecular function-DNA binding

2.5. NAC Domain Identification, Prediction of Protein Structure, and Various Attributes of Selected TaNACs

Although the plant transcription factor database provides a great deal of information about TFs such as TF ID, TF binding sites, the sites location on either positive or negative strands, and their start and end points on cis-regulatory sequences, various attributes such as TF gene ID, TF protein ID, gene description, and gene ontology are important features to fully characterize the transcription factors. We data-mined and retrieved the attributes of our selected TaNACs from different databases such as: PlantTFDB v5.0, EnsemblPlants v2.0, NCBI, QuickGo of EMBL-EBI, InterProScan, and SWISS-MODEL, and tabulated them (Table 2). The protein sequences of selected TaNACs were BLAST in the wheat EnsemblPlants v2.0 protein database and based on the highest identity index, the gene IDs were identified and the selected TaNACs namely Transcription factor JUNGBRUNNEN 1-like, NAC domain-containing protein 13-like, putative NAC domain-containing protein 94, and protein BEARSKIN-1-like were renamed to TaNAC JUNGBRUNNEN-1 (TaNACJ-1), TaNAC13a, TaNAC94, and TaNAC BEARSKIN-1 (TaNACBr-1), respectively. Furthermore, the protein sequence of NAC domain-containing protein 48-like has a 100% identity index with NAC 6D so we renamed the NAC domain-containing protein 48-like to TaNAC6D. Gene ontology analysis performed on the QuickGo database showed that all of the selected TaNACs have DNA binding ability and that the nucleus is the site of a cellular compartment. Details of the gene ontology analysis of each of the selected TaNAC genes are listed in Table 2.

2.5.1. Identification of the TaNAC Domain in Selected TaNAC Proteins

All selected TaNACs’ NCBI protein IDs were determined using transcription factor IDs. NCBI-retrieved protein sequences were analyzed for the presence of NAC domain confirmation using the InterProScan database. The analyzed file in the form of GFF was downloaded from Supplementary File S2. InterProScan analysis confirmed that TaNAC JUNGBRUNNEN-1 (TaNACJ-1), TaNAC13a, TaNAC94, TaNAC BEARSKIN-1 (TaNACBr-1), and TaNAC6D are 341 amino acid (aa), 429 aa, 390 aa, 336 aa, and 299 aa long proteins and have conserved NAC domains from 35 to 194 aa, 6 to 156 aa, 16 to 175 aa, 10 to 161 aa, and 9 and 159 aa, respectively, as show in Figure 3.

Figure 3.

Figure 3

Identification of NAC domain in selected TaNACs by InterProScan database (accessed on 14 September 2023).

2.5.2. Structure Prediction and Phylogenetic Analysis of Selected TaNACs

To investigate the conservation of tertiary structure proteins of TaNAC JUNGBRUNNEN-1 (TaNACJ-1), TaNAC13a, TaNAC94, TaNAC BEARSKIN-1 (TaNACBr-1), and TaNAC6D, we modeled each selected TaNAC. The results indicated good structural quality with two alpha helixes and four beta sheets in each of the main domains of all selected TaNAC proteins (Figure 4A). The Ramachandran plots of the transcription factor JUNGBRUNNEN 1-like, NAC domain-containing protein 13-like, putative NAC domain-containing protein 94, protein BEARSKIN1-like, and NAC domain-containing protein 48-like indicated that the residues in the favored regions were 92.09%, 96.43%, 92.09%, 92.08%, and 94.12%, respectively (Figure 4B).

Figure 4.

Figure 4

Tertiary structure prediction models of selected TaNAC proteins and Ramachandran plots. (A) Represents the tertiary structures of TaNAC JUNGBRUNNEN-1 (TaNACJ-1), TaNAC13a, TaNAC94, TaNAC BEARSKIN-1 (TaNACBr-1), and TaNAC6D (beta sheets in blue; alpha helixes in brown); (B) Ramachandran plots represent the residue in favored and unfavored regions (dots on the left in dark green circles represent residues in the favored regions, and dots on the right in lighter green circles represent residues in the unfavored regions).

To investigate the evolutionary relationship between 43 well-known TaNACs and TaNACJ-1, TaNAC13a, TaNAC94, TaNACBr-1, and TaNAC6D, phylogenetic analysis was performed by generating a maximum likelihood phylogenetic tree (File S3). The phylogenetic tree classified all TaNACs into three main groups. Four of our selected TaNACs, namely TaNAC6D, TaNAC13a, TaNACJ-1, and TaNAC94, were classified in group I. TaNAC6D shared a common clade with TaNAC2 and TaNAC5. TaNAC13a was in a single clade with TaNAC13 and TaNAC7; however, TaNACJ-1 and TaNAC94 were in a separate single clade showing a close evolutionary relationship between the two proteins. Furthermore, TaNACBr-1 was found in a common clade with TaNAC3 and TaNAC33 in group-III while none of the selected TaNACs were classified into group II (Figure 5).

Figure 5.

Figure 5

Maximum likelihood phylogenetic tree of TaNACJ-1, TaNAC13a, TaNAC94, TaNACBr-1, and TaNAC6D and 43 well-known TaNACs. The phylogenetic tree was generated using MEGA v.11 software, amino acid-based ClustlW-aligned sequences of TaNAC proteins. The selected TaNAC-containing clades are highlighted in redlined boxes.

2.6. Analysis of Expression of Selected TaNACs in Different Tissues of Developing Wheat Plants

The specificity of expression of TaNACJ-1, TaNAC13a, TaNAC94, TaNACBr-1, and TaNAC6D was analyzed in the various tissues of the Kontesa and Ostka cvs.: 5 DPG seedling roots, 5–6 cm long inflorescences, 0, 4, 7, and 14 DAP spikes, and the corresponding flag leaves. The expression data shown in Figure 6 are related to the expression of the ADP Ribosylation factor-2 set as 1.00. For expression analysis, in addition to the selected TaNACs, we included TaNAC2-5A since our previous studies showed that this gene, could potentially be involved in coregulation of TaCKX GFMs [18,21].

Figure 6.

Figure 6

Specificity of expression of the selected TaNAC genes in various tissues of the Kontesa and Osktka cvs. Each bar is the mean value representation of three biological and three technical replicates. One-way and two-way ANOVAs were performed for statistical analysis. The asterisks above the bar indicate statistical significance compared to 0 DAP flag leaves and below the bar compared to Kontesa cv. (* 0.05 > p ≥ 0.01, ** 0.01 > p ≥ 0.001, *** p < 0.001).

Each selected TaNAC showed different gene expression patterns in the tested tissues. However, the level of expression in seedling roots of all tested TaNACs was high or very high compared to other tissues. The highest expression in the root was measured for TaNAC13a as 0.217 and 0.247 in the Kontesa and Ostka cvs., respectively. The lowest expression was measured for TaNACBr-1 as 0.00914 and 0.00911 in the Kontesa and Ostka cvs., respectively. Furthermore, the expression of TaNAC2-5A in seedling roots was significantly higher in the Kontesa cv. (0.028) than the Ostka cv. (0.002). However, the expression of TaNAC6D, TaNACJ-1, and TaNAC94 was significantly higher in the Ostka cv. with values of 0.139, 0.072, and 0.042 compared to the Kontesa cv. with values of 0.095, 0.054, and 0.028, respectively. There was no significant difference in the expression of TaNACBr-1 in the roots of the Kontesa and Ostka cvs. (Figure 6).

The levels of expression of the tested TaNACs in inflorescences of the Kontesa and Ostka cvs. were very low compared to the other tissues tested. The highest expression was measured for TaANC6D in the Kontesa cv. as 0.010 and the Ostka cv. as 0.012, and the lowest expression was recorded in TaNACBr-1 in the Kontesa cv. as 0.00005 and the Ostka cv. as 0.00009. The remaining expression levels of the selected TaNACs, including TaNAC2-5A, were restricted between the highest and lowest ranges in the Kontesa and Ostka cvs. (Figure 6).

In general, the expression of the selected TaNACs in the flag leaves and spikes gradually increased from 0 to 7 DAP and at 14 DAP it began to decline (Figure 6). The expression levels of TaNAC2-5A in the flag leaves were lowest at 0 DAP (0.019 in the Kontesa cv. and 0.011 in the Ostka cv.) but gradually increased in 7 DAP, reaching the values of 0.074 in the Kontesa cv and 0.064 in the Ostka cv. The expression at 14 DAP decreased to 0.055 in the Kontesa cv. and 0.064 in the Ostka cv. TaNAC-5A expression was higher and significantly different in the flag leaves of the Kontesa cv. compared to the Ostka cv. until 7 DAP; however, at 14 DAP the expression in the Ostka cv. remained higher than the Kontesa cv. and the difference was statistically significant. Similarly, TaNAC2-5A expression in the spikes followed the same pattern as that in the flag leaves from 0 DAP to 14 DAP. The highest expression of TaNAC2-5A in the spikes was at 7 DAP as 0.018 in the Kontesa cv. and 0.020 in the Ostka cv.

TaNAC6D showed the lowest expression in 0 DAP flag leaves as 0.0013 in the Kontesa cv. and 0.02 in the Ostka cv., while the highest expression in 7 DAP flag leaves as 0.138 and 0.179 in the Kontesa and Ostka cvs., respectively. The comparative expression pattern between the Kontesa and Ostka cvs. in the flag leaves revealed that, at 0 DAP, the expression of TaNAC6D was significantly higher in the Ostka cv. than in the Kontesa cv., and the expression pattern remained the same until 7 DAP between the two cvs. But, at 14 DAP, the expression of TaNAC6D in the Kontesa cv. was significantly higher than in the Ostka cv. However, in the spikes, TaNAC6D expression followed the same pattern as TaNAC2-5A. The lowest expression of TaNAC6D was recorded at 14 DAP as 0.0018 in the Kontesa cv. and 0.0043 in the Ostka cv., while the highest expression of TaNAC6D was recorded at 7 DAP as 0.180 in the Kontesa cv. and 0.106 in the Ostka cv. Unlike TaANC2-5A and TaNAC13a, the expression pattern of TaNAC6D in the flag leaves was slightly different. The expression of TaNAC6D in the flag leaves started from being the lowest at 0 DAP and reached a maximum at 14 DAP in both the Kontesa and Ostka cvs. (Figure 3). The lowest expression at 0 DAP was recorded as 0.0016 and 0.0036, while the highest expression at 14 DAP was recorded as 0.056 and 0.040 in the Kontesa and Ostka cvs., respectively. The expression of TaNAC6D in the spikes was highest at 7 DAP as 0.046 in the Kontesa cv., whereas at 14 DAP in the Ostka cv. it was 0.034.

TaNACJ-1 exhibited a very distinctive 7 DAP specific expression pattern in flag leaves and spikes. The mean expression of TaNACJ-1 was highest at 7 DAP in flag leaves (0.015 and 0.0278) and in spikes (0.025 and 0.039) in both Kontesa and Ostka cvs. correspondingly. However, Ostka cv. exhibited higher expression of TaNACJ-1 in both tissues compared to Kontesa cv. TaNAC94 and TaNACBr-1 also exhibited a similar expression pattern to TaNACJ-1 considering the 7 DAP time-dependent expression pattern in flag leaves and spikes, except for 14 DAP. TaNAC94 maintained notable expression levels in flag leaves (0.014 and 0.006) in the Kontesa and Ostka cvs., respectively; meanwhile, TaNACBr-1 expression at 14 DAP in the flag leaves was 0.0019 and 0.0015 in the Kontesa and Ostka cvs., correspondingly. The highest mean expression of TaNAC 94 at 7 DAP was measured in the flag leaves (0.055 and 0.059) and in the spikes (0.003 and 0.01) for the Kontesa and Ostka cvs., respectively. Similarly, the highest expression of TaNACBr-1 was observed at 7 DAP in the flag leaves (0.0065 and 0.0068) and in the spikes (0.0066 and 0.0080) in the Kontesa and Ostka cvs., respectively.

3. Discussion

3.1. TaNAC TFs Orchestrate cis-Regulation of TaCKX GFMs

The key role of TaCKX GFMs and TaNAC GFMs in controlling yield-related traits in wheat highlights the importance of exploring the TaNAC TF of TaCKX GFMs. To identify TaNAC TF binding sites on the cis-regulatory sequences of TaCKX GFMs, we initially performed an identification analysis in all 35 homologous genes of this family based on the reference wheat genome (IWGSC, RefSeq v2.1). The results showed that all of the TaCKX GFMs have TaNAC binding sites on their cis-regulatory sequences; however, each TaCKX showed different binding affinity parameters (File S1). This initial analysis helped us to choose only those TaCKX GFMs, which showed the highest scores and lowest values of “p” and “q” for TaNAC TFs binding to the cis-regulatory sites of TaCKX GFMs. We selected the five most important TaCKX GFMs, namely TaCKX1-3A, TaCKX2.2.1-3B, TaCKX5-3D, TaCKX9-1B, and TaCKX10-7B to further prove the identification of TaNAC TF binding sites in the selected TaCKX genes of the Kontesa and Ostka cvs.

Variability among the cis-regulatory sequences in the core promoters and distal promoter regions can change the gene regulation network and obstruct the evaluation of promoter efficiency [25]. Therefore, to identify such variability in the cis-regulatory sequences of the selected TaCKX GFMs compared to reference genome sequences from the Chinese Spring cv. (IWGSC, RefSeq v2.1) we first performed conserved motif MEME Suite analysis before identification of TaNAC TFs and their binding sites. The MEME Suite is an integrated online web server for the discovery and analysis of conserved motifs and identifies features such as DNA binding sites, their distance, distribution on positive or negative strands, and protein interaction domains [33]. The motif conservation analysis (Figure 2) showed that the motifs were conserved between the Kontesa and Ostka sequences compared to the reference genome sequences at the three motif levels; however, the distance and distribution patterns of the motif were different between the TaCKX GFMs between the Kontesa and Ostka cvs. compared to the reference genome (IWGSC, RefSeq v2.1). Knowing the spatial distribution, location, and pattern of the motifs is a subject of interest in steric stabilization, and such changes in cis-regulatory sequences lead to crop domestication [25,34].

After motif conservation analysis, we finally identified TaNAC TFs and their binding sites on the selected TaCKX GFMs in the Kontesa and Ostka cvs. Among the several TaNAC TFs that bind to the selected TaCKX GFM cis-regulatory sequences, we selected only one TaNAC TF with the highest binding affinity parameters for each selected TaCKX GFM, except TaCKX10-7B (Table 1), for further characterization. Similarly to us, in several studies, including Pompili et al. (2020), Yokotani et al. (2021) and Zhang et al. (2022) [35,36,37], other authors have used the plant transcription factor database (PlantTFDB v5.0) to identify transcription factors. The names of the selected TaNAC TFs in the NCBI database were identified as: transcription factor JUNGBRUNNEN 1-like, NAC domain-containing protein 13-like, putative NAC domain-containing protein 94, and protein BEARSKIN-1-like, which bind to the cis-regulatory sites of the TaCKX1-3A, TaCKX2.2.1-3B, TaCKX5-3D, TaCKX9-1B, and TaCKX10-7B TaCKX GFMs, respectively.

Interestingly, a deep analysis of TaNAC TFs that were listed in Table 1 revealed that some of them have common binding sites on more than one selected TaCKX cis-regulatory region and potentially are involved in their regulation. For example, putative NAC domain-containing protein 94 (Traes_2BL_209C14A8F) has a common binding site on TaCKX5-3D and TaCKX1-3A (Table 1 and Table 2). Similarly, the NAC domain-containing protein 13-like (Traes_1AL_C4FA8404A) showed common binding sites on the cis-regulatory regions of TaCKX2.2.1-3B and TaCKX10-7B, suggesting that the common TaNAC could coregulate more than one TaCKX gene.

3.2. Structural Characterization and Various Attributes Reveal the Recognizable Pattern of Selected TaNACs

When protein analysis is performed, the aim is always to find as much information as possible to explore its potential role and relationship with the other proteins. In the case of NAC TFs, all proteins contain a conserved NAC domain with the non-variable N-terminal and the variable C-terminal [38]. To identify conserved domains, several studies have performed domain identification analysis by scanning protein sequences in the InterProScan database [39,40]. Consistent with these studies, our underlined analysis of the NAC domain identified a conserved NAC domain in all our selected TaNAC TFs (Figure 3). The presence of this domain validated them as TaNAC TFs. Furthermore, their projected tertiary structure models are in agreement with the tertiary model predicted by Guérin et al. (2022) [41] for four TaGNAC TFs related to grain development. The phylogenic tree analysis classified all TaNAC TFs into three groups according to their potential role and the previously reported data (Figure 4). Mao et al. (2020) [42] identified eight drought-induced genes, i.e., TaNAC30, TaNAC21, TaNAC27, TaNAC38, TaNAC10, TaNAC15, TaNAC34, and TaNAC40. All of these genes were present in group I with four of our selected TaNACs, namely TaNAC6D, TaNAC13a, TaNACJ-1, and TaNAC94, suggesting their potential role in drought stress. As investigated by us, TaNAC2-5A was also classified into group I. TaNAC2-5A is a gene encoding nitrate-inducible TaNAC TF, well characterized for its role in root growth, grain yield, soil nitrate uptake, establishment of seed vigor, and drought stress [31,32,43]. Furthermore, our selected TaNACBr-1 was classified into group III of the phylogenetic tree, which contains TaNAC TFs with a potential role in responses to drought, heat, and salt stress [44,45]. Tang et al. (2011) [46], in their study on the tolerance to drought stress conferred by TaNAC GFMs, classified TaNAC13 and TaNAC7 as development-related. Therefore, the potential role of our selected TaNAC13a, which shared the same common clade with TaNAC13 and TaNAC7, might also be associated with plant development. Two genes responsive to biotic stress, TaNAC30 and TaNAC35, that have been known to regulate leaf rust stress in wheat [47,48], were classified in group II of the phylogenetic tree.

The Gene Ontology (GO) resource is used to explain various aspects such as biological processes, molecular functions, and cellular localization of a gene product [49]. GO analysis showed that of all the selected TaNAC GFMs have transcription-regulation and DNA template-binding ability as their common biological and molecular functions, and the nucleus as their cellular compartment, which confirms them as transcription factors. Furthermore, the GO analysis of two of the selected TaNACs (TaNAC94 and TaNACBr-1) showed their potential role in the development of the root cap, while TaNACJ-1 and TaNAC6D showed their potential role in the negative regulation of leaf senescence and the regulation of the abscisic acid-activated signaling pathway, respectively (Table 2). Other important biological processes regulated by the selected TaNACs are listed in Table 2.

3.3. Selected TaNACs Are Preferentially Expressed in the Roots

The root is an important organ in plants that is not only responsible for the regrowth of the plant in the soil but also serves to absorb water and nutrients from the soil [50,51]. In wheat crops, several TaNAC TFs have been reported to regulate the root system. Overexpression of TaRNAC1 positively regulated the root system and increased above-ground biomass, while overexpression of TaSNAC8-6A helped with lateral root system development by activating drought-responsive and auxin-signaling genes [42]. Conversely, TaNAC14 overexpression negatively regulated root growth [52]. The TaNAC GFMs selected in this investigation were preferentially expressed in the roots of two cultivars, suggesting their potential role in root growth and development (Figure 6). Our expression analysis is in agreement with the GO analysis, where TaNACJ-1 showed the potential role in the response to hyperosmotic salinity, while TaNAC94 and TaNACBr-1 showed a direct role in root cap regulation (Table 2). TaCKX1 and TaCKX5 have been shown to be highly expressed in seedling roots [22] and the TF identification results of this study (Table 2) have shown that TaNAC94 TF is potentially involved in cis-regulation of both TaCKX1 and TaCKX5 GFMs. The preferential expression of TaNAC94 in seedling roots strongly suggests the potential role of TaNAC94 TF in the coregulation of TaCKX1 and TaCKX5. As drought is a serious challenge to crop productivity [53], the identification of gene functions associated with root growth and development is considered one of the best ways to improve crop productivity. Since all of our selected TaNACs showed expression specificity to the root, further characterization of these selected TaNACs could be beneficial in crop productivity.

3.4. Inflorescence Is Not the Primary Site for the Expression of Our Selected TaNAC GFMs

Inflorescence is the arrangement of the flowers during the flowering process [54]. This is an important part of the plant in which to assess the expression level of genes related to reproductive parts during flowering time. Some TaNAC GFMs, such as TaNACS-1A, have already been reported to be preferably expressed during the flowering days in wheat [55,56], while TaNAC8 was less favorable in the flowers and stem compared to the developing seeds [57]. We found that the selected TaNACs do not express preferably in inflorescence, except TaNAC6D (Figure 6).

3.5. The Selected TaNACs Showed a Distinct Preference for Expression in Flag Leaves and Spikes during the 7 and 14 DAP Periods

TaNAC genes related to seed-associated traits directly influence crop productivity, while TaNAC GFMs related to leaves or leaf senescence indirectly influence crop productivity [25]. We explored the expression pattern of the selected TaNACs in the spikes and flag leaves of the two cultivars collected during four developmental stages: 0, 4, 7, and 14 DAP. Each selected TaNAC showed a discrete pattern of expression; however, at 7 and 14 DAP, the level of expression was higher compared to the 0 and 4 DAP. It is notable to mention that, at some developmental stages, we observed different levels of expression of our selected TaNAC GFMs between the Kontesa and Ostka cvs., especially in the flag leaves and spikes (Figure 6). These differences in expression suggest that it can be related to the spike architecture awned (Ostka) or awnless (Kontesa) cultivars [18]. It has already been shown that 7 and 14 DAP spikes are sites of preference for some of the TaCKX GFMs. For example, TaCKX1 and the group of TaCKX2 genes were preferentially expressed at 7 and 14 DAP in the spikes of the Kontesa, Ostka, and Trappe cvs. [22]. The highest expression in 7 DAP spikes of 34 breeding lines has also been observed for TaCKX1, TaCKX11, and TaNAC2-5A [21]. Our results showed that the selected TaNAC GFMs, including TaNACJ-1, TaNAC13a, TaNAC94, TaNACBr-1, and TaNAC6D, interact with the cis-regulatory sites of TaCKX1-3A, TaCKX22.1-3B, TaCKX5-3D, TaCKX9-1B, and TaCKX10, respectively, and potentially regulate their expression in the spikes and flag leaves. TaNACs have been known to regulate seed-related traits such as seed germination, seed vigor, and seed storage protein [5,23,28]. The significance of the spike-related expression of our selected TaNACs may be correlated to such grain-related traits. Similarly, the leaf senescence trait has been reported to be regulated by various TaNACs, including TaNAC29, NAM-A1, and TaSNAC11-4B [58,59,60]. The preferential expression of our selected TaNACs in the flag leaves also suggests their potential role in leaf senescence.

4. Materials and Methods

4.1. Acquisition of TaCKX GFMs’ cis-Regulatory Sequences and Identification of TaNAC Transcription Factor Binding Sites

For the acquisition of 1.5 kb upstream promoter and cis-regulatory sequences including UTRs of all TaCKX GFMs, the wheat EnsemblPlants database (https://plants.ensembl.org/Triticum_aestivum/Info/Index accessed on 22 June 2022), RefSeq v2.1 of the International Wheat Genome Sequencing Consortium (IWGSC) was used [61,62]. The acquired sequences were used to identify TaNAC transcription factor binding sites in these sequences using the PlantTFDB v5.0 online web server database (http://planttfdb.gao-lab.org/ accessed on 4 July 2022) [63]. Find Individual Motif Occurrence (FIMO) files were downloaded from the PlantTFDB v5.0 database for each homolog of the selected TaCKX GFMs containing the details of all the transcription factor binding sites. From these FIMO files, TaNAC transcription factor binding sites were identified.

4.2. Plant Materials and Growth Conditions

Two Polish spring wheat cultivars, Kontesa and Ostka, were used in the experiments. The seeds of both cultivars were grown in Petri dishes at 4 °C for one day and at room temperature (22 °C) in dark conditions for four days. The seedlings were then replanted in pots containing peat soil and grown in the growth chamber with the following conditions: 20 °C/18 °C day/night temperature, 16/8 h light/dark photoperiod, 350 µmol m−2 s−1 light intensity, and 70% humidity. Four-week-old fresh leaves were selected for DNA extraction, and the samples were frozen in liquid nitrogen prior to DNA extraction.

4.3. Genomic DNA Extraction and PCR Amplification

Genomic DNA was extracted from young leaf samples from the Kontesa and Ostka cvs. using the CTAB method as described by Yu et al. (2017) [64]. Nanodrop (NanoDrop ND-1000) was used to measure concentration and purification, and 0.8% agarose gel was used to verify DNA integrity. The primers were designed using the DNASTART SeqMAN pro primer design option (Table S1) to amplify targeted cis-regulatory sequences for the selected TaCKX GFMs. The conditions for the PCR reaction were optimized as: initial denaturation and polymerase activation at 98 °C for 3 min, (98 °C for 30 s, 60 °C for 30 s, 72 °C for 1.5 min) × 35 cycles, and the final extension at 72 °C for 5 min. High-fidelity Phusion DNA polymerase (Thermo Fisher Scientific, Waltham, MA, USA) was used for PCR.

4.4. Cloning and Sequencing of Selected TaCKX cis-Regulatory Sequences of the Kontesa and Ostka Cultivars

The PCR amplicons of selected TaCKX GFM cis-regulatory regions were subjected to PCR purification using E.Z.N.A. Cycle Pure Kit (Omega Bio-TEK Inc, Norcross, GA, USA) and quantified using Nanodrop (NanoDrop ND-1000, Thermo Fisher Scientific, Wilmington, DE, USA). The blunt ends of the PCR amplicons produced by Phusion DNA polymerase were A ‘tailed’ using the HighTaq DNA polymerase kit (BIORON GmbH, Römerberg, Germany). The reaction mixture contained: 6 μL of PCR amplicon, 1 μL of HighTaq DNA polymerase 10× reaction buffer, 0.2 μL of 10 mM dATP, 1 μL of HighTaq polymerase (5 U/μL), and 0.8 μL of deionized water. A total of 10 μL of the reaction was incubated at 70 °C for 30 min and 1 μL was used for ligation to the pGEMT easy vector (Promega, Madison, WI, USA) following the manufacturer’s instructions. The DH5α strain of E. coli was used to prepare competent cells following the method reported by Chung et al. (1989) [65] with few modifications, and pGEMT easy recombinant vectors were transformed into DH5α competent cells using the BIO-RAD GENE Pulser apparatus at 25 microfarad (µF) capacitance and 2.5 kv voltage. Positive colonies were confirmed by the PCR amplification method and were sequenced from GENOMED (https://www.genomed.pl/).

4.5. Motif Conservation Analysis

For the analysis of homology and conservation of motifs of the upstream cis-regulatory region of each selected TaCKX GFM, the MEME Suite v5.4.1 (Introduction—MEME Suite) (meme-suite.org) database was used. A single text file was generated containing each selected TaCKX gene and its homologous sequences from the reference genome and selected sequences of the Kontesa and Ostka cvs. and was uploaded to the MEME suite for motif conservation. A maximum of three numbers of motifs were selected for conservation analysis.

4.6. Identification of TaNAC Transcription Factor Binding Sites in Selected TaCKX GFMs

The promoter and cis-regulatory sequenced regions of selected TaCKX GFM from the Kontesa and Ostka cvs. were analyzed in the PlantTFDB v5.0 database to identify TaNAC binding sites and their corresponding TaNAC TFs.

4.7. NAC Domain Identification, Prediction of Protein Structure, and Phylogenetic Analysis

The protein sequences of the transcription factor JUNGBRUNNEN 1-like, NAC domain-containing protein 13-like, putative NAC domain-containing protein 94, protein BEARSKIN1-like, and NAC domain-containing protein 48-like were scanned in the InterProScan database (https://www.ebi.ac.uk/interpro/ accessed on 14 September 2023) to identify and confirm the presence of NAC domains in the selected TaNACs. For protein structure prediction and validation, SWISS-MODEL (https://swissmodel.expasy.org/ accessed on 18 October 2023) was used. Phylogenetic tree analysis was performed using MEGA v.11 software.

4.8. RNA Extraction and cDNA Synthesis

For expression analysis, the following tissue samples were collected: 5-day-old seedling roots, 5–6 cm long inflorescences, 0, 4, 7 and 14 days after pollination (DAP) spikes and accompanying flag leaves. All samples were frozen in liquid nitrogen prior to RNA extraction. Each sample was collected in three biological replicates, and each biological sample was measured in three technical replicates. Total RNA was extracted from all selected tissues and different time intervals using TRIzol RNA extraction reagent (Thermo Fisher Scientific) following the manufacturer’s protocol. RNA was quantified by Nanodrop (NanoDrop ND-1000) and integrity was checked by running 2 μL of RNA on a 2% agarose gel. The RNA was treated with DNase I to remove DNA contamination before proceeding with the synthesis of cDNA. The RevertAid First Strand cDNA Synthesis Kit (Thermo Fisher Scientific) was used to reverse transcribe 1 μg of RNA into cDNA following the manufacturer’s protocol. The 1 μL cDNA was further diluted to 20 μL for the final concentration to be used for RT-qPCR.

4.9. Quantitative RT-qPCR

Six TaNAC genes were subjected to the RT-qPCR assay (TaNAC94-like: XM_044560882.1, TaNAC JUNGBRUNNEN 1-like: XM_044546100.1, TaNAC13-like: XM_044594559.1, TaNAC48-like: XM_044503013.1, and TaNAC BEARSKIN1-like: XM_044472340: TaNAC2-5A AY625683). The primers were designed using the DNASTART SeqMAN pro Primer design option (Table S2) to amplify each selected gene. All RT-qPCR reactions were performed on iQ5 Cycler (BIO-RAD, Hercules, CA, USA) as described by Ogonowska et al. (2019) [22]. The PCR profile was followed as: initial denaturation and polymerase activation at 95 °C for 3 min, (95 °C for 20 s, 63 °C for 67 °C 20 s, 72 °C for 25 s) × 45 cycles, final extension at 72 °C for 5 min, and melting curve from 65 to 95 °C for 25 s per degree Celsius of increment. Each value is the mean representation of the three biological and three technical replicates. Ref-2 (ADP ribosylation factor 2) was used as a normalizer (internal control) and a comparative control for the relative expression of selected TaNACs in a two-standard curve method of RT-qPCR.

4.10. Statistical Analysis

For statistical analysis, one-way and two-way analysis of variance (ANOVA) tests were performed to determine the level of significant differences between the expression levels of the Kontesa and Ostka cvs. GraphPad Prism v8.0 software for Windows was used to perform these statistical data analysis tests. Data bars with statistically significant differences and having p-values ≤ 0.05, 0.01 and 0.001 were indicated by asterisks as *, **, and ***, respectively.

5. Conclusions

NAC transcription factors are one of the largest TF families in plants, and TaNAC GFMs have been known to regulate several physiological processes in bread wheat by interacting with sequences on promoters or upstream cis-regulatory sites. Similarly, TaCKX family members are important genes that encode CKX enzyme to regulate cytokinin concentration by their degradation and consequently influence wheat yield-related traits. Therefore, in this study, we focused on identifying important TaNAC genes that could be involved in the cis-regulation of TaCKX GFMs. These results provide useful information to further characterize these selected TaNAC GFMs for their role in root growth and development, grain productivity, leaf senescence, and response to various stresses.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/ijms25042027/s1.

ijms-25-02027-s001.zip (274.2KB, zip)

Author Contributions

Conceptualization, A.N.-O., A.I. and W.O.; methodology, A.I. and J.B.; software, A.I. and M.P.; validation, A.N.-O., W.O. and A.I.; formal analysis, A.I., J.B., M.P., W.O. and A.N.-O.; investigation, A.I.; data curation A.I., J.B. and M.P.; writing—original draft preparation, A.I.; writing—review and editing A.N.-O.; visualization W.O.; supervision, A.N.-O.; project administration, A.N.-O.; funding acquisition, A.N.-O. All authors have read and agreed to the published version of the manuscript.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

All data used/generated in this study have been included in the text and Supplementary Materials of this manuscript.

Conflicts of Interest

The authors declare no conflicts of interest.

Funding Statement

This research was funded by the National Science Centre, Poland, grant No. UMO-2020/37/B/NZ9/00744.

Footnotes

Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

References

  • 1.Dvorak J., Akhunov E.D. Tempos of Gene Locus Deletions and Duplications and Their Relationship to Recombination Rate During Diploid and Polyploid Evolution in the Aegilops-Triticum Alliance. Genetics. 2005;171:323–332. doi: 10.1534/genetics.105.041632. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2.Griffiths S., Sharp R., Foote T.N., Bertin I., Wanous M., Reader S., Colas I., Moore G. Molecular characterization of Ph1 as a major chromosome pairing locus in polyploid wheat. Nature. 2006;439:749–752. doi: 10.1038/nature04434. [DOI] [PubMed] [Google Scholar]
  • 3.Paux E., Roger D., Badaeva E., Gay G., Bernard M., Sourdille P., Feuillet C. Characterizing the composition and evolution of homoeologous genomes in hexaploid wheat through BAC-end sequencing on chromosome 3B. Plant J. 2006;48:463–474. doi: 10.1111/j.1365-313X.2006.02891.x. [DOI] [PubMed] [Google Scholar]
  • 4.Nadolska-Orczyk A., Rajchel I.K., Orczyk W., Gasparis S. Major genes determining yield-related traits in wheat and barley. Theor. Appl. Genet. 2017;130:1081–1098. doi: 10.1007/s00122-017-2880-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Shewry P.R., Underwood C., Wan Y., Lovegrove A., Bhandari D., Toole G., Mills E.C., Denyer K., Mitchell R.A. Storage product synthesis and accumulation in developing grains of wheat. J. Cereal Sci. 2009;50:106–112. doi: 10.1016/j.jcs.2009.03.009. [DOI] [Google Scholar]
  • 6.Dowla M.N.U., Edwards I., O’Hara G., Islam S., Ma W. Developing Wheat for Improved Yield and Adaptation Under a Changing Climate: Optimization of a Few Key Genes. Engineering. 2018;4:514–522. doi: 10.1016/j.eng.2018.06.005. [DOI] [Google Scholar]
  • 7.Hochman Z., Gobbett D.L., Horan H. Climate trends account for stalled wheat yields in Australia since 1990. Glob. Chang. Biol. 2017;23:2071–2081. doi: 10.1111/gcb.13604. [DOI] [PubMed] [Google Scholar]
  • 8.Jameson P.E., Song J. Cytokinin: A key driver of seed yield. J. Exp. Bot. 2015;67:593–606. doi: 10.1093/jxb/erv461. [DOI] [PubMed] [Google Scholar]
  • 9.Yamburenko M.V., Kieber J.J., Schaller G.E. Dynamic patterns of expression for genes regulating cytokinin metabolism and signaling during rice inflorescence development. PLoS ONE. 2017;12:e0176060. doi: 10.1371/journal.pone.0176060. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Cortleven A., Leuendorf J.E., Frank M., Pezzetta D., Bolt S., Schmülling T. Cytokinin action in response to abiotic and biotic stresses in plants. Plant Cell Environ. 2018;42:998–1018. doi: 10.1111/pce.13494. [DOI] [PubMed] [Google Scholar]
  • 11.Gao S., Xiao Y., Xu F., Gao X., Cao S., Zhang F., Wang G., Sanders D., Chu C. Cytokinin-dependent regulatory module underlies the maintenance of zinc nutrition in rice. New Phytol. 2019;224:202–215. doi: 10.1111/nph.15962. [DOI] [PubMed] [Google Scholar]
  • 12.Pavlů J., Novák J., Koukalová V., Luklová M., Brzobohatý B., Černý M. Cytokinin at the Crossroads of Abiotic Stress Signalling Pathways. Int. J. Mol. Sci. 2018;19:2450. doi: 10.3390/ijms19082450. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Schaller G.E., Street I.H., Kieber J.J. Cytokinin and the cell cycle. Curr. Opin. Plant Biol. 2014;21:7–15. doi: 10.1016/j.pbi.2014.05.015. [DOI] [PubMed] [Google Scholar]
  • 14.Chen L., Zhao J., Song J.C., Jameson P.E. Cytokinin dehydrogenase: A genetic target for yield improvement in wheat. Plant Biotechnol. J. 2019;18:614–630. doi: 10.1111/pbi.13305. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Nguyen H.N., Perry L., Kisiala A., Olechowski H., Emery R.J.N. Cytokinin activity during early kernel development corresponds positively with yield potential and later stage ABA accumulation in field-grown wheat (Triticum aestivum L.) Planta. 2020;252:76. doi: 10.1007/s00425-020-03483-2. [DOI] [PubMed] [Google Scholar]
  • 16.Brandizzi F. Divide, expand, differentiate–new insights on plant organ growth through cytokinin signaling. Plant J. 2019;97:803–804. doi: 10.1111/tpj.14261. [DOI] [PubMed] [Google Scholar]
  • 17.Kudo T., Kiba T., Sakakibara H. Metabolism and Long-distance Translocation of Cytokinins. J. Integr. Plant Biol. 2010;52:53–60. doi: 10.1111/j.1744-7909.2010.00898.x. [DOI] [PubMed] [Google Scholar]
  • 18.Jablonski B., Bajguz A., Bocian J., Orczyk W., Nadolska-Orczyk A. Genotype-Dependent Effect of Silencing of TaCKX1 and TaCKX2 on Phytohormone Crosstalk and Yield-Related Traits in Wheat. Int. J. Mol. Sci. 2021;22:11494. doi: 10.3390/ijms222111494. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Jabłoński B., Ogonowska H., Szala K., Bajguz A., Orczyk W., Nadolska-Orczyk A. Silencing of TaCKX1 Mediates Expression of Other TaCKX Genes to Increase Yield Parameters in Wheat. Int. J. Mol. Sci. 2020;21:4809. doi: 10.3390/ijms21134809. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Jablonski B., Szala K., Przyborowski M., Bajguz A., Chmur M., Gasparis S., Orczyk W., Nadolska-Orczyk A. TaCKX2.2 Genes Coordinate Expression of Other TaCKX Family Members, Regulate Phytohormone Content and Yield-Related Traits of Wheat. Int. J. Mol. Sci. 2021;22:4142. doi: 10.3390/ijms22084142. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Szala K., Ogonowska H., Lugowska B., Zmijewska B., Wyszynska R., Dmochowska-Boguta M., Orczyk W., Nadolska-Orczyk A. Different sets of TaCKX genes affect yield-related traits in wheat plants grown in a controlled environment and in field conditions. BMC Plant Biol. 2020;20:496. doi: 10.1186/s12870-020-02713-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22.Ogonowska H., Barchacka K., Gasparis S., Jablonski B., Orczyk W., Dmochowska-Boguta M., Nadolska-Orczyk A. Specificity of expression of TaCKX family genes in developing plants of wheat and their co-operation within and among organs. PLoS ONE. 2019;14:e0214239. doi: 10.1371/journal.pone.0214239. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Luo G., Shen L., Zhao S., Li R., Song Y., Song S., Yu K., Yang W., Li X., Sun J., et al. Genome-wide identification of seed storage protein gene regulators in wheat through coexpression analysis. Plant J. 2021;108:1704–1720. doi: 10.1111/tpj.15538. [DOI] [PubMed] [Google Scholar]
  • 24.Szala K., Dmochowska-Boguta M., Bocian J., Orczyk W., Nadolska-Orczyk A. Transgenerational Paternal Inheritance of TaCKX GFMs Expression Patterns Indicate a Way to Select Wheat Lines with Better Parameters for Yield-Related Traits. Int. J. Mol. Sci. 2023;24:8196. doi: 10.3390/ijms24098196. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Iqbal A., Bocian J., Hameed A., Orczyk W., Nadolska-Orczyk A. Cis-Regulation by NACs: A Promising Frontier in Wheat Crop Improvement. Int. J. Mol. Sci. 2022;23:15431. doi: 10.3390/ijms232315431. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26.Strader L., Weijers D., Wagner D. Plant transcription factors—Being in the right place with the right company. Curr. Opin. Plant Biol. 2021;65:102136. doi: 10.1016/j.pbi.2021.102136. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 27.Li J., Xie L., Tian X., Liu S., Xu D., Jin H., Song J., Dong Y., Zhao D., Li G., et al. TaNAC100 acts as an integrator of seed protein and starch synthesis exerting pleiotropic effects on agronomic traits in wheat. Plant J. 2021;108:829–840. doi: 10.1111/tpj.15485. [DOI] [PubMed] [Google Scholar]
  • 28.Shen L., Luo G., Song Y., Xu J., Ji J., Zhang C., Gregová E., Yang W., Li X., Sun J., et al. A novel NAC family transcription factor SPR suppresses seed storage protein synthesis in wheat. Plant Biotechnol. J. 2020;19:992–1007. doi: 10.1111/pbi.13524. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.A Chapman E., Orford S., Lage J., Griffiths S. Delaying or delivering: Identification of novel NAM-1 alleles that delay senescence to extend wheat grain fill duration. J. Exp. Bot. 2021;72:7710–7728. doi: 10.1093/jxb/erab368. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Mao C., He J., Liu L., Deng Q., Yao X., Liu C., Qiao Y., Li P., Ming F. OsNAC2 integrates auxin and cytokinin pathways to modulate rice root development. Plant Biotechnol. J. 2019;18:429–442. doi: 10.1111/pbi.13209. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.He X., Qu B., Li W., Zhao X., Teng W., Ma W., Ren Y., Li B., Li Z., Tong Y. The nitrate inducible NAC transcription factor TaNAC2-5A controls nitrate response and increases wheat yield. Plant Physiol. 2015;169:1991–2005. doi: 10.1104/pp.15.00568. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Li W., He X., Chen Y., Jing Y., Shen C., Yang J., Teng W., Zhao X., Hu W., Hu M., et al. A wheat transcription factor positively sets seed vigour by regulating the grain nitrate signal. New Phytol. 2019;225:1667–1680. doi: 10.1111/nph.16234. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Bailey T.L., Johnson J., Grant C.E., Noble W.S. The MEME suite. Nucleic Acids Res. 2015;43:W39–W49. doi: 10.1093/nar/gkv416. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Swinnen G., Goossens A., Pauwels L. Lessons from Domestication: Targeting Cis-Regulatory Elements for Crop Improvement. Trends Plant Sci. 2016;21:506–515. doi: 10.1016/j.tplants.2016.01.014. [DOI] [PubMed] [Google Scholar]
  • 35.Pompili V., Piazza S., Li M., Varotto C., Malnoy M. Transcriptional regulation of MdmiR285N microRNA in apple (Malus x domestica) and the heterologous plant system Arabidopsis thaliana. Hortic. Res. 2020;7:99. doi: 10.1038/s41438-020-0321-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Yokotani N., Hasegawa Y., Sato M., Hirakawa H., Kouzai Y., Nishizawa Y., Yamamoto E., Naito Y., Isobe S. Transcriptome analysis of Clavibacter michiganensis subsp. michiganensis-infected tomatoes: A role of salicylic acid in the host response. BMC Plant Biol. 2021;21:476. doi: 10.1186/s12870-021-03251-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37.Zhang Z., Wang H., Wu J., Jin Y., Xiao S., Li T., Liu X., Zhang H., Zhang Z., Su J., et al. Comprehensive transcriptome analysis of stem-differentiating xylem upon compression stress in Cunninghamia lanceolata. Front. Genet. 2022;13:843269. doi: 10.3389/fgene.2022.843269. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Ooka H., Satoh K., Doi K., Nagata T., Otomo Y., Murakami K., Matsubara K., Osato N., Kawai J., Carninci P., et al. Comprehensive Analysis of NAC Family Genes in Oryza sativa and Arabidopsis thaliana. DNA Res. 2003;10:239–247. doi: 10.1093/dnares/10.6.239. [DOI] [PubMed] [Google Scholar]
  • 39.Jones P., Binns D., Chang H.-Y., Fraser M., Li W., McAnulla C., McWilliam H., Maslen J., Mitchell A., Nuka G., et al. InterProScan 5: Genome-scale protein function classification. Bioinformatics. 2014;30:1236–1240. doi: 10.1093/bioinformatics/btu031. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Quevillon E., Silventoinen V., Pillai S., Harte N., Mulder N., Apweiler R., Lopez R. InterProScan: Protein domains identifier. Nucleic Acids Res. 2005;33:W116–W120. doi: 10.1093/nar/gki442. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.Guérin C., Dupuits C., Mouzeyar S., Roche J. Insights into Four NAC Transcription Factors Involved in Grain Development and in Response to Moderate Heat in the Triticeae Tribe. Int. J. Mol. Sci. 2022;23:11672. doi: 10.3390/ijms231911672. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42.Mao H., Li S., Wang Z., Cheng X., Li F., Mei F., Chen N., Kang Z. Regulatory changes in TaSNAC8-6A are associated with drought tolerance in wheat seedlings. Plant Biotechnol. J. 2019;18:1078–1092. doi: 10.1111/pbi.13277. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43.Mao X., Zhang H., Qian X., Li A., Zhao G., Jing R. TaNAC2, a NAC-type wheat transcription factor conferring enhanced multiple abiotic stress tolerances in Arabidopsis. J. Exp. Bot. 2012;63:2933–2946. doi: 10.1093/jxb/err462. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Xia N., Zhang G., Sun Y.-F., Zhu L., Xu L.S., Chen X.M., Liu B., Yu Y.-T., Wang X.-J., Huang L.L., et al. TaNAC8, a novel NAC transcription factor gene in wheat, responds to stripe rust pathogen infection and abiotic stresses. Physiol. Mol. Plant Pathol. 2010;74:394–402. doi: 10.1016/j.pmpp.2010.06.005. [DOI] [Google Scholar]
  • 45.Zhou W., Qian C., Li R., Zhou S., Zhang R., Xiao J., Wang X., Zhang S., Xing L., Cao A. TaNAC6s are involved in the basal and broad-spectrum resistance to powdery mildew in wheat. Plant Sci. 2018;277:218–228. doi: 10.1016/j.plantsci.2018.09.014. [DOI] [PubMed] [Google Scholar]
  • 46.Tang Y., Liu M., Gao S., Zhang Z., Zhao X., Zhao C., Zhang F., Chen X. Molecular characterization of novel TaNAC genes in wheat and overexpression of TaNAC2a confers drought tolerance in tobacco. Physiol. Plant. 2011;144:210–224. doi: 10.1111/j.1399-3054.2011.01539.x. [DOI] [PubMed] [Google Scholar]
  • 47.Wang B., Wei J., Song N., Wang N., Zhao J., Kang Z. A novel wheat NAC transcription factor, TaNAC30, negatively regulates resistance of wheat to stripe rust. J. Integr. Plant Biol. 2017;60:432–443. doi: 10.1111/jipb.12627. [DOI] [PubMed] [Google Scholar]
  • 48.Zhang N., Yuan S., Zhao C., Park R.F., Wen X., Yang W., Liu D. TaNAC35 acts as a negative regulator for leaf rust resistance in a compatible interaction between common wheat and Puccinia triticina. Mol. Genet. Genom. 2020;296:279–287. doi: 10.1007/s00438-020-01746-x. [DOI] [PubMed] [Google Scholar]
  • 49.Klopfenstein D.V., Zhang L., Pedersen B.S., Ramírez F., Vesztrocy A.W., Naldi A., Mungall C.J., Yunes J.M., Botvinnik O., Weigel M., et al. GOATOOLS: A Python library for Gene Ontology analyses. Sci. Rep. 2018;8:10872. doi: 10.1038/s41598-018-28948-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 50.Chen D., Chai S., McIntyre C.L., Xue G.-P. Overexpression of a predominantly root-expressed NAC transcription factor in wheat roots enhances root length, biomass and drought tolerance. Plant Cell Rep. 2017;37:225–237. doi: 10.1007/s00299-017-2224-y. [DOI] [PubMed] [Google Scholar]
  • 51.Wasson A.P., Richards R.A., Chatrath R., Misra S.C., Prasad S.V.S., Rebetzke G.J., Kirkegaard J.A., Christopher J., Watt M. Traits and selection strategies to improve root systems and water uptake in water-limited wheat crops. J. Exp. Bot. 2012;63:3485–3498. doi: 10.1093/jxb/ers111. [DOI] [PubMed] [Google Scholar]
  • 52.Qing C.H.I., Du L.Y., Wen M.A., Niu R.Y., Wu B.W., Guo L.J., Meng M.A., Liu X.L., Zhao H.X. MiR164-TaNAC14 module regulates root development and abiotic-stress tolerance of wheat seedlings. J. Integr. Agric. 2022;22:981–998. [Google Scholar]
  • 53.Long S.P., Ort D.R. More than taking the heat: Crops and global change. Curr. Opin. Plant Biol. 2010;13:240–247. doi: 10.1016/j.pbi.2010.04.008. [DOI] [PubMed] [Google Scholar]
  • 54.Tucker S.C., Grimes J. The inflorescence: Introduction. Bot. Rev. 1999;65:303–316. doi: 10.1007/BF02857752. [DOI] [Google Scholar]
  • 55.Sultana N. Ph.D. Thesis. Murdoch University; Perth, Australia: 2020. Characterization of TaNAC-S Gene in Australian Wheat Cultivars in Relation to Senescence and Nitrogen Stress Response. [Google Scholar]
  • 56.Sultana N., Islam S., Juhasz A., Ma W. Wheat leaf senescence and its regulatory gene network. Crop. J. 2021;9:703–717. doi: 10.1016/j.cj.2021.01.004. [DOI] [Google Scholar]
  • 57.Xia N., Zhang G., Liu X.-Y., Deng L., Cai G.-L., Zhang Y., Wang X.-J., Zhao J., Huang L.-L., Kang Z.-S. Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses. Mol. Biol. Rep. 2010;37:3703–3712. doi: 10.1007/s11033-010-0023-4. [DOI] [PubMed] [Google Scholar]
  • 58.Harrington S.A., Overend L.E., Cobo N., Borrill P., Uauy C. Conserved residues in the wheat (Triticum aestivum) NAM-A1 NAC domain are required for protein binding and when mutated lead to delayed peduncle and flag leaf senescence. BMC Plant Biol. 2019;19:407. doi: 10.1186/s12870-019-2022-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 59.Huang Q., Wang Y., Li B., Chang J., Chen M., Li K., Yang G., He G. TaNAC29, a NAC transcription factor from wheat, enhances salt and drought tolerance in transgenic Arabidopsis. BMC Plant Biol. 2015;15:268. doi: 10.1186/s12870-015-0644-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 60.Zhang Z., Liu C., Guo Y. Wheat Transcription Factor TaSNAC11-4B Positively Regulates Leaf Senescence through Promoting ROS Production in Transgenic Arabidopsis. Int. J. Mol. Sci. 2020;21:7672. doi: 10.3390/ijms21207672. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 61.International Wheat Genome Sequencing Consortium (IWGSC) Appels R., Eversole K., Stein N., Feuillet C., Keller B., Rogers J., Pozniak C.J., Choulet F., Distelfeld A., et al. Shifting the limits in wheat research and breeding using a fully annotated reference genome. Science. 2018;361:eaar7191. doi: 10.1126/science.aar7191. [DOI] [PubMed] [Google Scholar]
  • 62.Yates A.D., Allen J., Amode R.M., Azov A.G., Barba M., Becerra A., Bhai J., I Campbell L., Martinez M.C., Chakiachvili M., et al. Ensembl Genomes 2022: An expanding genome resource for non-vertebrates. Nucleic Acids Res. 2021;50:D996–D1003. doi: 10.1093/nar/gkab1007. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 63.Jin J., Tian F., Yang D.-C., Meng Y.-Q., Kong L., Luo J., Gao G. PlantTFDB 4.0: Toward a central hub for transcription factors and regulatory interactions in plants. Nucleic Acids Res. 2016;45:D1040–D1045. doi: 10.1093/nar/gkw982. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 64.Yu G., Hatta A., Periyannan S., Lagudah E., Wulff B.B. Wheat Rust Diseases: Methods and Protocols. Springer; Berlin/Heidelberg, Germany: 2017. Isolation of wheat genomic DNA for gene mapping and cloning; pp. 207–213. [DOI] [PubMed] [Google Scholar]
  • 65.Chung C.T., Niemela S.L., Miller R.H. One-step preparation of competent Escherichia coli: Transformation and storage of bacterial cells in the same solution. Proc. Natl. Acad. Sci. USA. 1989;86:2172–2175. doi: 10.1073/pnas.86.7.2172. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

ijms-25-02027-s001.zip (274.2KB, zip)

Data Availability Statement

All data used/generated in this study have been included in the text and Supplementary Materials of this manuscript.


Articles from International Journal of Molecular Sciences are provided here courtesy of Multidisciplinary Digital Publishing Institute (MDPI)

RESOURCES