ABSTRACT
Tomatoes are readily available and affordable vegetables that offer a range of health benefits due to their bioactive molecules, such as antioxidants and antimicrobials. In contrast to the widely recognized antioxidant properties of tomatoes, their antimicrobial properties remain largely unexplored. Here, we present our findings on the antimicrobial properties of tomato juice and peptides, namely, tomato-derived antimicrobial peptides (tdAMPs), in relation to their effectiveness against typhoidal Salmonella. Our research has revealed that tomato juice demonstrates significant antimicrobial properties against Salmonella Typhi, a pathogen that specifically affects humans and is responsible for causing typhoid fever. By employing computational analysis of the tomato genome sequence, conducting molecular dynamics simulation, and performing functional analyses, we have successfully identified two tdAMPs, namely, tdAMP-1 and tdAMP-2. These tdAMPs have demonstrated potent antimicrobial properties by effectively disrupting bacterial membranes. The efficacy of tdAMP-2 is shown to be more effective than tdAMP-1. The efficacy of tdAMP-1 and tdAMP-2 has been demonstrated against drug-resistant S. Typhi, as well as hyper-capsular S. Typhi variants that possess hypervirulent characteristics, which are presently circulating in countries with endemicity. Tomato juice, along with the two tdAMPs, has demonstrated effectiveness against uropathogenic Escherichia coli as well. This underscores their potential as viable agents in combating certain Gram-negative pathogens. This study provides valuable insights into the development of effective and sustainable public health strategies that utilize tomato and its derivatives as lifestyle interventions.
IMPORTANCE
In this study, we investigate the antimicrobial properties of tomato juice, the most widely consumed affordable vegetables, as well as tomato-derived antimicrobial peptides, in relation to their effectiveness against foodborne pathogens with an emphasis on Salmonella Typhi, a deadly human-specific pathogen.
KEYWORDS: Salmonella, antimicrobials, antimicrobial peptides, tomato, Gram-negative bacteria, enteric pathogens
INTRODUCTION
Tomatoes, scientifically known as Solanum lycopersicum, are highly popular vegetables globally, owing to their exceptional taste and wide range of applications in various culinary traditions. The nutritional composition of tomatoes, including their abundance of beneficial compounds like lycopene, polyphenols, and vitamins, has been extensively studied and linked to a wide range of health advantages (1–6). Additionally, tomatoes have the advantage of being able to thrive in a wide range of regions with varying climate conditions. According to the 2021 report by the Food and Agriculture Organization of the United Nations (faostat@fao.org), Asia is the leading global producer of tomatoes, representing 64.8% of the total global tomato production. Europe, Africa, North America, and South America account for 13.3%, 11.6%, 5.98%, and 3.95% of the total tomato production, respectively.
Considerable research has been dedicated to investigating the antioxidant properties of various substances. In contrast, a limited number of studies have observed that peptides obtained from extracts of seeds, leaves, stems, and peels exhibit antimicrobial activity against foodborne pathogens (7–9). Antimicrobial peptides (AMPs) are naturally occurring compounds also found in plants that play a crucial role in the innate immune system’s ability to combat infections within their environment (10–12). It has been found that tomatoes possess AMPs, which are recognized for their strong and wide-ranging activities (13–16). The AMPs are cationic, amphipathic peptides that are found in animals and plants. They exhibit rapid antimicrobial activity by directly targeting the cell membrane (16, 17). The amphipathicity of AMPs allows for their interaction with the negatively charged head groups of the lipid bilayer in the membrane. This interaction is followed by their penetration into the membrane, resulting in the formation of pores. These pores ultimately lead to membrane permeabilization and subsequent bacterial death (18, 19). In addition to their direct antimicrobial properties, AMPs have the ability to modulate immune responses by facilitating the recruitment and activation of immune cells, as well as stimulating the release of cytokines and chemokines (19).
The global prevalence of various enteric pathogens poses a substantial risk to our collective well-being. Salmonella enterica serovar Typhi (S. Typhi), the causative agent of typhoid fever, which is a human-specific pathogen, has been widely acknowledged as the primary cause of mortality resulting from enteric pathogen infections (20, 21). Every year, there are 21 million reported cases of typhoid fever, resulting in 200,000 fatalities globally. Despite the availability of typhoid vaccines, numerous developing countries continue to face substantial obstacles in accessing these vital resources. Additionally, the issue of antibiotic resistance poses a significant risk, particularly among malnourished children (22–27).
In a study conducted by Allen et al. (28), it was found that a significant proportion of children (aged 6–23 months) residing in 64 developing countries, specifically 45.7%, do not include vegetables or fruits in their diet, indicating a prevalence of malnutrition in this population. In Pakistan, there has been a significant emergence and global spread of extensively drug-resistant S. Typhi, particularly in recent years. It is worth noting that in 2018, approximately 65% of children in the country did not consume an adequate amount of vegetables or fruits, which was the highest across Asian countries, with India following closely (28). This correlation may be attributed to the association between the consumption of fruits and vegetables and the enhancement of immunity and antibacterial activity (26–28).
Given that the tomato fruit is more frequently consumed by individuals compared to other parts of the plant where antimicrobial activities have been reported (7–9), it would be more practical to assess the antimicrobial properties of tomato juice as a potential approach for lifestyle interventions. In this study, we investigated the antimicrobial properties of tomato juice, the most widely consumed affordable vegetables, as well as tomato-derived antimicrobial peptides (tdAMPs), in relation to their effectiveness against foodborne pathogens with an emphasis on S. Typhi.
RESULTS
Tomato juice exhibits significant antimicrobial activity against S. Typhi
To evaluate the antimicrobial properties of the tomato fruit, we proceeded by grinding fresh tomatoes to produce tomato juice. Subsequently, we conducted an incubation experiment wherein S. Typhi was exposed to tomato juice. A notable reduction in the colony-forming units (CFUs) of S. Typhi was observed at the 2-hour mark following incubation, in comparison to the control group treated with phosphate-buffered saline (PBS) (Fig. 1A). In addition, it was observed that S. Typhi was effectively eliminated within a 24-hour incubation period (Fig. 1B), providing evidence of the antimicrobial properties exhibited by tomato juice. The pH of the tomato juice used in the study was determined to be approximately 4.5. To rule out the possibility that an acidic environment plays a role in S. Typhi growth inhibition, we carried out comparative growth tests in media with pH levels of 4.5 and 7.4. We found that the growth of S. Typhi was similar under both pH conditions (Fig. S1), indicating that the observed antimicrobial properties of tomato juice on S. Typhi bacteria are unlikely due to its acidic pH.
Fig 1.
Tomato juice exhibits significant antimicrobial activity against S. Typhi. (A–C) CFU assays of S. Typhi incubated with tomato juice at 2 (A) and 24 hours (B), or S. Typhi incubated with tomato juice that had been filtered using a 10-kDa filter, also for 2 and 24 hours (C). Data represent mean ± standard deviation of three independent experiments. Two-tailed Student t-tests between mock-treated and tomato juice-incubated S. Typhi were performed (*P < 0.05, **P < 0.01, ***P < 0.001). See also Fig. S1.
To determine the bioactive molecules responsible for the antimicrobial activity, the tomato juice underwent filtration using a column with a 10-kDa cutoff. We observed that the antimicrobial activity of the pass-through fraction was comparable to that of the total tomato juice, as shown in Fig. 1C. This suggests that the observed antimicrobial activity can be attributed to bioactive molecules that are smaller than 10 kDa.
Tomato-derived AMPs exhibit significant antimicrobial activity against S. Typhi
To identify potential candidates for antimicrobial peptides, a novel unbiased analysis was conducted on the complete genome sequence of Solanum lycopersicum. Out of the total of 37,658 genes that were examined, our attention was directed toward 707 genes that encode proteins with a length of less than 100 amino acids. This analysis was conducted using two AMP prediction tools, namely, CAMPR3 (29) and AMPpred (30). We have selected a group of candidates from AMPpred whose antibacterial probability exceeds 0.9, with a maximum probability of 1. This selection process has yielded the top 20 candidates, as shown in Fig. 2A and Table S1. After careful evaluation of the candidates, we have identified the two most promising candidates (YP_008563122.1 and XP_025885552.1) that have tested positive for both CAMPR3 and AMPpred. These candidates have been designated as tdAMP-1 and tdAMP-2, respectively. Furthermore, we have identified a gene consisting of five isotypes among the top 20 candidates. These isotypes possess a neutral isoelectric point (pI), which is in contrast to the typical basic pI characteristic observed in canonical AMPs. Therefore, we proceeded to select two out of the five isotypes of the gene, which we have designated as tdAMP-3 (XP_004247438.1) and tdAMP-4 (XP_004247441.1) (Table 1; Table S1).
Fig 2.
Tomato-derived AMPs exhibit significant antimicrobial activity against S. Typhi. (A), Our data analysis pipeline depicting selection of tdAMP candidates under 100 amino acids (aa). from Solanum lycopersicum’s whole-genome sequence. (B–I) Growth curves of S. Typhi treated with tdAMP-1 (B), tdAMP-2 (D), tdAMP-3 (F), or tdAMP-4 (H) at the indicated concentrations. Minimum inhibitory concentration (MIC) was determined where no growth was found after 24 hours. CFU assays of S. Typhi incubated for 24 hours with tdAMP-1 (C), tdAMP-2 (E), tdAMP-3 (G), or tdAMP-4 (I). Data represent mean ± SD of three independent experiments. Two-tailed Student t-tests between mock- and tdAMP-treated S. Typhi were performed (ns, not significant, *P < 0.05, **P < 0.01, ***P < 0.001, ****P < 0.0001). See also Fig. S2 and Table S1. Created with BioRender.
TABLE 1.
Summary of tdAMPs used in this study
| tdAMP | Sequence | Length | M.W. | pI |
|---|---|---|---|---|
| tdAMP-1 | MKIRASVRKICEKCRLIRRRGRIIVICSNPRHKQRQG | 37 | 4.5 kDa | 12.4 |
| tdAMP-2 | MMKGKNEANLKSKKRRICSGKLGRFLKEQRGRLYIVRRCVVMLLCWHD | 48 | 5.8 kDa | 10.6 |
| tdAMP-3 | MSDEEVVDPKATLEVSCKPKCVRQLKEYQACTKRIEGDESGHKHCTGQYFDYWHCIDKCVAAKLFDHLK | 69 | 8 kDa | 6.5 |
| tdAMP-4 | MSDEEVVDPKATMEVSCKPKCVRQLKDYQACTRRIEGDESGSKHCTGQYFDYWQCIDKCVAPKLFEKLK | 69 | 8 kDa | 6.8 |
To assess the effectiveness of the four AMP candidates (tdAMP-1, tdAMP-2, tdAMP-3, and tdAMP-4), we conducted an evaluation of their minimal inhibitory concentrations (MICs) and minimal bactericidal concentrations (MBCs) against S. Typhi. Both tdAMP-1 and tdAMP-2 demonstrated significant growth inhibition and killing of S. Typhi. Notably, tdAMP-2 (MIC = 16 µg/mL and MBC = 32 µg/mL) exhibited twice the effectiveness of tdAMP-1 (MIC = 32 µg/mL and MBC = 64 µg/mL) (Fig. 2B through E; Table 2). The determined MIC and MBC values of Melittin, used as a positive control AMP that is found in vee venom, were 16 and 64 µg/mL, respectively (Table 2). In contrast, tdAMP-3 and tdAMP-4 did not demonstrate any detectable growth inhibitory or bactericidal effects on S. Typhi at all tested concentrations (Fig. 2F through I). Moreover, we observed that the growth of S. Typhi was significantly enhanced in the presence of 64 µg/mL of tdAMP-3 or tdAMP-4 (Fig. 2G and I), which implies that S. Typhi might have the ability to utilize these peptides as a nutritional source for their growth. These results collectively indicate that tdAMP-1 and tdAMP-2 are effective antimicrobial peptides, whereas tdAMP-3 and tdAMP-4 are not.
TABLE 2.
Minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) of tdAMP-1 and tdAMP-2 against the indicated straina
| Strain | Antibiotics | MIC (µg/mL) | MBC (µg/mL) |
|---|---|---|---|
| S. Typhi | tdAMP-1 | 32 | 64 |
| tdAMP-2 | 16 | 32 | |
| tdAMP-3 | ND | ND | |
| tdAMP-4 | ND | ND | |
| Ciprofloxacin | 0.004 | 0.016 | |
| Melittin | 16 | 64 | |
| S. Typhi gyrA S83F | tdAMP-1 | 32 | 64 |
| tdAMP-2 | 16 | 32 | |
| Ciprofloxacin | 0.125 | 0.5 | |
| Acapsular S. Typhi (∆tviBC) | tdAMP-1 | 32 | 64 |
| tdAMP-2 | 16 | 32 | |
| Hypercapsular S. Typhi (tviE P263S) | tdAMP-1 | 32–64 | 64 |
| tdAMP-2 | 32 | 32 | |
| S. Typhimurium LT2 | tdAMP-1 | 32–64 | 64 |
| tdAMP-2 | 32–64 | 64 | |
| Uropathogenic E. coli CI5 | tdAMP-1 | 64 | 64 |
| tdAMP-2 | 32–64 | 32–64 | |
| Uropathogenic E. coli J96 | tdAMP-1 | 64 | 64 |
| tdAMP-2 | 32 | 64 |
Note that N-minimal medium was used in this study. ND, not determined.
All four tdAMPs were chemically produced and purified using high-performance liquid chromatography (HPLC), including tdAMP-1 and tdAMP-2. Given that tdAMP3 and tdAMP4 did not exhibit antimicrobial activity, it seems doubtful that the remaining trifluoroacetate (TFA) salt was the primary cause of tdAMP-1 and tdAMP-2’s antibacterial properties. To ensure that the observed antibacterial properties of tdAMP-1 and tdAMP-2 are not attributable to residual TFA salt, we dialyzed these peptides with 20 mM of acetate for 24 hours using a 1-kDa dialysis membrane and tested them for antimicrobial activity. The antibacterial activities of dialyzed tdAMP-1 and tdAMP-2 against S. Typhi were similar (Fig. S2A through D). The final acetate concentration ranged from 0.25 mM (for 8 µg/mL of tdAMPs) to 2 mM (for 64 µg/mL of tdAMPs). We also confirmed that these acetate concentrations have no influence on S. Typhi growth (Fig. S2E).
tdAMP-1 and tdAMP-2 are effective against drug-resistant, acapsular, or hyper-capsular/hypervirulent S. Typhi variants
Ciprofloxacin is the primary antibiotic used for the treatment of typhoid fever in regions where the prevalence of the disease is high. Nevertheless, there have been reports of resistance to it, and a frequently observed clinical mutation that leads to ciprofloxacin resistance is gyrA S83F (31). To evaluate the efficacy of tdAMP-1 and tdAMP-2 against drug-resistant S. Typhi, we employed S. Typhi strains carrying gyrA S83F mutation. The presence of the S. Typhi gyrA S83F mutation was confirmed through sequencing. It was consistently observed that there was a 32-fold increase in ciprofloxacin resistance (Table 2). Based on our investigation using the drug-resistant strain, it has been determined that both tdAMP-1 and tdAMP-2 exhibit equal efficacy against S. Typhi gyrA S83F and WT S. Typhi (Fig. 3A through D; Table 2).
Fig 3.
tdAMP-1 and tdAMP-2 are effective against drug-resistant, acapsular, or hyper-capsular/hypervirulent S. Typhi variants. (A–L) Growth curves and CFU assay results of drug-resistant S. Typhi (A–D), acapsular S. Typhi (E–H), and hyper-capsular/hypervirulent S. Typhi (I–L) treated with tdAMP-1 or tdAMP-2 at the indicated concentrations. Data represent mean ± SD of three independent experiments. Two-tailed Student t-tests between mock- and tdAMP-treated S. Typhi were performed (ns, not significant, *P < 0.05, **P < 0.01, ***P < 0.001, ****P < 0.0001).
We next explored whether tdAMP-1 and tdAMP-2 are also effective against capsular variants. Many bacterial pathogens possess capsular polysaccharides as a crucial virulence determinant, providing them with resistance against the host’s innate immune system, antibiotics, and AMPs (32). These capsular bacteria leverage this advantage to ensure their survival in the host, and this phenomenon has been associated with hypervirulence (33). To assess the efficacy of tdAMP-1 and tdAMP-2 against hyper-capsular bacteria, we have selected hyper-capsular/hypervirulent S. Typhi strains that are currently prevalent in endemic regions (34). Both tdAMP-1 and tdAMP-2 demonstrated efficacy against acapsular (Fig. 3E through H) and hyper-capsular/hypervirulent S. Typhi strains (Fig. 3I through L; Table 2). These results indicate that the tdAMPs exhibit bactericidal activity against S. Typhi, irrespective of the presence or absence of the Vi capsule.
Tomato juice, tdAMP-1, and tdAMP-2 induce membrane permeabilization
To investigate the potential mechanism underlying the antimicrobial activity of tomato juice and tdAMPs, we conducted a study on membrane permeabilization. To obtain a deeper understanding of the interaction between tdAMPs and bacterial membranes, as well as to analyze the molecular-level binding affinity disparity between tdAMP-1 and tdAMP-2, we utilized molecular dynamics. This computational technique allows for the simulation of AMPs' interaction with bacterial membranes.
To prepare for the simulations, we initially made predictions on the structures of tdAMP-1 and tdAMP-2 using AlphaFold v2 (35). These predicted structures were then employed as inputs for the molecular dynamics (MD) simulations, as shown in Fig. 4A. The tdAMP-1, tdAMP-2, or Melittin was applied to the model membrane, which mimics a bacterial membrane. A simulation was conducted for a duration of 500 ns, with three iterations. The tdAMP-1, tdAMP-2, and Melittin exhibited stable binding to the model membrane over a duration of 500 ns (Fig. 4B through D). Consequently, we proceeded to evaluate the strength of interaction between the tdAMPs and the model membrane by analyzing the hydrogen bonds formed between them. The tdAMP-2 demonstrated a greater than 1.5-fold increase in affinity for the bacterial membrane in comparison to tdAMP-1 (Fig. 4E and F), thereby providing support for the higher antimicrobial activity of tdAMP-2 over tdAMP-1 (Fig. 2 and 3). The residues R19/R20 were found to be crucial for the stable interaction in the case of tdAMP-1, while R15/R16/R30/R37/R38 played a significant role in the stable interaction of tdAMP-2 (Fig. 4G and H). Consistent with the findings obtained from the MD simulations (Fig. 4A through H), we observed that tdAMP-1, tdAMP-2, and tomato juice caused membrane permeabilization following a 45-minute incubation period (Fig. 4I and J). As propidium iodide (PI) stains bacteria when both their outer and inner membranes are damaged, the results indicate that tomato juice and tdAMPs possess bactericidal activity through the disruption of bacterial membranes.
Fig 4.
Tomato juice, tdAMP-1, and tdAMP-2 induce membrane permeabilization. (A–C) Molecular dynamics simulation of tdAMP-1 and tdAMP-2. The structures of tdAMP-1 and tdAMP-2 were predicted by AlphaFold v2 (A). Interactions of tdAMP-1 (B), tdAMP-2 (C), or Melittin (D) with the model membrane-mimicking bacterial membrane were shown. Green, backbone of tdAMP-1, tdAMP-2, and Melittin; red, phosphate group of lipids. (E–F) Counts of hydrogen bonds formed between the indicated tdAMP and the model membrane. (G–H) Heatmaps of hydrogen bonds formed between each amino acid of the indicated tdAMP (X-axis) and the model membrane by time (Y-axis). (I–J) Tomato juice, tdAMP-1, or tdAMP-2 induced membrane permeabilization evaluated by bacterial live/dead staining. SYTO9 (green) represents live bacteria, while PI (propidium iodide, red) represents dead bacteria. (I) Representative fluorescence microscopy images of bacterial cells. Ten microliters of S. Typhi (106 CFU of bacteria) was added to 90 µL of tomato juice, or 90 µL of PBS containing 64 µg/mL of tdAMPs or 64 µg/mL of Melittin. After incubating at 37°C for 45 minutes, the bacteria were stained and analyzed. Scale bars, 20 µm. (J) Quantification results of three independent experiments associated with I. Data represent mean ± SD of three independent experiments. Two-tailed Student t-tests between PBS and tomato juice, PBS and tdAMP-treated, or PBS and Melittin-treated S. Typhi were performed (***P < 0.001, ****P < 0.0001).
tdAMP-1, tdAMP-2, and tomato juice exhibit antimicrobial properties against various enteric pathogens
To assess the suitability of tomato juice and tdAMPs for addressing other enteric pathogens, we conducted tests on various strains including S. Typhimurium and two uropathogenic E. coli (UPEC) strains (E. coli CI5 and E. coli J96) (Fig. 5). S. Typhimurium is a prominent strain of non-typhoidal Salmonella that is known to cause acute gastroenteritis, but it is typically not considered to be life threatening for individuals (36). UPEC is recognized as the causative agent of urinary tract infections (UTIs), a condition that can result in medical complications if not promptly addressed (37–39). UTIs are among the common infectious diseases in developed countries. We found that tomato juice inhibited the growth of S. Typhimurium and UPEC strains (Fig. 5). After 24 hours of incubation, none of the tested strains were recovered (Fig. 5B, D, and F). Similarly, we found that the peptides, tdAMP-1 and tdAMP-2, were effective against S. Typhimurium, E. coli CI5, and E. coli J96 in MIC and MBC testing (Table 2). The findings collectively suggest that both tdAMPs and tomato juice exhibit effectiveness against typhoidal/non-typhoidal Salmonella and UPEC strains.
Fig 5.
tdAMP-1, tdAMP-2, and tomato juice exhibit antimicrobial properties against various enteric pathogens. (A–F) Growth curves and CFU assay results of S. Typhimurium (A–B), uropathogenic E. coli CI5 (C–D), and uropathogenic E. coli J96 (E–F) incubated with tomato juice. Data represent mean ± SD of two to three independent experiments.
DISCUSSION
In this study, we have identified antimicrobial properties in tomato juice, a widely consumed vegetable known for its popularity and affordability globally. Our research specifically focused on its effectiveness against S. Typhi, S. Typhimurium, and uropathogenic E. coli, as illustrated in Fig. 1 and 5. Furthermore, through computational and functional analyses, our study has identified two tomato-derived antimicrobial peptides tdAMP1 and tdAMP2 that demonstrate antimicrobial properties against a range of enteric pathogens, including typhoidal Salmonella (S. Typhi), non-typhoidal Salmonella (S. Typhimurium), and uropathogenic E. coli strains (Fig. 2; Table 2).
Drug-resistant enteric bacteria, including S. Typhi, have been observed to spread (40–43). We tested the efficacy of tdAMP-1 and tdAMP-2 against one of the most common forms of drug-resistant S. Typhi in this investigation. Based on our findings with S. Typhi bearing gyrA S83F, we discovered that tdAMP-1 and tdAMP-2 have equivalent efficacy against drug-susceptible and drug-resistant S. Typhi (Fig. 3; Table 2), emphasizing their significance and potential applicability.
Many bacterial pathogens possess capsular polysaccharides as a critical virulence factor, enabling them to evade the host’s innate immune system, antibiotics, and AMPs (32). Multiple studies have been conducted on capsulated bacterial pathogens, such as Klebsiella pneumoniae and Acinetobacter baumannii, which have provided evidence of the presence of capsular variants (33, 44–49). Intriguingly, we have observed similar adaptations in S. Typhi (34). These findings suggest a parallel evolution of capsulated pathogens. Therefore, we conducted an investigation to determine the efficacy of tdAMP-1 and tdAMP-2 against capsular variants. For the purpose of this investigation, we have chosen hyper-capsular/hypervirulent strains of S. Typhi that are currently prevalent in endemic regions (34). We found that both tdAMP-1 and tdAMP-2 demonstrated antimicrobial properties against acapsular and hyper-capsular/hypervirulent S. Typhi strains (Fig. 3; Table 2), underscoring their importance and potential utility against capsule variants.
The MD simulation is a computational technique that allows for the real-time analysis of atomic movements. It has emerged as a valuable tool for studying the atomic-level interactions between AMPs and model membranes. In our study, we conducted MD simulations to investigate the binding affinity of tdAMP-1 and tdAMP-2 with a bacterial model membrane. Our findings indicate that there is a significant difference in binding affinity between tdAMP-1 and tdAMP-2, with tdAMP-2 exhibiting a greater than 1.5-fold higher affinity for bacterial membranes than that of tdAMP-1 (Fig. 4A through H). This difference in binding affinity is in agreement with the variance in membrane permeabilization and antimicrobial activity (Fig. 4I and J; Fig. 2), which is widely recognized as a characteristic feature of AMPs acting on bacterial membranes (50–53).
Based on the fact that only four tdAMP candidates were screened with two tdAMPs with characterizations, it is reasonable to speculate that there may be many more tdAMPs present in tomato fruit. Conducting additional research will provide a comprehensive understanding of the antimicrobial properties of tomatoes, thereby making a valuable contribution to enhancing public health. It is worth emphasizing that this type of research provides valuable information not just because of incomplete or imperfect annotations of the whole-genome sequence of tomato but also because existing annotations are for their expected roles within plants rather than their impacts in humans.
In summary, this study offers valuable insights into the potential utilization of tomatoes as a natural antimicrobial food source for the promotion of public health. Given their widespread popularity and cost effectiveness, tomatoes possess considerable potential as alternative antimicrobial agents within lifestyle interventions.
MATERIALS AND METHODS
Prediction and synthesis of tdAMPs
The whole-genome sequence of Solanum lycopersicum (GCF_000188115.4) was used to collect the genes under 100 amino acids. The resulting 707 genes were analyzed with IPC (54) for calculating molecular weight and pI, CAMPR3 (29) and AMPpred (30) for AMP prediction. All tdAMP candidates (tdAMP-1, 2, 3, and 4) were chemically synthesized by GL Biochem and purified by high-performance liquid chromatography. When indicated, two tdAMPs that showed antimicrobial activity, tdAMP-1 and tdAMP-2 (0.64 mg/mL), were dialyzed with 20 mM of acetate for 24 h using a 1-kDa dialysis membrane (Spectra/Por®6 Dialysis Membrane, Spectrum Labs, cat#: 132636T). The antibacterial activity of the resultant tdAMPs was tested. In the bacterial cultures used for MIC and MBC testing, the final acetate concentration ranged from 0.25 mM (for 8 µg/mL of tdAMPs) to 2 mM (for 64 µg/mL of tdAMPs).
Tomato juice preparation
Heirloom and Campari tomatoes, which are between mature green and breaker (tomatoes starting to change colors), were ground with a homogenizer and filtered with two sterilized 100-µm nylon mesh layers. The filtrate was centrifuged for 30 min at 20,000 × g at 4°C to remove residual pulps and ground cells and stored at −80°C until use.
Bacteria strains
S. Typhi ISP2825 (SB2201) (55), S. Typhi ΔtviBC (SB2203), hyper-capsular S. Typhi (JS0047), S. Typhi gyrA S83F (designated as JS0062), S. Typhimurium LT2, E. coli CI5, and E. coli J96 were used in this study. Bacteria were grown overnight in 2 mL of Luria–Bertani (LB) medium at 37°C prior to use. JS0062 was constructed as previously described with minor modifications (56, 57). Briefly, the suicide vector pSB890 was digested with BamHI-HF (NEB, cat# R3136S) and NotI-HF (NEB, cat# R3189S). Inserts were amplified by PCR reactions using Herculase II Fusion DNA Polymerase (Invitrogen, cat# 600679) with primers (F1: 5′-taaaaagccccaccgcggtggcggcccgggtatacacgggaggtattgattttccag-3′, R1: 5′-ggtgtcatacactgcgaaatcgccgtggggatg-3′, F2: 5′-catccccacggcgatttcgcagtgtatgacacc-3′, R2: 5′-gtaagtgaactgcagcccgggggatcgcgcgaatgtacactttgccacgac-3′). The digested vector and two inserts were Gibson assembled (T5 exonuclease, NEB cat# M0363S; Phusion polymerase, NEB cat# M0530S; Taq DNA ligase, NEB cat# M0208L) to generate pSB890 gyrA S83F plasmid (designated as pJS0296). pJS0296 was transformed into E. coli ß2163 ∆nic35 for conjugation with S. Typhi and subsequently underwent homologous recombination. The strain was verified by Sanger sequencing through the Cornell Institute Biotechnology Resource Center Genomics Facility.
Minimum inhibitory concentration and minimum bactericidal concentration determination
The MIC and MBC assays were conducted according to the CLSI guidelines (https://clsi.org), with minor modifications made to accommodate the specific conditions for the bacterial strains utilized in this study, including the use of tomato juice and acidic culture conditions. Each bacterial culture (100 µL) was added to 2 mL of PBS to measure the optical density (OD600nm). Each bacterial sample was further diluted to 1 × 105 CFU of bacteria in 10 µL. Twofold serial diluted tdAMP in a range from 0 to 64 µg/mL in 90 µL of N-minimal medium [5 mM of KCl, 7.5 mM of (NH4)2SO4, 0.5 mM of K2SO4, 1 mM of KH2PO4, 10 µM of MgCl2, 38 mM of glycerol, 0.2% glucose, 0.1% casamino acids, and 50 mM of Tris/MES (2-(N-morpholino)ethanesulfonic acid) pH 7.4] or tomato juice was added into a 96-well plate, respectively. When S. Typhi was cultured, 0.005% tryptophan was also added to the media. Ten microliters (1 × 105 CFU of bacteria in 10 µL) was added into the well containing tdAMP or tomato juice. Empty wells were filled with 100 µL of MilliQ water to prevent dehydration. OD600nm was measured at 37°C with 30-min intervals for 24 hours. The MBC was determined by plating serially diluted samples that were harvested 24 hours after incubation. The MBC value was determined in instances where no bacteria were detected, as observed in all three independent experiments. The colonies were counted the following day. For the bactericidal activities determined in tomato juice, each bacterial culture (100 µL) was added to 2 mL of PBS to measure the OD600nm. Each bacterial sample was further diluted to 1 × 103 CFU of bacteria in 10 µL. Ten microliters (1 × 103 CFU of bacteria) of the diluted bacterial culture was added to each of the 1.5-mL microcentrifuge tubes containing 1 mL of tomato juice, and they were incubated for 2 and 24 hours. The colonies were counted the following day.
Molecular dynamics simulation
The input structures of tdAMP-1 and tdAMP-2 were predicted by Alphafold v2 (35). The model membrane-mimicking bacterial membrane was constructed using CHARMM-GUI with a CHARMM36 force field (58, 59). tdAMP-1, tdAMP-2, or Melittin (PDB: 6DST) was placed onto the model membrane and simulated using NAMD 3.0 (60) for 500 ns with three iterations. The model membrane was composed of PPPE (1-palmitoyl- 2-palmitoleoyl-phosphatidylethanolamine):PVPG (1-palmitoyl-2-vacenoyl-phosphatidylglycerol):PVCL2 (1,10-palmitoyl-2,20-vacenoyl cardiolipin)=16:4:1 (molar ratio). Note that the model membrane of tdAMP-2 contained a lipid concentration four times higher than that of tdAMP-1. This disparity is attributed to the larger spatial occupancy of tdAMP-2 compared to tdAMP-1, which is a result of its unique structural characteristics. The molar ratio of lipids remains consistent. The MD simulations were conducted using a 150-mM NaCl solution at a temperature of 310 K (equivalent to 37°C). The simulations were performed under constant particle number, pressure, and temperature (NPT) conditions. The water thickness was set to 20 Å using the TIP3P model. The system was neutralized using Na+ ions and subsequently equilibrated through a six-step process, which included energy minimization. Two femtoseconds per step were implemented for 500 nanoseconds of the production process. The analysis of hydrogen bonds formed between tdAMP-1 or tdAMP-2 and the model membrane was conducted using UCSF Chimera software (54).
Live/dead staining
Bacteria were grown overnight in 2 mL of LB medium at 37°C, and 100 µL of bacterial culture was added to 2 mL of PBS to measure the OD600nm. Bacteria corresponding to 1 × 108 CFU/mL of bacteria was collected from the diluted sample, re-suspended to 108 CFU/mL of bacteria, and 10 µL (106 CFU of bacteria in 10 µL) was added into 90 µL of PBS including 64 µg/mL of tdAMP-1, tdAMP-2, Melittin, or 90 µL of tomato juice. After incubating at 37°C for 45 minutes, the bacteria were stained with LIVE/DEAD BacLight Bacterial Viability Kit (Invitrogen, cat# L7012) for 15 minutes at 37°C. Ten microliters of sample was placed on a cover glass, imaged using a BZ-X810 (Keyence) microscope, and quantified with BZ-X810 image analyzer using Plan Fluorite 20X LD PH (BZ-PF20LP) objective.
Statistical analysis
Data were tested for statistical significance with the GraphPad Prism software. The number of replicates for each experiment and the statistical test performed are indicated in the figure legends.
ACKNOWLEDGMENTS
This work was supported in part by the USDA/NIFA Hatch Project 1017170 to J.S. The funders had no influence on the study design, data analysis, or decision to submit the article for publication.
R.S.K. executed the experiments, interpreted the results (Fig. 1 to 5 MIC assays, Fig. 5; Table 2 MIC assays), and wrote the manuscript. G.Y.L. conceptualized this research, executed the experiments (Fig. 2 to 5 Computational analyses and MBC assays and Fig. 4), interpreted the results, and wrote the manuscript. S.L. prepared the tomato juice and executed the tomato juice pilot experiments. J.S. conceptualized this research, acquired the funding, interpreted the results, and wrote the manuscript.
Contributor Information
Jeongmin Song, Email: jeongmin.song@cornell.edu.
Adelumola Oladeinde, US Department of Agriculture, Washington, DC, USA.
DATA AVAILABILITY
The published article includes all datasets generated during this study.
SUPPLEMENTAL MATERIAL
The following material is available online at https://doi.org/10.1128/spectrum.03102-23.
Figure S1, related to Fig. 1. S. Typhi grows well in both acidic and neutral pH conditions. Comparative growth assays on S. Typhi using media with pH levels of 4.5 and 7.4.
Figure S2, related to Fig. 2. The dialyzed tdAMP-1 and tdAMP-2 showed the same antimicrobial activities against S. Typhi. A–E, Growth curves and CFU assay results of S. Typhi treated with the dialyzed tdAMP-1 (A–B), tdAMP-2 (C–D), or acetate (E) at the indicated concentrations.
Legends of Fig. S1 and S2 and Table S1.
Table S1, related to Fig. 2. Identification of tdAMPs. The genes encoding proteins with a length of less than 100 amino acids were analyzed using CAMPR3 and AMPpred, resulting in the top 20 candidates whose antibacterial probability exceeds 0.9. After careful evaluation of the candidates, we have identified the 4 candidates for this study: tdAMP-1 (YP_008563122.1), tdAMP-2 (XP_025885552.1), tdAMP-3 (XP_004247438.1), and tdAMP-4 (XP_004247441.1).
ASM does not own the copyrights to Supplemental Material that may be linked to, or accessed through, an article. The authors have granted ASM a non-exclusive, world-wide license to publish the Supplemental Material files. Please contact the corresponding author directly for reuse.
REFERENCES
- 1. Applegate CC, Lowerison MR, Hambley E, Song P, Wallig MA, Erdman JW. 2021. Dietary tomato inhibits angiogenesis in TRAMP prostate cancer but is not protective with a western-style diet in this pilot study. Sci Rep 11:18548. doi: 10.1038/s41598-021-97539-2 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2. Chaudhary P, Sharma A, Singh B, Nagpal AK. 2018. Bioactivities of phytochemicals present in tomato. J Food Sci Technol 55:2833–2849. doi: 10.1007/s13197-018-3221-z [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3. Cheng HM, Koutsidis G, Lodge JK, Ashor AW, Siervo M, Lara J. 2019. Lycopene and tomato and risk of cardiovascular diseases: a systematic review and meta-analysis of epidemiological evidence. Crit Rev Food Sci Nutr 59:141–158. doi: 10.1080/10408398.2017.1362630 [DOI] [PubMed] [Google Scholar]
- 4. Ghavipour M, Saedisomeolia A, Djalali M, Sotoudeh G, Eshraghyan MR, Moghadam AM, Wood LG. 2013. Tomato juice consumption reduces systemic inflammation in overweight and obese females. Br J Nutr 109:2031–2035. doi: 10.1017/S0007114512004278 [DOI] [PubMed] [Google Scholar]
- 5. Ghavipour M, Sotoudeh G, Ghorbani M. 2015. Tomato juice consumption improves blood antioxidative biomarkers in overweight and obese females. Clin Nutr 34:805–809. doi: 10.1016/j.clnu.2014.10.012 [DOI] [PubMed] [Google Scholar]
- 6. Rowles JL, Ranard KM, Applegate CC, Jeon S, An R, Erdman JW. 2018. Processed and raw tomato consumption and risk of prostate cancer: a systematic review and dose-response meta-analysis. Prostate Cancer Prostatic Dis 21:319–336. doi: 10.1038/s41391-017-0005-x [DOI] [PubMed] [Google Scholar]
- 7. Tam CC, Nguyen K, Nguyen D, Hamada S, Kwon O, Kuang I, Gong S, Escobar S, Liu M, Kim J, Hou T, Tam J, Cheng LW, Kim JH, Land KM, Friedman M. 2021. Antimicrobial properties of tomato leaves, stems, and fruit and their relationship to chemical composition. BMC Complement Med Ther 21:229. doi: 10.1186/s12906-021-03391-2 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8. Kraszewska J, Beckett MC, James TC, Bond U. 2016. Comparative analysis of the antimicrobial activities of plant defensin-like and ultrashort peptides against food-spoiling bacteria. Appl Environ Microbiol 82:4288–4298. doi: 10.1128/AEM.00558-16 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9. Silva-Beltrán NP, Ruiz-Cruz S, Cira-Chávez LA, Estrada-Alvarado MI, Ornelas-Paz J de J, López-Mata MA, Del-Toro-Sánchez CL, Ayala-Zavala JF, Márquez-Ríos E. 2015. Total phenolic, flavonoid, tomatine, and tomatidine contents and antioxidant and antimicrobial activities of extracts of tomato plant. Int J Anal Chem 2015:284071. doi: 10.1155/2015/284071 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10. Ramada MHS, Brand GD, Abrão FY, Oliveira M, Filho JLC, Galbieri R, Gramacho KP, Prates MV, Bloch C. 2017. Encrypted antimicrobial peptides from plant proteins. Sci Rep 7:13263. doi: 10.1038/s41598-017-13685-6 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11. Liu H, Lei M, Du X, Cui P, Zhang S. 2015. Identification of a novel antimicrobial peptide from amphioxus Branchiostoma japonicum by in silico and functional analyses. Sci Rep 5:18355. doi: 10.1038/srep18355 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12. Suarez M, Haenni M, Canarelli S, Fisch F, Chodanowski P, Servis C, Michielin O, Freitag R, Moreillon P, Mermod N. 2005. Structure-function characterization and optimization of a plant-derived antibacterial peptide. Antimicrob Agents Chemother 49:3847–3857. doi: 10.1128/AAC.49.9.3847-3857.2005 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 13. Mahlapuu M, Håkansson J, Ringstad L, Björn C. 2016. Antimicrobial peptides: an emerging category of therapeutic agents. Front Cell Infect Microbiol 6:194. doi: 10.3389/fcimb.2016.00194 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14. Lázár V, Martins A, Spohn R, Daruka L, Grézal G, Fekete G, Számel M, Jangir PK, Kintses B, Csörgő B, Nyerges Á, Györkei Á, Kincses A, Dér A, Walter FR, Deli MA, Urbán E, Hegedűs Z, Olajos G, Méhi O, Bálint B, Nagy I, Martinek TA, Papp B, Pál C. 2018. Antibiotic-resistant bacteria show widespread collateral sensitivity to antimicrobial peptides. Nat Microbiol 3:718–731. doi: 10.1038/s41564-018-0164-0 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15. Anonymous . 2022. Identification of antimicrobial peptides from the human gut microbiome using deep learning. Nat Biotechnol 40:838–839. doi: 10.1038/s41587-022-01230-4 [DOI] [PubMed] [Google Scholar]
- 16. Hancock REW, Sahl H-G. 2006. Antimicrobial and host-defense peptides as new anti-infective therapeutic strategies. Nat Biotechnol 24:1551–1557. doi: 10.1038/nbt1267 [DOI] [PubMed] [Google Scholar]
- 17. Zhu Y, Hao W, Wang X, Ouyang J, Deng X, Yu H, Wang Y. 2022. Antimicrobial peptides, conventional antibiotics, and their synergistic utility for the treatment of drug-resistant infections. Med Res Rev 42:1377–1422. doi: 10.1002/med.21879 [DOI] [PubMed] [Google Scholar]
- 18. Chongsiriwatana NP, Lin JS, Kapoor R, Wetzler M, Rea JAC, Didwania MK, Contag CH, Barron AE. 2017. Intracellular biomass flocculation as a key mechanism of rapid bacterial killing by cationic, amphipathic antimicrobial peptides and peptoids. Sci Rep 7:16718. doi: 10.1038/s41598-017-16180-0 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19. Mookherjee N, Anderson MA, Haagsman HP, Davidson DJ. 2020. Antimicrobial host defence peptides: functions and clinical potential. Nat Rev Drug Discov 19:311–332. doi: 10.1038/s41573-019-0058-8 [DOI] [PubMed] [Google Scholar]
- 20. Marchello CS, Birkhold M, Crump JA. 2020. Complications and mortality of typhoid fever: a global systematic review and meta-analysis. J Infect 81:902–910. doi: 10.1016/j.jinf.2020.10.030 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21. Hancuh M, Walldorf J, Minta AA, Tevi-Benissan C, Christian KA, Nedelec Y, Heitzinger K, Mikoleit M, Tiffany A, Bentsi-Enchill AD, Breakwell L. 2023. Typhoid fever surveillance, incidence estimates, and progress toward typhoid conjugate vaccine introduction - worldwide, 2018-2022. MMWR Morb Mortal Wkly Rep 72:171–176. doi: 10.15585/mmwr.mm7207a2 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22. Antillón M, Warren JL, Crawford FW, Weinberger DM, Kürüm E, Pak GD, Marks F, Pitzer VE. 2017. The burden of typhoid fever in low- and middle-income countries: a meta-regression approach. PLoS Negl Trop Dis 11:e0005376. doi: 10.1371/journal.pntd.0005376 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23. Amsalu T, Genet C, Adem Siraj Y. 2021. Salmonella Typhi and Salmonella paratyphi prevalence, antimicrobial susceptibility profile and factors associated with enteric fever infection in Bahir Dar, Ethiopia. Sci Rep 11:7359. doi: 10.1038/s41598-021-86743-9 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24. Wong VK, Baker S, Connor TR, Pickard D, Page AJ, Dave J, Murphy N, Holliman R, Sefton A, Millar M, Dyson ZA, Dougan G, Holt KE, International Typhoid Consortium . 2016. An extended genotyping framework for Salmonella enterica serovar Typhi, the cause of human typhoid. Nat Commun 7:12827. doi: 10.1038/ncomms12827 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25. Wong VK, Baker S, Pickard DJ, Parkhill J, Page AJ, Feasey NA, Kingsley RA, Thomson NR, Keane JA, Weill F-X, et al. 2015. Phylogeographical analysis of the dominant multidrug-resistant H58 clade of Salmonella Typhi identifies inter- and intracontinental transmission events. Nat Genet 47:632–639. doi: 10.1038/ng.3281 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26. González JF, Alberts H, Lee J, Doolittle L, Gunn JS. 2018. Biofilm formation protects Salmonella from the antibiotic ciprofloxacin in vitro and in vivo in the mouse model of chronic carriage. Sci Rep 8:222. doi: 10.1038/s41598-017-18516-2 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27. Neupane DP, Ahn C, Yang YA, Lee GY, Song J. 2022. Malnutrition and maternal vaccination against typhoid toxin. PLoS Pathog 18:e1010731. doi: 10.1371/journal.ppat.1010731 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28. Allen CK, Assaf S, Namaste S, Benedict RK. 2023. Estimates and trends of zero vegetable or fruit consumption among children aged 6-23 months in 64 countries. PLOS Glob Public Health 3:e0001662. doi: 10.1371/journal.pgph.0001662 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29. Waghu FH, Barai RS, Gurung P, Idicula-Thomas S. 2016. CAMPR3: a database on sequences, structures and signatures of antimicrobial peptides. Nucleic Acids Res 44:D1094–D1097. doi: 10.1093/nar/gkv1051 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30. Meher PK, Sahu TK, Saini V, Rao AR. 2017. Predicting antimicrobial peptides with improved accuracy by incorporating the compositional, physico-chemical and structural features into Chou’s general PseAAC. Sci Rep 7:42362. doi: 10.1038/srep42362 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31. Aldred KJ, McPherson SA, Turnbough CL, Kerns RJ, Osheroff N. 2013. Topoisomerase IV-quinolone interactions are mediated through a water-metal ion bridge: mechanistic basis of quinolone resistance. Nucleic Acids Res 41:4628–4639. doi: 10.1093/nar/gkt124 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32. Campos MA, Vargas MA, Regueiro V, Llompart CM, Albertí S, Bengoechea JA. 2004. Capsule polysaccharide mediates bacterial resistance to antimicrobial peptides. Infect Immun 72:7107–7114. doi: 10.1128/IAI.72.12.7107-7114.2004 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33. Ernst CM, Braxton JR, Rodriguez-Osorio CA, Zagieboylo AP, Li L, Pironti A, Manson AL, Nair AV, Benson M, Cummins K, Clatworthy AE, Earl AM, Cosimi LA, Hung DT. 2020. Adaptive evolution of virulence and persistence in carbapenem-resistant Klebsiella pneumoniae. Nat Med 26:705–711. doi: 10.1038/s41591-020-0825-4 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 34. Lee GY, Song J. 2024. Single missense mutations in VI capsule synthesis genes confer hypervirulence to Salmonella Typhi. bioRxiv. doi: 10.1101/2023.12.28.573590 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 35. Jumper J, Evans R, Pritzel A, Green T, Figurnov M, Ronneberger O, Tunyasuvunakool K, Bates R, Žídek A, Potapenko A, et al. 2021. Highly accurate protein structure prediction with AlphaFold. Nature 596:583–589. doi: 10.1038/s41586-021-03819-2 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 36. Thiennimitr P, Winter SE, Bäumler AJ. 2012. Salmonella, the host and its microbiota. Curr Opin Microbiol 15:108–114. doi: 10.1016/j.mib.2011.10.002 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37. Subashchandrabose S, Mobley HLT. 2015. Virulence and fitness determinants of uropathogenic Escherichia coli. Microbiol Spectr 3. doi: 10.1128/microbiolspec.UTI-0015-2012 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38. Song J, Abraham SN. 2008. Innate and adaptive immune responses in the urinary tract. Eur J Clin Invest 38 Suppl 2:21–28. doi: 10.1111/j.1365-2362.2008.02005.x [DOI] [PubMed] [Google Scholar]
- 39. Abraham SN, Miao Y. 2015. The nature of immune responses to urinary tract infections. Nat Rev Immunol 15:655–663. doi: 10.1038/nri3887 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40. Levine MM, Simon R. 2018. The gathering storm:is untreatable typhoid fever on the way? mBio 9:e00482-18. doi: 10.1128/mBio.00482-18 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41. Klemm EJ, Shakoor S, Page AJ, Qamar FN, Judge K, Saeed DK, Wong VK, Dallman TJ, Nair S, Baker S, Shaheen G, Qureshi S, Yousafzai MT, Saleem MK, Hasan Z, Dougan G, Hasan R. 2018. Emergence of an extensively drug-resistant Salmonella enterica serovar Typhi clone harboring a promiscuous plasmid encoding resistance to fluoroquinolones and third-generation cephalosporins. mBio 9:e00105-18. doi: 10.1128/mBio.00105-18 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 42. Kim C, Latif I, Neupane DP, Lee GY, Kwon RS, Batool A, Ahmed Q, Qamar MU, Song J, Gao F. 2021. The molecular basis of extensively drug-resistant Salmonella Typhi isolates from pediatric septicemia patients. PLoS One 16:e0257744. doi: 10.1371/journal.pone.0257744 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43. Neupane DP, Dulal HP, Song J. 2021. Enteric fever diagnosis: current challenges and future directions. Pathogens 10:410. doi: 10.3390/pathogens10040410 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44. Siu LK, Yeh KM, Lin JC, Fung CP, Chang FY. 2012. Klebsiella pneumoniae liver abscess: a new invasive syndrome. Lancet Infect Dis 12:881–887. doi: 10.1016/S1473-3099(12)70205-0 [DOI] [PubMed] [Google Scholar]
- 45. Holt KE, Wertheim H, Zadoks RN, Baker S, Whitehouse CA, Dance D, Jenney A, Connor TR, Hsu LY, Severin J, et al. 2015. Genomic analysis of diversity, population structure, virulence, and antimicrobial resistance in Klebsiella pneumoniae, an urgent threat to public health. Proc Natl Acad Sci U S A 112:E3574–E3581. doi: 10.1073/pnas.1501049112 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46. Wyres KL, Lam MMC, Holt KE. 2020. Population genomics of Klebsiella pneumoniae. Nat Rev Microbiol 18:344–359. doi: 10.1038/s41579-019-0315-1 [DOI] [PubMed] [Google Scholar]
- 47. Pan YJ, Lin TL, Chen CT, Chen YY, Hsieh PF, Hsu CR, Wu MC, Wang JT. 2015. Genetic analysis of capsular polysaccharide synthesis gene clusters in 79 capsular types of Klebsiella spp. Sci Rep 5:15573. doi: 10.1038/srep15573 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 48. Roshini J, Patro LPP, Sundaresan S, Rathinavelan T. 2023. Structural diversity among Acinetobacter baumannii K-antigens and its implication in the in silico serotyping. Front Microbiol 14:1191542. doi: 10.3389/fmicb.2023.1191542 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 49. Hu L, Shi Y, Xu Q, Zhang L, He J, Jiang Y, Liu L, Leptihn S, Yu Y, Hua X, Zhou Z. 2020. Capsule thickness, not biofilm formation, gives rise to mucoid Acinetobacter baumannii phenotypes that are more prevalent in long-term infections: a study of clinical isolates from a hospital in China. Infect Drug Resist 13:99–109. doi: 10.2147/IDR.S230178 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50. Tossi A, Sandri L, Giangaspero A. 2000. Amphipathic, alpha-helical antimicrobial peptides. Biopolymers 55:4–30. doi: 10.1002/1097-0282(2000)55:1<4::AID-BIP30>3.0.CO;2-M [DOI] [PubMed] [Google Scholar]
- 51. Kim D, Soundrarajan N, Lee J, Cho H-S, Choi M, Cha S-Y, Ahn B, Jeon H, Le MT, Song H, Kim J-H, Park C. 2017. Genomewide analysis of the antimicrobial peptides in Python bivittatus and characterization of cathelicidins with potent antimicrobial activity and low cytotoxicity. Antimicrob Agents Chemother 61:e00530-17. doi: 10.1128/AAC.00530-17 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 52. Klubthawee N, Adisakwattana P, Hanpithakpong W, Somsri S, Aunpad R. 2020. A novel, rationally designed, hybrid antimicrobial peptide, inspired by cathelicidin and aurein, exhibits membrane-active mechanisms against Pseudomonas aeruginosa. Sci Rep 10:9117. doi: 10.1038/s41598-020-65688-5 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53. Sengkhui S, Klubthawee N, Aunpad R. 2023. A novel designed membrane-active peptide for the control of foodborne Salmonella enterica serovar typhimurium. Sci Rep 13:3507. doi: 10.1038/s41598-023-30427-z [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54. Kozlowski LP. 2021. IPC 2.0: prediction of isoelectric point and pKa dissociation constants. Nucleic Acids Res 49:W285–W292. doi: 10.1093/nar/gkab295 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 55. Lee GY, Song J. 2021. Complete genome sequence of Salmonella enterica serovar Typhi strain ISP2825. Microbiol Resour Announc 10:e0080421. doi: 10.1128/MRA.00804-21 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 56. Lee S, Yang YA, Milano SK, Nguyen T, Ahn C, Sim JH, Thompson AJ, Hillpot EC, Yoo G, Paulson JC, Song J. 2020. Salmonella typhoid toxin PltB subunit and its non-typhoidal Salmonella ortholog confer differential host adaptation and virulence. Cell Host Microbe 27:937–949. doi: 10.1016/j.chom.2020.04.005 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 57. Chang S-J, Song J, Galán JE. 2016. Receptor-mediated sorting of typhoid toxin during its export from salmonella Typhi-infected cells. Cell Host Microbe 20:682–689. doi: 10.1016/j.chom.2016.10.005 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 58. Cheng X, Jo S, Lee HS, Klauda JB, Im W. 2013. CHARMM-GUI micelle builder for pure/mixed micelle and protein/micelle complex systems. J Chem Inf Model 53:2171–2180. doi: 10.1021/ci4002684 [DOI] [PubMed] [Google Scholar]
- 59. Jo S, Kim T, Iyer VG, Im W. 2008. CHARMM-GUI: a web-based graphical user interface for CHARMM. J Comput Chem 29:1859–1865. doi: 10.1002/jcc.20945 [DOI] [PubMed] [Google Scholar]
- 60. Phillips JC, Hardy DJ, Maia JDC, Stone JE, Ribeiro JV, Bernardi RC, Buch R, Fiorin G, Hénin J, Jiang W, McGreevy R, Melo MCR, Radak BK, Skeel RD, Singharoy A, Wang Y, Roux B, Aksimentiev A, Luthey-Schulten Z, Kalé LV, Schulten K, Chipot C, Tajkhorshid E. 2020. Scalable molecular dynamics on CPU and GPU architectures with NAMD. J Chem Phys 153:044130. doi: 10.1063/5.0014475 [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Supplementary Materials
Figure S1, related to Fig. 1. S. Typhi grows well in both acidic and neutral pH conditions. Comparative growth assays on S. Typhi using media with pH levels of 4.5 and 7.4.
Figure S2, related to Fig. 2. The dialyzed tdAMP-1 and tdAMP-2 showed the same antimicrobial activities against S. Typhi. A–E, Growth curves and CFU assay results of S. Typhi treated with the dialyzed tdAMP-1 (A–B), tdAMP-2 (C–D), or acetate (E) at the indicated concentrations.
Legends of Fig. S1 and S2 and Table S1.
Table S1, related to Fig. 2. Identification of tdAMPs. The genes encoding proteins with a length of less than 100 amino acids were analyzed using CAMPR3 and AMPpred, resulting in the top 20 candidates whose antibacterial probability exceeds 0.9. After careful evaluation of the candidates, we have identified the 4 candidates for this study: tdAMP-1 (YP_008563122.1), tdAMP-2 (XP_025885552.1), tdAMP-3 (XP_004247438.1), and tdAMP-4 (XP_004247441.1).
Data Availability Statement
The published article includes all datasets generated during this study.





