Skip to main content
eLife logoLink to eLife
. 2024 Mar 25;13:e96891. doi: 10.7554/eLife.96891

Repulsive Sema3E-Plexin-D1 signaling coordinates both axonal extension and steering via activating an autoregulatory factor, Mtss1

Namsuk Kim 1,†, Yan Li 1,†, Ri Yu 1, Hyo-Shin Kwon 1, Anji Song 1, Mi-Hee Jun 1, Jin-Young Jeong 1,2, Ji Hyun Lee 1, Hyun-Ho Lim 1, Mi-Jin Kim 3, Jung-Woong Kim 3, Won-Jong Oh 1,✉
Editors: Jun Ding4, K VijayRaghavan5
PMCID: PMC11001299  PMID: 38526535

Abstract

Axon guidance molecules are critical for neuronal pathfinding because they regulate directionality and growth pace during nervous system development. However, the molecular mechanisms coordinating proper axonal extension and turning are poorly understood. Here, metastasis suppressor 1 (Mtss1), a membrane protrusion protein, ensured axonal extension while sensitizing axons to the Semaphorin 3E (Sema3E)-Plexin-D1 repulsive cue. Sema3E-Plexin-D1 signaling enhanced Mtss1 expression in projecting striatonigral neurons. Mtss1 localized to the neurite axonal side and regulated neurite outgrowth in cultured neurons. Mtss1 also aided Plexin-D1 trafficking to the growth cone, where it signaled a repulsive cue to Sema3E. Mtss1 ablation reduced neurite extension and growth cone collapse in cultured neurons. Mtss1-knockout mice exhibited fewer striatonigral projections and irregular axonal routes, and these defects were recapitulated in Plxnd1- or Sema3e-knockout mice. These findings demonstrate that repulsive axon guidance activates an exquisite autoregulatory program coordinating both axonal extension and steering during neuronal pathfinding.

Research organism: Mouse

Introduction

In the developing nervous system, axons of newly generated neurons extend toward destination targets and make connections to establish a functional circuit following an exquisitely designed program. In this long-range pathfinding process, axons encounter attractive and repulsive signals from guidance molecules, and diverse combinations of ligand–receptor pairs communicate signals to a neuron from the environment (Kolodkin and Tessier-Lavigne, 2011; Tessier-Lavigne and Goodman, 1996). In addition to the conventional guidance mode, which has been established, recent studies have demonstrated the complexity of signaling through different mechanistic layers, such as crosstalk between guidance molecules (Dupin et al., 2015; Poliak et al., 2015), guidance switching between different holoreceptor complexes (Bellon et al., 2010), or guidance tuning by intrinsic regulators (Bai et al., 2011; Bonanomi et al., 2019). In general, the specific cognate guidance receptors that sense extracellular signals are mostly localized in growth cones, a specialized structure at the fore of a growing axon, and these receptors convey intracellular signaling cues within neurons (Dent et al., 2011; Franze, 2020). Therefore, proper signaling from guidance molecules in the growth cone surface is critical as axons travel to their destination. Because the axonal destination can be as far as a meter or more away from the soma, various transport systems consisting of specific adaptors and motor proteins transport guidance proteins to axon terminals and are thus critical for axonal movement (Dent et al., 2011; Winckler and Mellman, 2010). However, how individual guidance molecules are correctly delivered to growth cones and can accommodate the axonal growth pace is unclear, and the molecular machinery critical for the specific transportation of guidance molecules is unknown.

Growth cones are highly dynamic and motile cellular structures that facilitate axon growth and steering through activated receptors that alter cytoskeletal actin and microtubule assembly (Lowery and Van Vactor, 2009; Vitriol and Zheng, 2012). Therefore, guidance receptors undoubtedly need to be localized to these protrusive structures to control actin dynamics. Since actin filament assembly is typically accompanied by membrane remodeling, a group of cytoskeletal scaffold proteins linking actin to the cell membrane must be activated (Vitriol and Zheng, 2012). One such protein group consists of Bin/Amphiphysin/Rvs (BAR) domain proteins, which have been implicated in many actin-associated membrane functions, such as cell motility, endocytosis, and organelle trafficking (Chen et al., 2013). Among these proteins, metastasis suppressor 1 (Mtss1, also called missing in metastasis), one of a few inverse BAR (I-BAR) domain subfamily proteins, is notable due to its capability of forming cellular protrusions by promoting inverse membrane curvature (Machesky and Johnston, 2007). Because of its unique ability to connect the plasma membrane inner leaflet with actin, the role of Mtss1 has been characterized in promoting spine protrusions as well as neuronal dendrite growth (Kawabata Galbraith et al., 2018; Saarikangas et al., 2015; Yu et al., 2016). However, in contrast to these many studies of Mtss1 on the dendritic side during development, few studies have investigated whether Mtss1 is expressed and plays a specific role in axons.

Semaphorin 3E (Sema3E), a class 3 secreted semaphorin family protein, conveys guidance signals by directly binding with the Plexin-D1 receptor in both the nervous and vascular systems (Gu et al., 2005; Oh and Gu, 2013a). The Sema3E-Plexin-D1 pair mainly transmits a repulsive guidance cue via local cytoskeletal changes, thereby inhibiting axonal overgrowth and/or ectopic synapse formation in the central nervous system (Chauvet et al., 2007; Ding et al., 2012; Fukuhara et al., 2013; Mata et al., 2018; Pecho-Vrieseling et al., 2009). Previous studies have demonstrated that Sema3E-Plexin-D1 signaling is involved in dendritic synapse formation as well as traditional axon projection in the basal ganglia circuitry, which is essential for diverse behavioral and cognitive functions in the brain (Ding et al., 2012; Ehrman et al., 2013). Notably, Plexin-D1 is expressed only in direct-pathway medium spiny neurons (MSNs) projecting to the substantia nigra pars reticulata (SNr), one of two distinct types of MSNs in the striatum (Ding et al., 2012). Plexin-D1-positive striatonigral axons travel through the corridor between the globus pallidus (Gp) and reticular thalamic nucleus (rTh)/zona incerta (ZI), in which Sema3E molecules reside and emit repulsive signals to direct proper pathway formation toward the SNr (Chauvet et al., 2007; Ehrman et al., 2013). However, how the striatonigral pathway coordinates axonal growth and steering during pathfinding remains largely unknown.

In this study, we investigated the molecular mechanism of the repulsive Sema3E-Plexin-D1 guidance signaling pair in striatonigral-projecting neurons during mouse basal ganglia circuit development. We found that Sema3E-Plexin-D1 signaling coordinates axonal extension and diversion by enhancing the action of the facilitator protein Mtss1 during active striatonigral projection progression. In the context of the important and intricate networks in the brain, this study provides evidence showing that autoregulatory factor expression regulated by guidance signaling leads to the correct neuronal trajectory to the destination.

Results

Sema3E-Plexin-D1 signaling regulates Mtss1 expression in the developing striatum

The majority of striatal neurons are MSNs (up to 90%), and the MSNs are equally divided into direct and indirect pathways (Gerfen and Surmeier, 2011). In a previous study, we found that Plxnd1 is selectively expressed in direct-pathway MSNs (also called striatonigral neurons) that project directly to the substantia nigra, with approximately 45% of striatal neurons identified as Plexin-D1-positive neurons (Ding et al., 2012). Because of the relative abundance of Plexin-D1-positive neurons, we expected a high probability of discovering the potential downstream responsive genes modulated by Sema3E-Plexin-D1 signaling in the striatum. Therefore, we performed bulk RNA sequencing (RNA-seq) with striatal tissues at P5, when Plxnd1 expression is high in the striatum, and compared the results obtained with control (Plxnd1f/f) and conditional neuronal Plxnd1-knockout (Nes-Cre; Plxnd1f/f) mice (Figure 1A). Plxnd1 mRNA ablation in striatal tissues was validated in pan-neuronal Plxnd1-knockout (Nestin-Cre) mice (Figure 1—figure supplement 1A and B).

Figure 1. Sema3E-Plexin-D1 signaling induces Mtss1 expression selectively in developing striatonigral projecting neurons.

(A) RNA sequencing (RNA-seq) analysis of wild-type (WT) (Plxnd1f/f) and conditional neuronal knockout (cKO) (Nes-cre; Plxnd1f/f) pups at P5. The box in red indicates the dorsal striatum region from which RNA was isolated. (B) Volcano plot of significant differentially expressed genes (DEGs) between WT and Plxnd1 cKO. Blue and red circles indicate significantly down- and upregulated genes, respectively, as indicated by a fold change greater than 2. (C) Relative levels of Mtss1 expression in the striatum of WT or Plxnd cKO mice at P5 were compared by quantitative RT-PCR (RT-qPCR). n = 16 for WT mice, n = 14 for Plxnd1 cKO mice in four independent experiments. (D, E) Western blot images showing Mtss1 expression in the striatum of WT or Plxnd1 cKO mice and quantification. The values are averaged from n = 5 for WT mice and n = 4 for Plxnd1 cKO mice. (F, G) Western blot images and quantification of Mtss1 expression in the striatum of WT or Sema3e KO mice at P5. WT mice, n = 7, and Sema3e KO mice, n = 8. (H) Fluorescence in situ hybridization (FISH) for Plxnd1 mRNA (green) and Mtss1 mRNA (red) in the striatum of WT or Plxnd1 cKO mice at P5. White dotted boxes are shown in the inset image on the bottom. Scale bar, 200 μm. (I) Quantification of fluorescence intensity to measure the expression levels of Mtss1 in (H). WT mice, n = 3, and Plxnd1 cKO mice, n = 3. (J) Immunohistochemistry showing tdTomato-expressing Drd1a+MSNs (red) and Mtss1 (green) in the striatum of Drd1a-tdT mice at P5. The small boxes in the striatum and cortex are shown at better resolution in the inset images. Scale bar, 100 μm. (K) Western blot images showing the expression of Mtss1 and Plexin-D1 in the striatum of WT or Plxnd1 cKO mice at different developmental stages ranging from embryonic day 16.5 (E16.5) to postnatal day 0 (P0). (L) Quantification of band intensity in (K). WT, n = 4, and KO, n = 4 at E16.5, WT, n = 3, and KO, n = 3 at E18.5, WT, n = 3, and KO, n = 3 at P0. (M, N) Western blot images showing the temporal expression of Plexin-D1 and Mtss1 in the striatum from E14.5 to adulthood (8 weeks old) and quantification. Error bars, mean ± SEM; *p<0.05, **p<0.01 by Student’s t-test for all quantifications. The values represent the average band intensity, n = 3 at each age. str, striatum; cx, cortex; Th, thalamus; SNr, substantia nigra.

Figure 1—source data 1. Western blots shown in Figure 1D, F, K, and M.

Figure 1.

Figure 1—figure supplement 1. Identification of Mtss1 in the striatum on P5 through RNA sequencing (RNA-seq) analysis.

Figure 1—figure supplement 1.

(A) Expression of Plxnd1 mRNA from wild-type (WT) (Plxnd1f/f) or conditional knockout (cKO) (Nes-cre; Plxnd1f/f) littermate mouse striatum at P5 was examined via in situ hybridization (ISH). Scale bars, 500 μm. (B) Plxnd1 mRNA expression was determined by reverse transcription-polymerase chain reaction (RT-PCR). (C) Common gene expression patterns were determined through two independent experiments and by RNA-seq. The values in the principal component analysis (PCA) plot indicate the amount of variation attributed to each principal component. Small circles indicate individual samples, and large ovals represent experimental groups. (D) Heatmap showing differential gene expression patterns as determined through RNA-seq analysis. Each row represents hierarchically clustered genes, and each column represents experimental samples with dendrograms and clusters generated with RNA-seq data. Red in the heatmap indicates upregulation of gene expression, and blue denotes downregulation of gene expression; the measures were based on z-score. (E) The most highly enriched Gene Ontology (GO) biological process and cellular component categories in Nes-cre; Plxnd1f/f samples were visualized on the basis of significant differentially expressed genes (DEGs) determined by RNA-seq. The size of a circle represents enriched genes, and the color represents the −log10 of the p-value.
Figure 1—figure supplement 1—source data 1. RT-PCR shown in Figure 1—figure supplement 1B.
Figure 1—figure supplement 2. Sema3E expression through thalamostriatal projections at E16.5.

Figure 1—figure supplement 2.

(A) The expression levels of Plxnd1 mRNA (green) and Sema3e mRNA (red) in the brains of E16.5 mice were detected by double fluorescence in situ hybridization. The red arrow in the bottom-right image indicates the Sema3E protein detected by AP-Plexin-D1-ECD (extracellular domain). Scale bar, 1 mm. (B) Thalamostriatal projections in the parasagittal sections of the brains at E16.5 were stained by DiI to visualize the projecting axons from neurons in the thalamus. Scale bar, 500 μm. (C) Sema3E protein in the striatum of E16.5 brains was detected by western blot analysis. * indicates a nonspecific band. cx, cortex; str, striatum; and Th, thalamus. .
Figure 1—figure supplement 2—source data 1. Western blots shown in Figure 1—figure supplement 2C.

Next, we performed gene expression profile analysis. The principal component analysis (PCA) plot showed that Plxnd1-knockout accounted for the largest variance, and the results obtained in biological replicates showed high reproducibility (Figure 1—figure supplement 1C). Application of a conservative DEseq approach to RNA-seq data analysis confirmed 2360 differentially expressed transcripts (Figure 1—figure supplement 1D). Gene Ontology (GO) analysis was then performed, and biological connections between upregulated (1240 transcripts) and downregulated (1120 transcripts) differentially expressed genes (DEGs) in Plxnd1-knockout mice compared to wild-type (control) mice were identified (Figure 1—figure supplement 1E). Clustering of the downregulated DEGs in Plxnd1-knockout mice enabled their classification into several categories that were associated with axon guidance, regulation of dendritic spine morphology, and neuronal projection. The volcano plots present the statistical significance of differential transcript expression with the respective fold change values (p<0.05, absolute log2 [fold change, FC] > 1) compared to the expression observed in the control group (Figure 1B).

Among the downregulated genes, Mtss1 was particularly notable due to its high relevance to actin cytoskeletal rearrangement (Kawabata Galbraith et al., 2018; Lin et al., 2005; Saarikangas et al., 2015). Mtss1 gene expression was verified by quantitative RT-PCR (qRT-PCR) performed with Plxnd1-knockout striatal tissues (Figure 1C). The Mtss1 protein levels were also markedly decreased in the knockout mice at P5 (Figure 1D and E). We also analyzed Mtss1 expression in Sema3e-knockout striatal samples obtained at P5 and found that its expression was decreased, but less dramatically than it was in Plxnd1-knockout striatal samples (Figure 1F and G). These results suggest that Sema3E-Plexin-D1 signaling activation can increase Mtss1 expression in striatal neurons during development.

Mtss1 is selectively expressed in striatonigral-projecting neurons during the active pathfinding period

To determine whether this Mtss1 expression is specific to Plexin-D1-positive neurons, we first performed fluorescence in situ hybridization. Mtss1 expression significantly overlapped with Plxnd1-positive neurons in both the cortex and striatum, and its expression was reduced in Plxnd1-knockout mice (Figure 1H and I). Moreover, when we performed immunostaining with Drd1a-tdT mice, in which direct-pathway MSNs fluoresced red (Ade et al., 2011), Mtss1 expression significantly overlapped with Drd1a-tdT striatal neurons (Figure 1J; 98.2 ± 1.72%), suggesting that Plexin-D1 signaling mediates Mtss1 expression selectively in striatonigral projecting MSNs. Although Mtss1 was expressed at a low level regardless of Plexin-D1 presence at E16.5, it seemed to be under the control of Plexin-D1 signaling in the developing striatum from the last gestation period to the early postnatal period (Figure 1K and L). Furthermore, the Sema3E ligand activating the Plexin-D1 receptor was predominantly expressed in the thalamus and released into the striatum, probably during thalamostriatal projection at E16.5, as observed in the early postnatal stage in a previous study (Figure 1—figure supplement 2; Ding et al., 2012). Next, we analyzed the expression profiles of Plexin-D1 and Mtss1 from the developmental stage to the adult stage. Both Plexin-D1 and Mtss1 were expressed in the embryonic striatum, and their expression was elevated in the perinatal stage. Interestingly, Mtss1 expression was maintained at a relatively high level from E18.5 to P5 and then declined sharply and disappeared in the adult striatum, and although Plexin-D1 showed a similar expression pattern, its expression was maintained at a low level in the adult striatum, presumably to regulate other functions such as thalamostriatal synapse formation (Figure 1M and N; Ding et al., 2012).

Sema3E-Plexin-D1 signaling regulates Mtss1 expression in cultured medium spiny neurons

To determine whether Plexin-D1-driven Mtss1 expression can be recapitulated in vitro, we compared the Mtss1 levels in cultured striatal neurons isolated from wild-type and Plxnd1-null mice. In wild-type neurons, both Plexin-D1 and Mtss1 expression levels were low at day 3 in vitro (DIV3) and then increased by DIV6. In contrast, Plxnd1-knockout neurons failed to elevate Mtss1 expression by DIV6, suggesting that Mtss1 expression is induced at the cellular level rather than by indirect systemic changes at the circuit level in vivo (Figure 2A and B). In addition, the expression of Mtss1 was decreased in cultured Sema3e-knockout neurons (Figure 2C and D). Next, to further confirm that the Sema3E-Plexin-D1 guidance pair is required for the activation of Mtss1 expression in striatonigral neurons, we supplemented the Sema3e- or Plxnd1-knockout neurons with exogenous Sema3E ligand according to the scheme in Figure 2E. Given that some Sema3E ligands are naturally present in our striatal cultures from globus pallidus neurons, conducting tests on the exogenous Sema3E effect in the Sema3e-knockout cultures is ideal to minimize experimental variation. In fact, Mtss1 expression was increased by Sema3E replenishment in Sema3e-knockout neurons, whereas it was not altered in Plxnd1-knockout neurons (Figure 2F–I). Moreover, since Akt is already known to mediate the Sema3E-Plexin-D1 signaling cascade in neurons (Burk et al., 2017), we next examined whether disturbing Akt activity alters Mtss1 expression in cultured neurons. Treatment with an Akt inhibitor, MK2206, downregulated Mtss1 expression but caused no changes in Plexin-D1 levels (Figure 2J–M). Furthermore, the elevated expression of Mtss1 due to the addition of exogenous Sema3E supplement in Sema3e-knockout neurons was also diminished by MK2206, suggesting that the Sema3E-Plexin-D1 pathway is involved in Mtss1 expression through Akt signaling (Figure 2N and O). These results suggest that Mtss1 is a downstream expression target of Sema3E-Plexin-D1 signaling in direct-pathway MSNs.

Figure 2. In cultured medium spiny neurons (MSNs), Mtss1 expression is directly regulated by Sema3E-Plexin-D1 signaling through the AKT pathway.

Figure 2.

(A) Western blot images showing Mtss1 expression in MSNs derived from the striatum of wild-type (WT) or Plxnd1 conditional knockout (cKO) mice at P0 and measured at DIV3 and DIV6 in culture. (B) Quantification of band intensity in (A). Two-way ANOVA with Tukey’s post hoc correction for multiple comparisons; n = 3. (C) Mtss1 expression in MSNs obtained from the striatum of WT or Sema3e KO mice at P0 and measured at DIV6 in culture. (D) Quantification of the blots shown in (C). Student’s t-test; n = 5 for WT, n = 5 for KO in five independent experiments. (E) Schematic illustration of the experimental strategy for Sema3E-ligand or MK2206, an AKT inhibitor treatment in MSN culture. (F, G) Western blot images showing Mtss1 expression after AP-Sema3E (2 nM) treatment in cultured MSNs derived from Sema3e KO mice or Plxnd1 cKO mice. (H, I) Quantification of (F, G). Student’s t-test; AP, n = 4, AP-sema3E, n = 4 for sema3e KO mice, AP n = 4, AP-sema3E n = 4 for Plxnd1 cKO mice in three independent experiments. (J, K) Western blot to analyze the expression of Mtss1 and Plexin-D1 after MK2206 (100 nM) treatment in cultured MSNs and subsequent quantification for band intensity (L, M). Student’s t-test; n = 6 for sham, n = 6 for MK2206 in six independent experiments. (N O) Western blot image and analysis showing Mtss1 expression in Sema3e knockout MSNs treated with MK2206 after incubation with AP-Sema3E. Two-way ANOVA with Tukey’s post hoc correction for multiple comparisons; n = 5 in five independent experiments. Error bars, mean ± SEM; *p<0.05, **p<0.01, ***p<0.001 by indicated statistical tests. .

Figure 2—source data 1. Western blots shown in Figure 2A, C, F, G, J, K, and N.

Mtss1 is important for neurite extension in direct-pathway MSNs

Since Mtss1 has a well-characterized role in the regulation of filopodia and spine precursors (Saarikangas et al., 2015; Yu et al., 2016), we first tested the morphological changes induced by Mtss1 in COS7 cells. Mtss1 was weakly expressed in COS7 cells, but its levels were not altered after overexpressing Plexin-D1 with or without Sema3E (Figure 3—figure supplement 1A and B). Mtss1 overexpression in COS7 cells led to a diverse degree of morphological changes, such as excessively spiky or thin and long processes, and highly localized in F-actin-enriched protrusions. However, overexpression of Mtss1 lacking the I-BAR domain failed to generate these protrusive shapes (Figure 3—figure supplement 1C and D). Mtss1 lacking WH2 domain showed much weaker effect because WH2 is an important region for Mtss1 interaction with F-actin (Mattila et al., 2003). These results suggest that Mtss1 is involved in F-actin dynamics and thus may be an important regulator of neurite outgrowth in cultured MSNs, similar to the situations in other types of neurons (Kawabata Galbraith et al., 2018; Saarikangas et al., 2015; Yu et al., 2016).

Interestingly, Mtss1 was significantly localized to the Tau-positive-axonal side of cultured MSNs at DIV3 (Figure 3A). We measured the neurite length of the direct-pathway MSNs that had been genetically labeled with red fluorescence in Drd1a-tdT crossbred reporter mice. We observed significant growth retardation in MSNs lacking Mtss1 compared to wild-type neurons at DIV3 and DIV6 (Figure 3B, C and E, F). Furthermore, we also observed that Mtss1-deficient neurons failed to extend neurites more than twice the size of the cell body, suggesting that a lack of Mtss1 presumably caused a severe neurite growth defect (Figure 3D). Next, we analyzed neurite length in Plxnd1-knockout neurons. Interestingly, there was no difference in neurite length between Drd1a-positive wild-type MSNs and Plxnd1-knockout MSNs at DIV3 (Figure 3G and H), probably due to the low Mtss1 induction shown in Figure 2A, whereas the length was significantly reduced in the Plxnd1-deficient MSNs at DIV6 (Figure 3I and J). These results suggest the possibility that Mtss1 expression is independent of Plexin-D1 signaling in the young neurons as observed in early development (Figure 1K). However, Mtss1 expression appears to be highly induced by Sema3E-Plexin-D1 activation to regulate axonal extension as neurons mature. To further confirm that low Mtss1 expression is critical for shortening neurite outgrowth, we overexpressed Mtss1 in Plxnd1-deficient MSNs. In comparison to the neurite length observed in GFP-overexpressing MSNs, ectopic Mtss1 overexpression rescued the growth reduction phenotype in the Plxnd1-knockout neurons (Figure 3K and L). These results suggest that the Sema3E-Plexin-D1 repulsive guidance cue is capable of regulating axonal growth through positive facilitator proteins such as Mtss1.

Figure 3. Mtss1 contributes to neurite extension of Drd1a-positive medium spiny neurons (MSNs) under the regulation of Sema3E-Plexin-D1 signaling.

(A) Immunocytochemistry for Mtss1 (green), Tau (gray), and F-actin (red) in cultured MSNs at DIV3 obtained from wild-type (WT) or Mtss1 conditional knockout (cKO) mice. White dotted boxes are shown in the inset image on the bottom. Scale bar, 10 μm. (B) Representative images of Drd1a+MSNs at DIV3 derived from WT (Drd1a-tdT; Mtss1f/f) or Mtss1 cKO (Drd1a-tdT; Nes-cre; Mtss1f/f) mice. Scale bar, 20 μm. (C) Quantification of neurite length in (B) was performed as previously reported (Chauvet et al., 2016). The values represent the average ratio of the fold change in length compared to the control samples. Student’s t-test; n = 179 for WT, n = 184 for Mtss1 cKO, in three independent experiments. (D) Percentage of Drd1a-positive MSNs with neurites shorter than twice the cell body diameter in (B, C). χ2 test; n = 48 for WT, n = 48 for Mtss1 cKO in four independent experiments. (E) Representative images of Drd1a+MSNs at DIV6 derived from WT (Drd1a-tdT; Mtss1f/f) or Mtss1 cKO (Drd1a-tdT; Nes-cre; Mtss1f/f) mice. Scale bar, 50 μm. (F) Quantification of neurite length in (E). Student’s t-test; n = 210 for WT, n = 260 for Mtss1 cKO in three independent experiments. (G) Representative images of Drd1a+MSNs at DIV3 derived from WT (Drd1a-tdT; Plxnd1f/f) or Plxnd1 cKO (Drd1a-tdT; Nes-cre; Plxnd1f/f) mice. Scale bar, 20 μm. (H) Quantification of neurite length in (G). Student’s t-test; n = 167 for WT, n = 159 for Plxnd1 cKO in three independent experiments. (I) Representative images of Drd1a+MSNs at DIV6 derived from WT or Plxnd1 cKO mice. Scale bar, 50 μm. (J) Quantification of neurite length in (I). Student’s t-test; n = 339 for WT, n = 403 for Plxnd1 cKO in three independent experiments. (K) Representative images of GFP- or Mtss1-myc-transfected-Drd1a+MSNs at DIV6 derived from WT or Plxnd1 cKO mice. Scale bar, 50 μm. (L) Quantification of neurite length in (K). Error bars, mean ± SEM; *p<0.05, ****p<0.0001 by one-way ANOVA with Tukey’s post hoc correction for multiple comparisons; n = 163 for WT + GFP, n = 187 for Plxnd1 cKO + GFP, n = 195 for Plxnd1 cKO + Mtss1-myc in three independent experiments. Error bars, mean ± SEM; ns p>0.05, *p<0.05, ****p<0.0001 by indicated statistical tests.

Figure 3.

Figure 3—figure supplement 1. Expression of Mtss1 induces I-BAR domain-dependent morphological changes in COS7 cells, generating protrusions.

Figure 3—figure supplement 1.

(A) Western blot images showing that weakly expression of endogenous Mtss1 was not altered by overexpression of Plexin-D1 with or without Sema3E in COS7 cells. Asterisk indicates nonspecific band. (B) Quantification of the band intensity in (A). Error bars, mean ± SEM; ns p>0.05 by two-way ANOVA with Bonferroni’s post hoc correction for multiple comparisons; n = 3. (C) Schematics describing the full-length construct of Mtss1-myc and its deletion mutant constructs (Mtss1ΔI-BAR-myc, Mtss1ΔWH2-myc, and I-BAR-myc). (D) Immunocytochemistry images taken after overexpression of each construct. Constructs show the I-BAR domain leading to diverse cell protrusion morphologies. Some of the protrusions were excessively spiked or thin and long (arrowheads). Overexpression of the I-BAR domain only (I-BAR-myc) can induce extreme protrusion structures. Scale bar, 20 μm.
Figure 3—figure supplement 1—source data 1. Western blots shown in Figure 3—figure supplement 1A.

The Mtss1 I-BAR domain binds to Plexin-D1, and this interaction is Sema3E-independent

Since both Plexin-D1 and Mtss1 regulate actin cytoskeletal rearrangement as a guidance molecule and membrane transformer, respectively, near the cell surface, we speculated that Plexin-D1 and Mtss1 might interact with each other via the BAR domain to induce actin-related cellular events. To test whether Plexin-D1 and Mtss1 can physically interact, we generated multiple deletion constructs of human Plexin-D1 and Mtss1 (Figure 4A). When we overexpressed full-length Plexin-D1 and Mtss1 together in HEK293T cells, both proteins were successfully pulled down together (Figure 4B). However, Plexin-D1 with the intracellular domain (ICD) deleted failed to bind Mtss1, indicating an intracellular Plexin-D1 and Mtss1 interaction (Figure 4C). When we overexpressed full-length Plexin-D1 and each Mtss1 deletion construct, every Mtss1 construct containing the I-BAR domain coprecipitated with Plexin-D1, but I-BAR-deficient Mtss1 failed to interact with Plexin-D1 (Figure 4D). In a previous study, it was determined that Plexin-D1 interacts with SH3-domain binding protein 1 (SH3BP1), another protein of the BAR domain family (Tata et al., 2014), thus we investigated whether Plexin-D1 also binds to other BAR domain-containing proteins in general. As previously reported, we found that overexpression of Plexin-D1 in HEK293T cells resulted in the formation of a complex with overexpressed SH3BP1 (Figure 4—figure supplement 1A). However, it did not form a complex with srGAP2, a protein containing an F-BAR domain, or IRSP53, another protein containing an I-BAR domain like Mtss1 (Figure 4—figure supplement 1B and C). Conversely, we also examined whether Mtss1 can interact with other members of the Plexin family. As shown in Figure 4—figure supplement 1D and E, overexpressed Mtss1 was unable to form a complex with Plexin-B2 or -B3 proteins. These findings suggest that the formation of the Plexin-D1-Mtss1 complex is relatively specific.

Figure 4. The Mtss1 I-BAR domain directly binds to Plexin-D1, independent of Sema3E.

(A) Schematics depicting full-length constructs of Mtss1 and its truncation mutants. (B) Coimmunoprecipitation and immunoblot analysis of HEK293T cells transfected with Mtss1-myc with vsv-Plexin-D1. The interaction between Mtss1 and Plexin-D1 was investigated by immunoprecipitation with anti-vsv (left) or anti-myc (right) antibodies and subsequent western blotting with reciprocal antibodies. (C) Immunoprecipitation and western blot analysis after Plexin-D1 and Mtss1 overexpression. The vsv-Plexin-D1ΔICD did not bind to Mtss1-myc. (D) Immunoprecipitation and western blot assays to identify the binding domain in Mtss1 that interacts with Plexin-D1. (E) The interaction between Mtss1 and Plexin-D1 was assessed over time following treatment with Sema3E (2 nM) and was not affected by AP-Sema3E treatment. (F) Graph quantifying the band intensity in (E). Error bars, mean ± SEM; ns p>0.05 by two-way ANOVA with Bonferroni’s post hoc correction for multiple comparisons; n = 3 in three independent experiments. (G) Pull-down assay and visualization of the protein bands using Coomassie staining. His-Mtss1-IBAR binds directly to Plexin-D1-ICD-strep.

Figure 4—source data 1. Western blots and gel shown in Figure 4B, C, D, E, and G.

Figure 4.

Figure 4—figure supplement 1. The interaction between BAR domain-containing proteins and Plexin-D1, or between Mtss1 and Plexin family proteins.

Figure 4—figure supplement 1.

(A–C) Coimmunoprecipitation and immunoblot analysis of HEK293T cells transfected with BAR family genes (SH3BP1-HA (N-BAR), HA-srGAP2 (F-BAR), and IRSP53-Flag (I-BAR)) with vsv-Plexin-D1. (D, E) Immunoprecipitation and western blot analysis after overexpression of Mtss1-myc and Plexin proteins (vsv-Plexin-B2 and vsv-Plexin-B3). The vsv-Plexin-B2 and vsv-Plexin-B3 did not bind to Mtss1-myc.
Figure 4—figure supplement 1—source data 1. Western blots shown in Figure 4—figure supplement 1A–E.

Since Sema3E binding to Plexin-D1 caused SH3BP1 release from the complex (Tata et al., 2014), we examined whether Sema3E binding influences Mtss1 dissociation from Plexin-D1. In contrast to the effect on SH3BP1, Sema3E treatment did not interfere with Plexin-D1-Mtss1 complex formation, indicating that the complex is formed in a Sema3E-independent manner (Figure 4E and F). Moreover, to determine whether Plexin-D1 and Mtss1 can bind directly to each other, we performed an in vitro protein–protein binding assay using the purified ICD of Plexin-D1 and the I-BAR domain of Mtss1 proteins. As shown in Figure 4G, both proteins precipitated together, suggesting that Plexin-D1 and Mtss1 play a role as direct binding partners.

Mtss1 transports Plexin-D1 to the growth cone in cultured direct-pathway MSNs

Because of the high probability of localization of the Plexin-D1-Mtss1 complex at the cell membrane, Mtss1 may regulate Plexin-D1 function at the cell surface. To investigate the role of Mtss1 in Plexin-D1 activity, we first examined whether Mtss1 affects the Plexin-D1 level on the plasma membrane by performing a surface molecule biotinylation analysis. We observed that overexpressed Plexin-D1 proteins in COS7 cells were efficiently biotinylated on the cell surface, but the Plexin-D1 protein level on the surface was not changed during Mtss1 coexpression (Figure 5—figure supplement 1A and B). Another potential mechanism by which Mtss1 may affect Plexin-D1 activity might be endocytic regulation because Plexin-D1 is rapidly endocytosed after Sema3E treatment (Burk et al., 2017). However, Mtss1 coexpression did not affect Sema3E-induced Plexin-D1 endocytosis (Figure 5—figure supplement 1C and D). Additionally, Mtss1 overexpression did not change the binding affinity of Sema3E for Plexin-D1 (Figure 5—figure supplement 1E). These data, including those regarding Sema3E-independent complex formation (Figure 4E and F), suggest that Mtss1 does not directly affect the functional role of Sema3E-Plexin-D1 at the cell-surface level.

We next hypothesized that Mtss1 forms a complex with Plexin-D1 that targets Plexin-D1 to filopodium-like structures since we observed that Mtss1 is mainly involved in protrusion formation and neurite outgrowth in cultured cells. To test this possibility, we coexpressed Plexin-D1 and Mtss1 and analyzed their localization in COS7 cells. As shown in Figure 5—figure supplement 1F and G, when Plexin-D1 and Mtss1 were coexpressed, both proteins were mostly present in F-actin-enriched protrusions. However, overexpression of Plexin-D1 lacking the ICD overlapped with Mtss1 to a lesser extent than overexpression of wild-type Plexin-D1, whereas Mtss1 was abundant in the protrusions. In addition, Mtss1 lacking the I-BAR domain, which possesses membrane-bending activity, did not generate filopodia-like protrusions in COS7 cells but was localized with F-actin, including in marginal areas, probably via the Mtss1 WH2 domain (Mattila et al., 2003). Interestingly, although Plexin-D1 was evenly distributed throughout a cell, most Plexin-D1 was not present with Mtss1 missing the I-BAR domain. In addition, the localization of Plexin-D1 and Mtss1 in the protrusions was also not disturbed in the presence of Sema3E (Figure 5—figure supplement 1H). These results suggest that Mtss1 not only induces cell protrusion formation but also contributes to Plexin-D1 localization to specific sites.

Next, to confirm that Mtss1 leads Plexin-D1 to protrusive structures, such as growth cones in cultured neurons, Mtss1 and Plexin-D1 localization was analyzed by transfecting Mtss1-deficient striatal neurons with expression constructs carrying both proteins. Both overexpressed Plexin-D1 and Mtss1 proteins seemed to be colocalized along growing neurites, but the Mtss1 mutant lacking the I-BAR domain showed reduced Plexin-D1 level as well as a low colocalization rate (Figure 5A–C). As shown in COS7 cells (Figure 5—figure supplement 1F), wild-type Mtss1 proteins were present with Plexin-D1 in F-actin-enriched regions of growth cones; in contrast, mutant Mtss1 was expressed at a lower level than wild-type Mtss1 and failed to colocalize with Plexin-D1, resulting in reduced Plexin-D1 localization in the growth cone (Figure 5D–F). However, the intensity of Plexin-D1 upon co-expression of wild-type Mtss1 or mutant Mtss1 remained unchanged in the cell body (Figure 5—figure supplement 2A and B). It is plausible that overexpressed proteins accumulate in the soma, and a limited proportion of them are destined to the axon terminal on demand (Droz et al., 1973). To explore the role of Mtss1 in transporting Plexin-D1, we directly monitored the movement of Plexin-D1 along neurites in real time by imaging Drd1a-positive MSNs expressing Plexin-D1-GFP fusion proteins in wild-type and Mtss1-knockout neurons at DIV6. Our live-cell imaging showed that the majority of Plexin-D1-containing vesicles were dynamically transported in both proximal and distal directions in wild-type MSNs. In contrast, the Plexin-D1-positive vesicles in Mtss1-deficient MSNs remained stationary, and their overall numbers in neurites were also slightly reduced (Figure 5G–K and Videos 1–4). These observations demonstrate that Mtss1 facilitates the dynamic transportation of Plexin-D1 along the growing neurites of direct-pathway MSNs, leading to an increased rate of Plexin-D1 localization in the growth cones.

Figure 5. Mtss1 facilitates Plexin-D1 transport to the growth cone in cultured Drd1a-positive medium spiny neurons (MSNs).

(A) Immunocytochemistry for Mtss1-myc or Mtss1ΔI-BAR -myc (green), vsv-Plexin-D1 (red) in the axons of MSNs transfected with vsv-Plexin-D1 and Mtss1-myc or Mtss1ΔI-BAR-myc, using Mtss1-null mice as a background. The images were acquired using structured illumination microscopy (N-SIM). Scale bar, 5 μm. (B) Quantification of the fluorescence intensity in the axons of (A). Two-way ANOVA with Tukey’s post hoc correction for multiple comparisons; vsv-Plexin-D1+Mtss1-myc, n = 21, and vsv-Plexin-D1+Mtss1ΔI-BAR-myc, n = 14. (C) Quantification of colocalization by Pearson’s correlation coefficient calculated using Costes’ randomized pixel scrambled image method. Student’s t-test; vsv-Plexin-D1+Mtss1-myc, n = 21, and vsv-Plexin-D1+Mtss1ΔI-BAR-myc, n = 14. (D) Immunocytochemistry for vsv-Plexin-D1 (red), Mtss1-myc (green), and F-actin (gray) in the growth cones of MSNs transfected with vsv-Plexin-D1 and Mtss1-myc or Mtss1ΔI-BAR-myc originating from Mtss1-null mice. Scale bar, 5 μm. (E) Quantification of the intensities in the growth cones. The values represent the average fold change in expression compared to the control samples (vsv-Plexin-D1+Mtss1-myc). Two-way ANOVA with Tukey’s post hoc correction for multiple comparisons; vsv-Plexin-D1+Mtss1-myc, n = 8, and vsv-Plexin-D1+Mtss1ΔI-BAR-myc, n = 9. (F) Quantification of colocalization by Pearson’s correlation coefficient calculated using Costes’ randomized pixel scrambled image method. Student’s t-test; vsv-Plexin-D1+Mtss1-myc, n = 8, and vsv-Plexin-D1+Mtss1ΔI-BAR-myc, n = 9. (G) Representative time-lapse images of Plexin-D1-GFP-positive vesicles (green) from wild-type or Mtss1 conditional knockout (cKO) MSNs at DIV6. Plexin-D1-positive vesicles transported toward distal or proximal directions are indicated by red and yellow arrowheads, respectively. White arrowheads indicate stationary vesicles. A mean velocity of less than 0.1 μm/s was considered to be a stationary condition. See Videos 1–4. Scale bar, 5 μm. (H–J) Quantification of mean velocity (H), total travel distance (I), and number of vesicles (J) along neurites of Plexin-D1-positive vesicles. Student’s t-test; n = 23 for WT, n = 25 for Mtss1 cKO in four independent experiments. (K) Distribution analysis of vesicle directionality. (L) The AP-Sema3E binding assay was performed to visualize Plexin-D1 protein (black arrows) in the growth cones of WT or Plxnd1-deficient MSNs. Scale bar, 10 μm. (L) The AP-Sema3E binding assay performed to visualize Plexin-D1 protein (black arrows) in the growth cones of WT or Mtss1-deficient MSNs. Localization of Plexin-D1 (black arrows) in the growth cone investigated in cultured MSNs from WT (Drd1a-tdT; Mtss1f/f) or Mtss1 cKO (Drd1a-tdT; Nes-cre; Mtss1f/f) mice. (M) Quantification of Plexin-D1 intensity shown in (L). Mann‒Whitney test; WT n = 51, KO n = 50. Error bars in all graphs, mean ± SEM; *p<0.05, **p<0.01, ***p<0.001. ****p<0.0001 by indicated statistical tests.

Figure 5.

Figure 5—figure supplement 1. Mtss1 expression alters Plexin-D1 localization to the protrusion structure in COS7 cells without affecting its endocytosis or Sema3E binding.

Figure 5—figure supplement 1.

(A) Cell surface biotinylation and subsequent Western blot analysis to analyze the surface localization of Plexin-D1 in COS7 cells. (B) Quantification of the surface Plexin-D1 level as shown in (A). The values represent the averages of the fold ratios compared to those of total Plexin-D1. Error bars, mean ± SEM; ns p>0.05 by Student’s t-test; n = 3. (C) Endocytosed biotinylated vsv-PlexinD1 was detected by western blot analysis following cell surface stripping in the presence or absence of AP-Sema3E (2 nM). (D) Quantification of the band intensity shown in (C). The values in the graph represent the average fold change compared to the expression in control samples (vsv-Plexind1 treated with AP-Sema3E). (E) AP-Sema3E binding assay to test the effect of Mtss1 on the interaction between Sema3E and Plexin-D1. Error bars, mean ± SEM; ns p>0.05 by Kruskal‒Wallis test with Dunn’s post hoc correction for multiple comparisons; n = 8 for vsv-Plexin-D1+AP; n = 7 for vsv-Plexin-D1+Mtss1-myc+AP, n = 8 for vsv-Plexin-D1+Mtss1-myc+AP, and n = 8 for vsv-Plexin-D1+Mtss1-myc+AP-Sema3E, in three independent experiments. (F) Immunocytochemistry for vsv-Plexin-D1 (red), Mtss1-myc (green), and F-actin (gray) in COS7 cells. Images were obtained by structured illumination microscopy (N-SIM). White arrows (top) indicate colocalized Plexin-D1 and Mtss1 in the protrusion structure. White arrowheads (middle) indicate high Mtss1 levels localized in cell protrusions without Plexin-D1. Yellow arrows (bottom) indicate the normal cell surface with Mtss1ΔI-BAR but no Plexin-D1 colocalization. Scale bar, 5 μm. (G) Quantification of colocalization rates shown in (F) between vsv signals and myc signals was assessed by Pearson’s correlation coefficient calculated using Costes’ randomized pixel scrambled image method. Error bars, mean ± SEM; *p<0.05, **p<0.01, ****p<0.0001 by one-way ANOVA with Tukey’s post hoc correction for multiple comparisons; vsv-Plexin-D1+Mtss1 myc, n = 12; vsv-Plexin-D1ΔICD + Mtss1-myc, n = 12; vsv-Plexin-D1+Mtss1DI-BAR-myc, n = 11. (H) Immunocytochemistry for vsv-Plexin-D1 (red) and Mtss1-myc (green) with or without AP-Sema3E in COS7 cells. The white dotted boxes are magnified in the panels on the right. The presence of Sema3E did not affect the positioning of Plexin-D1 and Mtss1 within the protrusion (arrowheads). Scale bars, 50 μm (left) and 20 μm (magnified images on the right two panels).
Figure 5—figure supplement 1—source data 1. Western blots shown in Figure 5—figure supplement 1A and C.
Figure 5—figure supplement 2. No significant alteration in the expression of vsv-Plexin-D1 or Mtss1-myc or Mtss1ΔI-BAR-myc in the medium spiny neuron (MSN) soma.

Figure 5—figure supplement 2.

(A) Representative image of Immunocytochemistry for vsv-Plexin-D1 (red), Mtss1-myc or Mtss1ΔI-BAR -myc (green) in the cell body of cultured MSNs transfected with vsv-Plexin-D1 and Mtss1-myc or Mtss1ΔI-BAR-myc, using Mtss1-null mice as a background. (B) Quantification of the fluorescence intensity in the cell body of (A). Error bars, mean ± SEM; ns p>0.05 by two-way ANOVA with Tukey’s post hoc correction for multiple comparisons; vsv-Plexin-D1+Mtss1 myc, n = 5, and vsv-Plexin-D1+Mtss1ΔI-BAR-myc, n = 5. Scale bar, 5 μm.

Video 1. Time-lapse live imaging of Plexin-D1-GFP-positive vesicles (green) from wild-type medium spiny neurons (MSNs) at DIV6_1.

Download video file (1MB, mp4)

Video 2. Time-lapse live imaging of Plexin-D1-GFP-positive vesicles (green) from wild-type medium spiny neurons (MSNs) at DIV6_2.

Download video file (6.1MB, mp4)

Video 3. Time-lapse live imaging of Plexin-D1-GFP-positive vesicles (green) from Mtss1 conditional knockout (cKO) medium spiny neurons (MSNs) at DIV6_1.

Download video file (1.9MB, mp4)

Video 4. Time-lapse live imaging of Plexin-D1-GFP-positive vesicles (green) from Mtss1 conditional knockout (cKO) medium spiny neurons (MSNs) at DIV6_2.

Download video file (999.5KB, mp4)

Moreover, to examine whether endogenous Mtss1 expression affects Plexin-D1 localization in the growth cone, leading to an active guidance role, we performed an AP-Sema3E binding analysis in Drd1a-positive MSNs at DIV6 (Gu et al., 2005). The AP-Sema3E binding assay has been used in many previous studies as an alternative method to detect endogenous Plexin-D1 protein due to the lack of reliable anti-Plexin-D1 antibodies (Bellon et al., 2010). The Mtss1-knockout neurons exhibited a low level of AP-Sema3E binding in the growth cones, indicating that the endogenous trafficking of Plexin-D1 to the tip of the growing axon is disrupted in the absence of Mtss1 (Figure 5L and M). These results suggest that Mtss1 serves to deliver Plexin-D1 to the growth cone.

Plexin-D1 trafficking to the growth cone by Mtss1 potentiates the repulsive response to Sema3E

Because Mtss1 facilitates Plexin-D1 transport to the growth cone, proper Plexin-D1 localization at the membrane may contribute to the triggering of repulsive signaling by Plexin-D1 in response to Sema3E. To test this hypothesis, we performed a growth cone collapse assay at DIV3 in direct-pathway MSNs and found that wild-type Drd1a-tdT-positive striatal neurons underwent a high collapse rate after exogenous Sema3E treatment, whereas the growth cones of neurons lacking Mtss1 did not collapse at a significantly different rate (Figure 6A and B). However, reintroduction of wild-type Mtss1 into Mtss1-knockout MSNs resulted in growth cone collapse, but overexpressed Mtss1 lacking the I-BAR domain showed less response to Sema3E (Figure 6C and D). In addition, Plxnd1-null MSNs also showed a very low collapse rate regardless of Sema3E addition at DIV6 (Figure 6E), consistent with a previous report that Sema3E-Plexin-D1 signaling acts as a repulsive guidance cue (Chauvet et al., 2007). The reduced collapse phenotypes were rescued by overexpression of full-length Plexin-D1 but not by ICD-deleted Plexin-D1 (Figure 6F). In summary, Mtss1 targeting of Plexin-D1 to the growth cone is critical for robust Sema3E-induced repulsive signaling.

Figure 6. The repulsive response through Sema3E-Plexin-D1 signaling is attenuated in the absence of Mtss1.

Figure 6.

(A) A growth cone collapse assay in the presence or absence of Sema3E (2 nM) was performed with medium spiny neuron (MSN) cultures derived from wild-type (WT) (Drd1a-tdT; Mtss1f/f) or Mtss1-KO (Drd1a-tdT; Nes-cre; Mtss1f/f) mice at DIV3. Scale bar, 10 μm. The images were obtained from structured illumination microscopy (N-SIM). (B) Quantification of collapsed growth cones in (A). Error bars, mean ± SEM; ***p<0.001, ****p<0.0001 by χ2 test; WT + AP, n = 155, WT + AP-Sema3E, n = 163, KO + AP, n = 149, KO + AP-Sema3E, n = 149. (C) A growth cone collapse assay in the presence or absence of Sema3E (2 nM) was performed with MSN cultures following ectopic expression of Mtss1-myc or Mtss1ΔΙ−ΒΑR-myc in the Mtss1-null background at DIV3. Scale bar, 10 μm. (D) Quantification of collapsed growth cones in (C). Error bars, mean ± SEM; ***p<0.001, ****p<0.0001 by χ2 test; Mtss1-myc+AP, n = 28, Mtss1-myc+AP-Sema3E, n = 28, Mtss1ΔI-BAR-myc+AP, n = 28, Mtss1ΔΙ−ΒΑR-myc+AP-Sema3E, n = 43. (E) Quantification of the collapse assay in the presence or absence of Sema3E (2 nM) was performed with MSN cultures at DIV6 from WT (Drd1a-tdT; Plxnd1f/f) or Plxnd1-KO (Drd1a-tdT; Nes-cre; Plxnd1f/f) mice. ****p<0.0001 by χ2 test; WT + AP, n = 44, WT + AP-Sema3E, n = 45, KO + AP, n = 45, KO + AP-Sema3E, n = 46. in three independent experiments. (F) Quantification of a growth cone collapse assay in the presence or absence of Sema3E (2 nM) was performed with MSN cultures following ectopic expression of vsv-Plexin-D1 or vsv-Plexin-D1ΔICD in the Plxnd1-KO background at DIV6. ****p<0.0001 by χ2 test; vsv-Plexin-D1+AP, n = 35, vsv-Plexin-D1+AP-Sema3E, n = 32, vsv-Plexin-D1ΔICD + AP, n = 30, vsv-Plexin-D1ΔICD + AP-Sema3E, n = 26 in three independent experiments. tdT, tdTomato.

Absence of Mtss1 reduces projection density and Plexin-D1 localization in the striatonigral pathway

First, to determine whether Mtss1 is indeed expressed in the projecting striatonigral axons and their destination, the SNr, we performed immunostaining using wild-type or Mtss1-knockout mouse brains. We observed Mtss1 localization in the striatonigral tract and SNr, but the immunostaining signal disappeared in Mtss1-deficient mice (Figure 7—figure supplement 1). Although we also detected Mtss1 in the SNr region, we could not rule out the possibility that substantia nigra neurons express Mtss1 at this stage. Next, to investigate the role of Mtss1 in striatonigral pathway development in vivo, we performed an AP-Sema3E binding assay to examine the Plexin-D1-positive tract in brain tissue (Chauvet et al., 2007). In mice expressing wild-type Mtss1, a significant amount of Plexin-D1 was observed in the neuronal tract reaching the substantia nigra. In contrast, Mtss1-knockout mice exhibited a relatively small area of Plexin-D1-positive striatonigral tracts, including both poor neuronal projection and reduced Plexin-D1 localization at E17.5 (Figure 7A–D). In addition, despite these reduced neuronal projections in the Mtss1-knockout mice, the density of the AP-Sema3E-positive tracts was reduced even more (Figure 7E), indicating that the absence of Mtss1 prevents both normal axonal projections and Plexin-D1 trafficking. In the coronal view, the bundle density of Plexin-D1-positive projections passing between the rTh and Gp was reduced in the Mtss1-knockout mice (Figure 7F). Because most mice with conditional Nestin-Cre-driven Mtss1 deletion were born alive, we analyzed the Plexin-D1-positive striatonigral pathway at P5. Consistent with the results obtained with E17.5 embryos, Mtss1-deficient neonates showed fewer Plexin-D1-positive striatonigral projections in the coverage area and a reduced path width (Figure 7G–J).

Figure 7. A reduced number of Plexin-D1 molecules localize to the developing striatonigral projections in Mtss1-deficient mice.

(A) AP-Sema3E binding assay (top) to detect Plexin-D1 expression (white arrows) in striatonigral projections and immunohistochemistry (bottom) for neurofilaments (NFs) indicated by red dotted square, performed in adjacent parasagittal sections at E17.5 of wild-type (WT) or Mtss1 conditional knockout (cKO) mice. The diminished projections are marked by white brackets (middle of the striatum) and arrowheads (near substantia nigra regions). Scale bar, 500 μm. (B) Quantification of the Plexin-D1-positive area in the total striatonigral projection at E17.5 of WT or Mtss1 cKO mice. Student’s t-test; WT, n = 12, KO, n = 12 (three sections/mouse). (C) Quantification of the fluorescence density (intensity/area) of NF in striatonigral projections at E17.5 in WT or Mtss1 cKO mice. Student’s t-test; WT, n = 16, KO, n = 17 (three or four sections/mouse). (D) Quantification of the AP density (intensity/area) in striatonigral projections at E17.5 in WT or Mtss1 cKO mice. Student’s t-test; WT, n = 16, KO, n = 17 (three or four sections/mouse). (E) The ratio of AP to NF density (intensity/area). Student’s t-test; WT, n = 16, KO, n = 17 (three or four sections/mouse). (F) Coronal view of Plexin-D1 localization in striatonigral projections at E17.5 in WT or Mtss1 cKO mice. Yellow dotted lines indicate the corridor between the thalamus and globus pallidus. Insets show the images in dotted boxes at higher resolution. Scale bar, 200 μm. (G) Representative images of Plexin-D1 molecules in striatonigral projections visualized by AP-Sema3E binding assay in WT or Mtss1 cKO mice at P5. White arrows indicate striatonigral projections. Scale bar, 1 mm. (H) Schematic representing the quantified region. The dotted blue lines indicate the striatonigral projection-covering areas. The width (red segment) of the striatonigral tract was measured as previously described (Burk et al., 2017). (I, J) Quantification of the Plexin-D1-positive area (%) in dotted blue area and projection width at P5 according to the scheme shown in (H). Mann‒Whitney test (I) and Student’s t-test (J). n = 18 (three sections/mouse). (K) Immunohistochemistry of coronal sections of striatal projections labeled with td-Tomato endogenously expressed through the Drd1a promotor in WT (Drd1a-tdT; Mtss1f/f) or Mtss1 cKO mice (Drd1a-tdT; Nes-cre; Mtss1f/f) at P5. The white dotted boxes on the left images are shown in the inset images on the right, which were captured in a single plane using a high-resolution confocal microscope. Scale bar, 500 μm. (L, M) Quantification of the density (intensity/area) (L) and area size (M) of the striatonigral projection in the dotted region in the inset images. Mann‒Whitney test (L) and Student’s t-test (M); n = 18 per group (six sections/mouse). (N) AP-Sema3E binding assay and tdT immunostaining in adjacent sections of WT or Mtss1 cKO mice located near the SNr. The green line in (H) indicates the location for cross-sectioning. The inset images of Plexin-D1-positive striatonigral projections were taken from the blue dotted boxes on the left panels. The dotted white lines indicate the tdT-positive striatonigral projections. Scale bar, 200 μm. (O, P) Quantification of the density (intensity/area) of tdT (O) and AP (P) of striatonigral projections WT or Mtss1 cKO mice. (Q) The ratio of AP to tdT density (intensity/area). Student’s t-test; WT, n = 18, KO, n = 18 (six sections/mouse). (R) Immunohistochemistry of coronal views of striatonigral projections in WT (Drd1a-tdT; Plxnd1f/f) or Plxnd1 cKO mice (Drd1a-tdT; Nes-cre; Plxnd1f/f) at P5. The white dotted boxes on the left images are shown in the inset images on the right, which were obtained using a high-resolution confocal microscope in a single plane. Scale bar, 500 μm. (S, T) Quantification of the density (intensity/area) of tdT (S) and area size (T). Student’s t-test; n = 18 per group (six sections/mouse). Error bars, mean ± SEM; *p<0.05, **p<0.01, ***p<0.001. ****p<0.0001 by indicated statistical tests. str, striatum; cx, cortex; Th, thalamus; SNr, substantia nigra; EP, entopeduncular nucleus; Gp, globus pallidus; Hp, hippocampus.

Figure 7.

Figure 7—figure supplement 1. Expression of Mtss1 in the striatonigral tract and SNr at P5.

Figure 7—figure supplement 1.

(A) Illustration showing the region acquired for the striatonigral tract (area 1) and SNr (area 2). (B) Immunohistochemistry showing tdTomato-expressing Drd1a+MSNs (red) and Mtss1 (green) in the striatonigral tract (area 1) and SNr (area 2) in wild-type (WT) (Drd1a-tdT; Mtss11f/f) or Mtss1 conditional knockout (cKO) mice (Drd1a-tdT; Nes-cre; Mtss1f/f) at P5. The white arrow indicates that Mtss1 was expressed in the striatonigral tract (white star). Scale bars, 100 μm.
Figure 7—figure supplement 2. Mtss1 or Plexin-D1 deficiency reduced striatonigral axonal bundles without altering striatonigral projection patterns at P30.

Figure 7—figure supplement 2.

(A) Immunohistochemistry of coronal section images in wild-type (WT) or Mtss1 conditional knockout (cKO) mice at P30. The white dotted boxes on the left images are shown in the inset images, which were captured in a single plane using a high-resolution confocal microscope. Scale bar, 500 μm. (B, C) Quantifications as described for the results obtained at P5. Error bars, mean ± SEM; ****p<0.0001 by Mann‒Whitney test (B) and ns p>0.05 by Student’s t-test (C); n = 18 per group (six sections/mouse). (D) Coronal images of striatonigral projections in WT or Plxnd1 cKO mice at P30. Scale bar, 500 μm. (E, F) Quantification of the density (intensity/area) (E) and the area size (F) at P30. Error bars, mean ± SEM; **p<0.01 by Mann‒Whitney test (E) and ns p>0.05 by Student’s t-test (F); n = 18 per group (six sections/mouse). (G, H) Representative images showing parasagittal sections of brains from WT or Mtss1 cKO mice (G) or Plxnd1 cKO (H). The white boxes on the left images are shown in the inset image on the right. Misguided striatonigral projections were not observed at P30. Scale bar, 500 μm. Hp, hippocampus; str, striatum; cx, cortex; Th, thalamus; Gp, globus pallidus; SNr, substantia nigra.
Figure 7—figure supplement 3. The absence of Mtss1 does not affect medium spiny neuron (MSN) survival, dendritic arborization, and Plexin-D1 expression during striatonigral pathway development.

Figure 7—figure supplement 3.

(A) Immunohistochemistry staining for cleaved caspase 3 (CC3) in the striatum of wild-type (WT) or Mtss1 conditional knockout (cKO) mice. The white dotted boxes on the left images are shown in the inset images on the right at a better resolution. Scale bar, 25 μm. (B) Quantification of cell death by the number of CC3-positive cells in a 1 mm2 area covering the dorsal part of the striatum in WT or Mtss1 cKO mice. Error bars, mean ± SEM; ns p>0.05 by Mann‒Whitney test; WT, n = 20; Mtss1 cKO mice, n = 20 (five sections/mouse). (C) Representative images of Golgi staining at low (top panels) and high (bottom panels) magnification. Scale bars, 100 μm. Sholl analysis of dendritic morphology (D) and dendritic length (E) performed by using Neurolucida360 in 3D analysis. Error bars, mean ± SEM; ns p>0.05 by Student’s t-test; WT, n = 12, and Mtss1 cKO mice, n = 15, from three mice. (F, G) Western blot images and quantification of Plexin-D1 expression in the striatum of WT or Mtss1 cKO mice at P5. Error bars, mean ± SEM; *p<0.05 by Student’s t-test; WT mice, n = 3, and Mtss1 cKO mice, n = 4. (H) Plexin-D1 expression in MSNs obtained from the striatum of WT or Mtss1 cKO mice at P0 and measured at DIV6 in culture. (I) Quantification of the western blots shown in (H). Error bars, mean ± SEM; *p<0.05, by Student’s t-test; n = 3 for WT, n = 3 for KO in three independent experiments.
Figure 7—figure supplement 3—source data 1. Raw uncropped western blot & gel images.
Figure 7—figure supplement 4. Striatonigral projection defects are observed in Sema3e-null mice at P5.

Figure 7—figure supplement 4.

(A) Immunohistochemistry was performed on coronal sections from wild-type (WT) or Sema3e knockout (KO) mice at P5. The white dotted boxes on the left images are shown in the inset images, which were captured in a single plane using a high-resolution confocal microscope. Scale bar, 500 μm. (B, C) Quantification of the density (intensity/area) (B) and the area size (C) at P5. Error bars, mean ± SEM; ns p>0.05, ***p<0.001 by Student’s t-test; n = 18 per group (six sections/mouse). (D) Diagram depicting the width (red line) of the striatonigral pathway. (E) Quantification of the width of the striatonigral projections at P5. Error bars, mean ± SEM; ***p<0.001 by Student’s t-test; WT, n = 15, KO, n = 14 (3–4 sections/mouse). (F) Representative images showing parasagittal sections of brains from WT or Sema3e-KO mice at P5. White boxes are magnified on the right panels. Scale bar, 500 μm. The phenotype of misguided striatonigral projections was observed in three out of four Sema3e-KO mice at P5 (white arrowheads). (G) The number of deviated axonal bundles within the corresponding area (white boxes in F). Error bars, mean ± SEM; *p<0.05 by Student’s t-test; n = 4 mice for WT, n = 4 mice for KO.

To further identify Plexin-D1-positive striatonigral pathway defects, we crossed Drd1a-tdT transgenic reporter mice with conditional Mtss1-knockout mice and visualized the pathway in the offspring. Consistent with the results shown in AP-Sema3E binding experiments, the total boundary area with Drd1a-tdT-positive projections was smaller and less compact in the Mtss1-knockout mice than in the wild-type mice at P5 (Figure 7K–M). At P30, the projection density defects were more obvious, but the boundary area in the wild-type and mutant mice was not significantly different, indicating that Mtss1 deficiency led to the formation of fewer striatonigral axonal bundles (Figure 7—figure supplement 2A–C). We assumed that Mtss1 regulates the initial striatonigral axonal projection during development of the neonate and that the pathway establishment ends by P7 (Morello et al., 2015) therefore, the scarcity of the projections may be clearer when the brain increases to the adult size. Moreover, we examined whether Mtss1 expression affects Plexin-D1 levels on the Drd1a-tdT-positive tracks at P5 using the same methodology as employed at E17.5 (Figure 7A). Our findings revealed a decreased ratio of AP-Sema3E binding per tdT staining, suggesting that Mtss1 is implicated not only in axonal projections but also in Plexin-D1 trafficking in navigating striatonigral projections (Figure 7N–Q).

We then investigated whether Mtss1 specifically contributes to the development of descending striatonigral projections rather than dendritic arborization. Since global Mtss1-mutant mice have enlarged brain ventricles and decreased cortical thickness (Minkeviciene et al., 2019), we first examined whether the axonal projection in Mtss1-knockout mice is due to cellular death of MSNs in the striatum. Using cleaved caspase 3 staining to detect apoptotic cells, we found few dying cells in the wild-type and Mtss1-mutant neonates (Figure 7—figure supplement 3A and B), indicating that no significant cell pathology was induced by Mtss1 expression deficiency. Because Mtss1 is selectively expressed in direct-pathway MSNs, which comprise approximately 45% of striatal neurons (Figure 1), we expected that Golgi staining would be sufficient to detect any dendritic defects, such as aberrant number and/or length of branches. However, we found no detectable difference between the wild-type and Mtss1 mutants at P5 (Figure 7—figure supplement 3C–E). In addition, no significant change in Plexin-D1 levels was observed in the striatum or cultured neurons of Mtss1-deficient mice compared to those in littermate controls (Figure 7—figure supplement 3F–I). These results indicate that the weakening of the Plexin-D1-positive striatonigral pathway in Mtss1-knockout mice is caused by both impairments of neuronal projections and inappropriate Plexin-D1 distribution due to Mtss1 downregulation.

The absence of Plexin-D1 or Sema3E reduces the axonal projection of direct-pathway MSNs

Since Mtss1 expression is under the control of Sema3E-Plexin-D1 signaling, we investigated whether Plxnd1 deletion leads to phenocopying of the striatonigral projection defects observed in Mtss1-knockout mice. During the neonatal period, the boundary area and compactness of descending striatonigral projections were small and loose in the Plxnd1-knockout mice, but only a reduced projection density was observed in adult mice, which was similar to that of Mtss1-knockout mice (Figure 7R–T, Figure 7—figure supplement 2D–F). Moreover, Sema3e-knockout at P5 also showed these projection defects, albeit somewhat milder compared to those observed in Plxnd1- or Mtss1-deficient mice (Figure 7—figure supplement 4A–E). These phenocopy results suggest that activation of Sema3E-Plexin-D1 signaling, which leads to induction of Mtss1, is required for the striatonigral trajectory during the axonal pathfinding period.

Absence of Mtss1 or Plexin-D1 results in irregular projection patterns in direct-pathway MSNs

Subsequently, we examined whether striatonigral projection patterns are altered by Mtss1 deficiency. Interestingly, we observed that the descending striatonigral projections in the wild-type mice were relatively straight and untangled near the Gp region through the sagittal view (Figure 8A). When visualizing the striatonigral projection using 3D imaging by sparsely labeling with DiI injection at the dorsal striatum, the axonal bundles appeared relatively fasciculated and straight in the wild-type at P5 (Figure 8B and C). However, Mtss1 mutants showed irregular projection patterns with random directionality and mild defasciculation (Figure 8A–C). To assess axonal deviation, we measured the number of projections intersecting each other in the same region, as shown in Figure 8A and B. The deficiency of Mtss1 led to more deviant ectopic projections (Figure 8E). However, the misguidance defects were not apparent at P30, likely because abnormal projections were discarded as mice matured into adults (Figure 7—figure supplement 2G). These results suggest that inefficient Plexin-D1 trafficking to the extending axons in the Mtss1-knockout mice may have weakened the proper guidance response.

Figure 8. Direct-pathway medium spiny neurons (MSNs) exhibit irregular projection patterns in the absence of either Mtss1 or Plexin-D1.

(A) Immunohistochemistry of parasagittal sections of striatonigral projections labeled with Drd1a-tdT in wild-type (WT) or Mtss1 conditional knockout (cKO) mice at P5. The white boxes on the left images are shown in the inset image on the right. Misguided striatonigral projections are indicated by white arrowheads. The phenotype was observed in five out of five Mtss1 cKO mice at P5. Scale bar, 500 μm. (B) Schematics depicting DiI injection (red asterisk) into the dorsal striatum for sparse labeling of striatonigral projections. The regions indicated in the blue square were captured for three-dimensional (3D) visualization. (C) Representative 3D images of DiI-labeled axonal tracks in WT or Mtss1 cKO mice at P5. Compared to the fasciculated straight projections in WT (top panels), the striatonigral projections of Mtss1 cKO mice presented relatively defasciculated (bottom panels) and occasionally severely misrouted patterns (white arrow in the bottom-right panel). The phenotype was observed in three out of three Mtss1 cKO mice. Scale bar, 200 μm. (D) Representative images showing parasagittal sections of brains from WT or Plxnd1 cKO mice at P5. The misrouted projections are also indicated by white arrowheads in the magnified inset images. The phenotype was observed in four out of four Plxnd1 cKO mice at P5. Scale bar, 500 μm. (E, F) Quantification of the number of intersecting axonal bundles within the corresponding area from Mtss1 cKO (A) or Plxnd1 cKO (D). (E) Student’s t-test; n = 5 mice for WT, n = 5 mice for Mtss1 cKO. (F) Student’s t-test; n = 5 mice for WT, n = 4 mice for Plxnd1 cKO. Error bars, mean ± SEM; **p<0.01, ***p<0.001 by indicated statistical tests. (J) Model showing that Mtss1, upregulated by the Sema3E-Plexin-D1 signaling pathway, promotes axonal growth and directs Plexin-D1 to the growth cone to receive a repulsive guidance signal.

Figure 8.

Figure 8—figure supplement 1. No Mtss1 was found in endothelial cells at E14.5, and no vascular defects were observed in Mtss1-conditional knockout (KO) mice.

Figure 8—figure supplement 1.

(A) Fluorescence in situ hybridization for Plxnd1 mRNA (green) and Mtss1 mRNA (red) in the brain and dorsal trunk at E14.5. White dotted boxes are shown in the inset image on the bottom. Scale bars, 100 μm for brain, 50 μm for dorsal trunk. (B) 3D vascular reconstruction analysis images after CD31 immunostaining and tissue clearing obtained using multifunctional fast confocal microscopy Dragonfly 502w. (C) Western blotting to analyze Mtss1 expression after AP-Sema3E (2 nM) treatment in human umbilical vein endothelial cells (HUVECs) or human cortical microvessel endothelial cells (HCMEC/D3). Error bars, mean ± SEM; ns p>0.05 by Mann‒Whitney test; AP, n = 4, AP-Sema3E, n = 4 for HUVECs, ns p>0.05 by Student’s t-test; AP, n = 4, AP-Sema3E, n = 4 for HCMEC/D3s in four dependent experiments.
Figure 8—figure supplement 1—source data 1. Western blots shown in Figure 8—figure supplement 1C.
Figure 8—figure supplement 2. Schematic summary showing striatonigral projection development via a serial reciprocal interaction of the Sema3E-Plexin-D1-Mtss1 complex.

Figure 8—figure supplement 2.

Previous studies have reported that Sema3E-Plexin-D1 signaling defects lead to ectopic projection during development or misguidance in the adult striatonigral pathway (Chauvet et al., 2007; Ehrman et al., 2013), but these phenotypes were not detected in our study. Instead, we also observed irregular projection patterns near the Gp in Plxnd1-knockout mice at P5 but not at P30 (Figure 8D and F, Figure 7—figure supplement 2H), similar to those seen in Mtss1-knockout mice. Moreover, Sema3e-knockout at P5 showed a few axonal bundles deviated from their typical trajectories (Figure 7—figure supplement 4F and G). These results demonstrate that Sema3E-Plexin-D1 signaling, probably in concert with Mtss1 molecules, is specifically involved in the proper guidance of descending striatonigral projections. Collectively, our results confirm that Sema3E-Plexin-D1 signaling activates Mtss1 action, through which striatonigral neurons are extended and steered through the proper route to the target destination (Figure 8J).

Finally, since Sema3E-Plexin-D1 is well known to regulate both neural and vascular development (Oh and Gu, 2013a), we wondered whether Mtss1 also plays a role in the vasculature as a downstream player of the common guidance cue. Although it was expressed in neuronal cells, Mtss1 was not detected in vascular endothelial cells expressing Plexin-D1 during development (Figure 8—figure supplement 1A). In addition, Mtss1-knockout mice did not result in an obvious intersomatic vasculature defect, which is a typical phenotype observed in Sema3e or Plxnd1 mutants (Burk et al., 2017; Gu et al., 2005; Figure 8—figure supplement 1B). Interestingly, Mtss1 was highly expressed in the two different types of cultured endothelial cells but was not controlled by Sema3E-Plexin-D1 signaling (Figure 8—figure supplement 1C). These results provide evidence that the activation of Mtss1 by the Sema3E-Plexin-D1 signaling pathway and its function in neurons could be selective and distinct.

Discussion

There are two main aspects of the traditional axon guidance concept: attractive cue-guided axon growth and repulsive cue-guided axon growth. In these processes, the axon terminals are constantly facing both types of signals en route to their destination. In the present study, we show that repulsive guidance cues, namely, Sema3E-Plexin-D1 pairs, induce a dual-functioning facilitator, Mtss1, through which navigating axons ensure incessant extension to their target tissues while exhibiting sensitivity and subsequent steering in response to repulsive signals. In our model (Figure 8—figure supplement 2), Plexin-D1 on the cell body of direct-pathway MSNs in the striatum receives its specific ligand, Sema3E, through the thalamostriatal projection at the late embryonic stage and induces a unique pool of regulatory factors, including Mtss1. Mtss1 then generates axonal projections to targets in the substantia nigra while enabling Plexin-D1 to transport along axons. In the growth cones, Mtss1 promotes membrane curvature to form a protruding filopodium, and Plexin-D1 is positioned on the cell surface to sense the external repulsive guidance signals from Sema3E. Currently, it is not clear whether Plexin-D1 and Mtss1 are present as a complex at the membrane surface of the growth cone, but Mtss1 does not seem to directly affect the repulsive signaling activation of Sema3E-Plexin-D1. In this way, Mtss1 provides an efficient transport system for its own activator during striatonigral axon growth and potentiates the repulsive guidance cue.

Gene expression by axon guidance signaling

Although many studies have reported the identification of proteins locally synthesized in the axon terminal (Jung et al., 2012), most proteins required for growth cone behavior are generated in and delivered from the soma. Because of the diverse roles of guidance molecules, such as driving neuronal cell migration, cell death, and axonal regeneration, as well as in traditional axonal navigation in the nervous system (Kolodkin and Tessier-Lavigne, 2011), guidance signaling is generally thought to be involved in the activation of a gene expression program in the nucleus. However, few studies have examined gene expression changes induced by guidance signaling at the level of transcriptional regulation, and the most definitive results have been obtained in the Drosophila model (Russell and Bashaw, 2018). A well-described example is the Frazzled (Fra) receptor in the regulation of midline axon crossing in Drosophila, where the truncated ICD of Fra is generated by gamma-secretase and enters the nucleus to activate transcription of the commissureless (comm) gene (Neuhaus-Follini and Bashaw, 2015). In a rodent model, microarray analysis of the Robo mutant revealed hundreds of DEGs that may be related to the dynamics of neuronal progenitors in the developing cortex (Yeh et al., 2014). Another example is Eph-Ephrin signaling in neural progenitor cells, where Ephrin-B1 reverse signaling downregulates miR-124 expression to inhibit neurogenesis as a posttranscriptional repressor (Arvanitis et al., 2010).

Through a bulk RNA-seq analysis, we showed that Sema3E-Plexin-D1 signaling changed the expression of specific genes, including Mtss1, required for the precise axon guidance of striatonigral neurons. Since ablation of Plexin-D1 expression results in the ectopic formation of thalamostriatal synapses on the MSN cell body as well as on dendrites (Ding et al., 2012), it is likely that Plexin-D1 is expressed in the soma of MSNs and is capable of transmitting gene expression signals. Although Sema3E-Plexin-D1 signaling regulated the expression of a set of genes in the present study, the precise signaling cascade that extends into the nucleus is still not completely understood. Nevertheless, we cannot dismiss the possibility that Mtss1 expression activation through Sema3E-Plexin-D1 signaling may be subject to post-transcriptional or translational regulatory mechanisms. Thus, to uncover the molecular mechanism through which these guidance molecules mediate specific gene expression or ensure stability, comprehensive studies on gene regulation in a suitable homogeneous cellular model are necessary. A growing body of evidence demonstrates that diverse extracellular stimuli induce mechanotransduction through dynamic changes in the actin and microtubule cytoskeletal networks, which depend on Rho family proteins to cascade signals in the cytosol and nucleus to activate gene expression (Dupont and Wickström, 2022; Giehl et al., 2015; Miralles et al., 2003; Percipalle and Visa, 2006; Samarakoon et al., 2010). Previously, Sema3E-Plexin-D1 signaling was shown to modulate such cytoskeletal rearrangement through the PI3K/Akt pathway in regulating endothelial cell mobility, axonal growth, and growth cone collapse (Aghajanian et al., 2014; Bellon et al., 2010; Burk et al., 2017). Likewise, we found that disturbance of Akt signaling reduced Mtss1 expression in young cultured MSNs, suggesting that activation of Sema3E-Plexin-D1 signaling induces specific molecule expression through similar Akt-mediated actin dynamics.

Despite the fact that Mtss1 is a downstream molecule under Sema3E-Plexin-D1 signaling, it is still puzzling how Mtss1 expression is specifically and selectively regulated during striatonigral pathfinding. Since Mtss1 expression did not appear to be affected by Plxnd1-knockout at early embryonic stages and some level of Mtss1 persisted in cultured neurons lacking Sema3e or Plxnd1, we cannot exclude the possibility that other pathways activate Mtss1 expression. Nevertheless, it is certain that Mtss1 expression is under Sema3E-Plexin-D1 signaling activation during striatonigral projection and that, when axons reach their destination at P7, Mtss1 expression is downregulated. Such concurrence of Mtss1 downregulation and axonal projection leads us to speculate that target-derived factor-driven retrograde signaling may be involved in this gene regulation (Harrington and Ginty, 2013), and elucidating the relevant mechanism may be an interesting objective for future study. Furthermore, it is noteworthy that levels of both Plexin-D1 and Mtss1 were exclusively upregulated during the late gestation to early postnatal period, followed by an abrupt downregulation. Therefore, it is plausible that the activation of Mtss1 relies on the reinforcement of Plexin-D1 signaling. During angiogenic sprouting, the expression of Plexin-D1 in endothelial cells is controlled by VEGF signaling (Kim et al., 2022; Yu et al., 2022). However, the upstream pathway responsible for Plexin-D1 expression in neurons and the precise regulation of signaling strength in this context is still uncertain.

Trafficking of Plexin-D1-Mtss1 in striatonigral neurons

Another intriguing finding in our study is that Plexin-D1-containing vesicles undergo both anterograde and retrograde movement along neurites in cultured direct-pathway MSNs. Until now, neurotrophin or semaphorin 3A-mediated retrograde trafficking has been extensively studied due to its crucial role in controlling the growth of axons and dendrites, promoting neuronal survival, and facilitating synaptogenesis within the peripheral nervous system. Additionally, finely regulated anterograde transport is essential for replenishing receptors on the growth cone surface to ensure the responses of appropriate target-derived guidance signals (Scott-Solomon and Kuruvilla, 2018; Yamashita, 2019). We observed that Mtss1 contributes to the Plexin-D1 localization in the growth cone of cultured MSNs and in the terminal region of descending striatonigral projections. Previously, it has been reported that signaling endosomes containing Sema3A/Plexin-A at the axonal growth cones are retrogradely transported to soma. This process facilitates the localization of AMPA receptor GluA2 to the distal dendrites, thereby regulating dendritic development in the cultured hippocampal neurons (Yamashita et al., 2014). Since it is known that Plexin-D1 plays a role in the somatodendritic synaptogenesis of direct-pathway MSNs (Ding et al., 2012), the connection of the retrograde trafficking Plexin-D1-positive vesicles in this process or other developmental mechanisms like retrograde Sema3A signaling in the soma remains to be elucidated.

Axon-specific role of Sema3E-Plexin-D1-Mtss1 in striatonigral neuron

Sema3E-Plexin-D1 signaling is involved in dendritic synapse formation during the postnatal stage as well as traditional axon projection from the embryonic to the postnatal stage in the basal ganglia circuit (Ding et al., 2012). In addition, since axon projection and synapse formation are sequential events that occur in different cellular compartments during circuit establishment (Kuo and Liu, 2019), Sema3E-Plexin-D1 signaling may play discrete roles within different parts of a neuron, such as the dendrite versus the axon, through a unique subset of molecules. Indeed, our observations that the duration of Mtss1 expression coincided with active striatonigral axon pathfinding, Mtss1 was significantly expressed on the axonal side, and axon projection defects were observed after Sema3E-Plexin-D1 signaling disruption suggest that the Sema3E-Plexin-D1-Mtss1 complex appears to mainly regulate axon projection and guidance, at least during striatonigral pathway development. However, the cellular distribution of Mtss1 is somewhat controversial, as its expression is mainly observed on the dendritic side of Purkinje cells and hippocampal neurons, and its knockout shows defective dendritic arborization and spine formation (Kawabata Galbraith et al., 2018; Saarikangas et al., 2015; Yu et al., 2016), while a study has also shown that Mtss1 is more localized in the axoplasmic compartment of Purkinje cells (Hayn-Leichsenring et al., 2011). In this study, Mtss1- knockout did not show clear dendritic changes in MSNs, at least at P5 when an active axon trajectory occurs; however, given the enlarged ventricle and decreased cortical volume phenotype in knockout adults (Minkeviciene et al., 2019), later Mtss1 expression (even at low levels) may affect overall dendritic development. Consistent with this assumption, a previous study reported a slight decrease in dendritic spine density but a slight increase in the number of dendritic crossings without a change in total dendritic length in the direct pathway MSNs of 3- to 4-week-old Plxnd1- or Sema3e-knockout mice (Ding et al., 2012). Thus, we cannot exclude the possibility that the Sema3E-Plexin-D1-Mtss1 complex modulates MSN dendritic development later than the axonal pathfinding period.

Counterintuitive mechanism of attractive and repulsive guidance by Mtss1

From a traditional guidance point of view, our finding was somewhat unexpected because it was counterintuitive: conventional repulsive guidance cues that mediate growth inhibition induce upregulation of a positive regulator of neurite extension. We revealed that Mtss1 plays a dual role in striatonigral neurons, axon extension by membrane protrusion ability, and axon guidance by efficient Plexin-D1 trafficking to the growth cone. Therefore, our findings represent two important discoveries regarding the axon guidance mechanism. First, axon guidance signaling can switch on the specific regulatory program necessary for facilitating its own function, thereby generating the appropriate machinery to accomplish an intrinsic guidance role during neuronal pathfinding. Second, molecules such as Mtss1 coordinate positive and negative growth potentials in the axonal pathfinding route. Axon guidance cues require various auxiliary proteins to perform their programmed functions, in particular, transporting guidance receptors to the growth cone, endocytic sorting, and activating signaling cascades (O’Donnell et al., 2009), but none of the cofactors discovered to date have induced direct expression regulation of the guidance signaling with which it is involved. Previous studies have shown that Sema3E-Plexin-D1 signaling can switch its role from repulsive to attractive by interacting with the coreceptors neuropilin-1 (Npn1) and vascular endothelial growth factor receptor type 2 (VEGFR2) in subiculum neurons (Bellon et al., 2010; Chauvet et al., 2007). This mechanism is not applicable to developing striatonigral MSNs because the Npn1 receptor is not expressed in early postnatal striatal neurons (Ding et al., 2012). Instead, striatonigral neurons seem to adopt a new strategy, such as activating their own attractive driver to promote axonal growth. From a phenotypic perspective, it is also plausible that the positive or negative guidance roles of Mtss1 may be interdependent. Striatonigral extension defects could potentially lead to inadequate responses to Sema3E signals during pathfinding, consequently resulting in misguided projections. Similarly, guidance defects may disrupt normal signaling processes within the growth cone, thereby transmitting incorrect information for the replenishment of Plexin-D1 to the soma. This erroneous signaling could weaken Mtss1 expression and normal trafficking, ultimately leading to axonal growth defects.

Diverse roles of BAR domain proteins in the axon guidance signaling pathway

Mtss1 promotes membrane curvature through the I-BAR domain and induces the redistribution of lipids in the membrane, thereby increasing the local phosphatidylinositol 4,5-bisphosphate (PIP2) level at the negatively curved membrane. The elevation of local PIP2 levels leads to membrane binding of the I-BAR domain via electrostatic interactions (Lin et al., 2018). Interestingly, Sema3E binding to Plexin-D1 elevates PIP2 locally to activate Arf6, resulting in rapid focal adhesion disassembly (Sakurai et al., 2011). Since Mtss1 I-BAR can interact with Plexin-D1 at the curved membrane, the local increase in PIP2 in the curved membrane region may trigger signaling cascades. Although BAR-domain proteins play pivotal roles in membrane dynamics, a direct association between BAR-domain proteins and axon guidance receptors has not been extensively studied, and functional relevance in vivo is unclear. One example is the srGAP2 protein, which has been studied and shown to bind directly with the SH3 domain of the Robo1 guidance protein in cooperation with the F-BAR and RhoGAP domains (Guez-Haddad et al., 2015). Interestingly, in endothelial cells, Plexin-D1 forms a complex with SH3BP1, another small GTPase protein containing the N-BAR domain (Tata et al., 2014). Similar to the effect of Mtss1 and Plexin-D1 complex formation via the I-BAR domain, SH3BP1 colocalized with Plexin-D1 at lamellipodia in a complex formed via the N-BAR domain and mediates Sema3E-induced cell collapse through Rac1 activity regulation. However, in contrast to the effect of the Mtss1 mutant lacking the I-BAR domain, which failed to change the cell morphology, SH3BP1 lacking N-BAR led to cell collapse. Moreover, Sema3E binding to Plexin-D1 caused SH3BP1 to be released from the complex, whereas Sema3E did not interfere with the Plexin-D1-Mtss1 complex. In addition, the presence of Mtss1 had no effect on the endocytosis of Plexin-D1 by Sema3E or on the ability of Sema3E to bind to Plexin-D1. Hence, it is plausible that Mtss1 plays a role as a facilitator of Plexin-D1 trafficking rather than as a direct downstream signaling transducer such as SH3BP1. Because of the diverse roles played by Sema3E-Plexin-D1 across cell types, the effect of signaling induced by this guidance cue may be determined by distinct downstream molecules that share structural similarities in a relevant biological context. Another intriguing finding is the specific complex formation between Plexin-D1 and Mtss1 in the present study. Plexin-D1 did not form a complex with other BAR-domain-containing proteins, srGAP2 and IRSP53, known to have a role in neurons. While we did not conduct an extensive examination, it is noteworthy that at least two other Plexin proteins were unable to form a complex with Mtss1. Therefore, it would be interesting to explore the structural characteristics underlying these interactions.

Variable axon projection defects in direct pathway MSNs mediated by Sema3E-Plexin-D1 signaling

To modulate movement information conveyed through basal ganglia circuitry, two distinct types of striatal MSNs send axonal projections to different targets: a direct-pathway MSN expresses the dopamine D1 receptor to promote movement, and an indirect-pathway MSN expresses the dopamine D2 receptor to inhibit movement (Kreitzer and Malenka, 2008; Surmeier et al., 2007). Because of these unique functional and anatomical features, decoding the distinct molecular properties of the two types of MSNs and the regulatory mechanisms involved in circuitry formation is important. A few previous transcriptome analyses have been performed with juvenile and adult mouse brains (Heiman et al., 2008; Kronman et al., 2019; Lobo et al., 2006), but an understanding of the molecular repertoire of each MSN during development is very limited. In the present study, Mtss1 was identified as a selective molecule expressed in striatonigral projection neurons mediated by Sema3E-Plexin-D1 signaling, but its expression is limited to only the early striatonigral projection period; therefore, the previous transcriptome database in adults may have failed to identify Mtss1 as a specific marker molecule in direct-pathway MSNs.

In this study, Mtss1 expression was found to be relatively high during the perinatal period and then was dramatically downregulated by P7, by which time striatonigral projection has been completed (Morello et al., 2015). Consistent with a previous study showing that Plexin-D1-positive cells in the striatum were first detected on E14.5 (van der Zwaag et al., 2002), we found that its expression increased in the early postnatal stage. During a similar developing window in the striatonigral pathway, Sema3E was predominantly expressed in the GP and rTh/ZI, which is located in the route to the substantia nigra; therefore, the absence of repulsive Sema3E-Plexin-D1 signaling resulted in defects in striatonigral projection (Burk et al., 2017; Chauvet et al., 2007; Ehrman et al., 2013). However, we did not find ectopic projections, misguidance defects, or enlarged paths in Mtss1- or Plxnd1-knockout mice. Nevertheless, we observed fewer projections with aberrantly tangled patterns. These discrepancies may be explained by the following observations. First, because we used a genetic model to selectively label the striatonigral projections, we could detect abnormal phenotypes at a better specific resolution. Second, we noticed a certain degree of developmental retardation in the Mtss1- or Plxnd1-knockout neonates, even among those in the same litter; therefore, we strictly selected samples on the basis of body weight. However, despite the low striatonigral projection formation rate in the Mtss1-, Plxnd1-, or Sema3e-knockout mice, the adult mice showed a normal overall range of projection boundary size and width, suggesting that a decrease in repulsive signals in the mutants may have widened the descending projections. Third, the mouse genetic background may have led to the observed phenotypic discrepancies. We previously observed that certain vascular phenotypes were more evident in Sema3e-knockout mice with a 129SVE background than in those with a C57BL/6 background (Oh and Gu, 2013b), implying that relatively minor defects may vary depending on the genetic background.

Although Sema3E-Plexin-D1 has a similar mechanism of action as a common guidance cue in the nervous and vascular systems, it also exhibits completely different behavior in each system (Oh and Gu, 2013a). For example, the Plexin-D1-Npn1-VEGFR2 complex transmits an attractive signal upon Sema3E binding in specific neurons (Bellon et al., 2010), but endothelial cells still respond negatively to Sema3E despite the presence of all three receptors (Oh and Gu, 2013b). Interestingly, Sema3E-Plexin-D1 utilizes Akt-mediated cytoskeletal dynamics for its signaling cascade in both neuronal and endothelial cells (Burk et al., 2017; Moriya et al., 2010), and various auxiliary molecules, such as SH3BP1, Arf6, and GIPC1, have been revealed in each cell (Burk et al., 2017; Sakurai et al., 2010; Tata et al., 2014). However, only a few of these cofactors have shown a common molecular mechanism and expression by exchanging cells with each other, suggesting that Sema3E-Plexin-D1 signaling requires unique factors to perform different functions. Similarly, we identified Mtss1 as a downstream factor of the Sema3E-Plexin-D1 cue, but its function seems to be limited in neurons, at least in vivo. Therefore, it is necessary to elucidate whether Sema3E-Plexin-D1 signaling activates a specific pool of regulatory factors required for vascular development and to compare this with the results obtained in neurons, which will help us understand the underlying mechanism of specific molecule expression by guidance signaling. Furthermore, given the tremendous complexity of wiring in the central nervous system, it will be intriguing to discover new dual-function molecules similar to those in the Sema3E-Plexin-D1-Mtss1 complex that are involved in the formation of other circuits in the future.

Materials and methods

Mice

Plxnd1flox/flox (Plxnd1f/f) mice (Kim et al., 2011) and Sema3e+/-mice (Chauvet et al., 2007) were maintained on a C57BL/6 (#000664, The Jackson Laboratory) background. Nestin-Cre (#003771), Tie2-cre (#008863), and Drd1a-tdTomato (#016204) mice were obtained from The Jackson Laboratory (Bar Harbor, USA) and maintained on the same background. The frozen sperm of Mtss1flox/+ mice were generously provided by Dr. Mineko Kengaku and rederived at the Laboratory Animal Resource Center in the Korea Research Institute of Bioscience and Biotechnology (Cheongju, Korea). All protocols for animal experiments were approved by the Institutional Animal Care and Use Committee of Korea Brain Research Institute (IACUC-18-00008, 20-00012). All experiments were performed according to the National Institutes of Health Guide for the Care and Use of Laboratory Animals and ARRIVE guidelines.

Cell lines and primary striatal neuron culture

COS7 (21651, Korean Cell Line Bank), HEK293T (CRL-3216, ATCC), HUVEC (CC-2935, Lonza), and HCMEC/D3 (SCC066, Millipore) cell lines were purchased from the indicated companies, and the cell culture media and culture conditions were as provided by the respective companies. All cell lines were initially authenticated by the company and were tested to be mycoplasma negative. Primary mouse striatal neurons were isolated from neonatal pups as described in a previous report with some modifications (Penrod et al., 2011). Whole striatal tissues including the globus pallidus were digested with 20 units/ml papain (LS003124, Worthington, Lakewood, USA) diluted in dissection solution (5 mM MgCl2 and 5 mM HEPES in 1× Hanks’ balanced salt solution, pH 7.2) followed by multiple washes in inhibition solution (0.1% BSA and 0.1% Type II-O trypsin inhibitor diluted in dissection solution). The tissues were resuspended in neuronal plating medium (1 mM pyruvic acid, 0.6% glucose, and 10% heat-inactivated horse serum in Minimum Essential Medium with Earle’s Salts) and triturated 50 times with a fire-polished Pasteur pipette. The dissociated neurons were centrifuged at 1000 × g for 5 min and resuspended in fresh neuronal plating media for cell counting. Then, the cells were plated on coverslips or culture dishes coated with 50 μg/ml poly-d-lysine (P6407, Sigma) and 1 μg/ml laminin (354232, Corning) at a density of 3 × 104 cells/cm2. After 4 hr of incubation at 37°C, the plating media were replaced with neuronal growth media (0.5 mM l-glutamine, B27 supplements in neurobasal medium [10888022, Gibco]), and a quarter of the media was replaced with fresh growth media every 3 d until harvest.

Plasmids

A pBK-CMV vector containing VSV-tagged human Plexin-D1 cDNA (Gu et al., 2005) was recloned into a pCAG vector (pCAG-vsv-hPlexin-D1), and a Plexin-D1 construct lacking an ICD (amino acids deleted: 1299–1925) was generated by PCR-based mutagenesis (pCAG-vsv-hPlexin-D1ΔICD). To generate the pCAG-hPlexin-D1-GFP fusion construct, a GFP gene fragment was inserted at the C-terminus of the pCAG-vsv-hPlexin-D1 plasmid. pAPtag-5-Sema3E vectors were reported previously (Chauvet et al., 2007), and the mouse Plexin-D1 extracellular domain (amino acids: 1–1269) was amplified from mouse Plexin-D1 cDNA and directly cloned into a pAPtag-5 vector (pAPtag5-mPlexin-D1-ECD). The human full-length Mtss1 expression construct was purchased from Origene (pCMV6-hMtss1, Cat# RC218273, USA), and Myc-tagged Mtss1 deletion constructs (Mtss1ΔI-BAR [amino acids deleted: 1–250], Mtss1ΔWH2 [amino acids deleted: 714–745], and Mtss1-I-BAR [amino acids: 1–250]) were generated by PCR-based mutagenesis. To generate full-length mouse Flag-Plexin-D1, SH3BP1-HA, and HA-srGAp2, each gene was isolated directly from the mouse brain cDNA library and cloned into pCAG vector with the tagging fragment. The mouse vsv-plexin-B2, mouse vsv-plexin-B3, and human pECE-M2-BAIAP2 (IRSP53-Flag) were purchased from Addgene (#68038, #68039, #31656, USA).

RNA sequencing analysis

RNA sequencing (RNA-seq) library preparation and sequencing were conducted at Ebiogen (Seoul, South Korea). Libraries were constructed using a NEBNext Ultra Directional RNA-seq Kit customized with mouse-specific oligonucleotides for rRNA removal. Directional mRNA-seq was conducted using the paired-end, 6 Gb read option of the Illumina HiSeq X10 system.

Bioinformatic analysis for RNA-seq

The entire analysis pipeline of RNA-seq was coded using R software (version 3.6), which was controlled by systemPipeR (version 1.18.2). The raw sequence reads were trimmed for adaptor sequences and masked for low-quality sequences using systemPipeR. Transcript quantification of the RNA-seq reads was performed with GenomicAlignments (version 1.20.1) using reads aligned with the Mus musculus transcriptome annotation using Rsubread (version 1.24.6). The fragments per kilobase of transcript per million mapped reads (FPKM) values were calculated using the fpkm function of DESeq2 (version 1.24.0) and were processed using the robust median ratio method. Transcript reads were normalized by the voom function of Limma (version 3.40.6). To determine if a transcript was differentially expressed (DE), EdgeR (version 3.26.7) calculated the results based on the normalized counts from entire sequence alignments. Significantly DE transcripts with a fold change greater than the raw FPKM value (>2) and adjusted p-value (<0.01) in all experimental comparisons were selected and used for further analysis. Gene annotations were added with an online database using Ensembl biomaRt (version 2.40.4), and visualization was performed using the R base code and gplots package (version 3.0.1.1). For DEG sets, hierarchical cluster analysis was performed using complete linkage and Euclidean distance to measure similarity. All data analysis and the visualization of DEGs were conducted using R version 3.0.2 (https://www.r-project.org/).

Quantitative reverse transcription PCR (qRT-PCR)

Total RNA was extracted from dissected tissue using TRIzol (15596026, Thermo). cDNA was synthesized from 200 ng of total RNA with a QuantiTect Reverse Transcription Kit (205313, QIAGEN). Quantitative PCRs were carried out in triplicate using SYBR Green I Master Mix (S-7563, Roche) on a LightCycler 480 system (Roche). Expression was calculated using the 2−ΔΔCt method with Gapdh as a reference. The following primers were used (forward primer and reverse primer, respectively): Plxnd1: 5′-CTAGAGATCCAGCGCCGTTT, 5′-GGCACTCGACAGTTGGTACA, Mtss1: 5′-CCTTTCCCTCATTGCCTGCCT, 5′-TCTGAGATGACGGGAACATGCC, and Gapdh: 5′-TGACGTGCCGCCTGGAGAAAC, 5′-CCGGCATCGAAGG TGGAAGAG.

Transfection

DNA expression constructs were transfected into COS7 or HEK293T cells by Lipofectamine 2000 (11668019, Invitrogen) in OPTI-MEM (31985-070, Gibco) for 4 hr according to the manufacturer’s instructions and then replaced with normal culture media until the next procedure. For imaging analysis, 0.5 μg of DNA was transfected into COS7 cells (1 × 104 cells/cm2) cultured on coverslips in a 12-well plate. For biochemical analysis, 4 μg of DNA was transfected into HEK293T cells (3 × 104 cells/cm2) cultured on a 10 cm dish. To achieve high transfection efficiency into primary neurons, the nucleofection technique using a Lonza Amaxa Nucleofector was performed following the manufacturer’s instructions (Basic Nucleofector Kit for Primary Mammalian Neurons, VAPI-1003). To transfect into neurons, 4 μg of expression constructs were added to at least 1 × 106 isolated neuronal cells for each electroporation, and the transfected cells were plated and cultured as described in the previous section.

Alkaline phosphatase (AP)-conjugated ligand preparation and binding analysis

AP-conjugated Sema3E and Plexin-D1-ECD ligands were generated in HEK293T cells, and ligand binding experiments were performed as described in previous reports (Chauvet et al., 2016; Chauvet et al., 2007). Briefly, the AP-conjugated expression construct was transfected into cells by Lipofectamine 2000 and cultured overnight in Dulbecco’s modified Eagle’s medium containing 10% fetal bovine serum (FBS). Then, the medium was replaced with OPTI-MEM and harvested at 5 d post transfection. The collected conditioned medium was filtered to increase the ligand concentration.

To measure the binding ability of AP-Sema3E to the Plexin-D1 receptor, COS7 cells on a six-well plate were transfected with each expression vector and cultured for 24 hr. The next day, the cells were washed in HBHA buffer (1× HBSS, 0.5 mg/ml BSA, 0.5% sodium azide, and 20 mM HEPES [pH 7.0]) and incubated with 2 nM AP or AP-Sema3E for 1 hr at room temperature (RT). After seven washes in the HBHA buffer, the cells were lysed in 1% Triton X-100 and 10 mM of Tris–HCl (pH 8.0), and the supernatant was obtained by centrifugation at 13,000 × g for 10 min. The lysates were heat-inactivated at 65°C for 10 min, each lysate was used for AP concentration using a BioMate 3S spectrophotometer (Thermo Scientific), and the amount of protein was measured by BCA assay.

For AP-conjugated ligand binding analysis of tissues, 20-μm-thick cryosections were fixed in cold methanol for 8 min and preincubated in 1× phosphate-buffered saline (PBS) containing 4 mM MgCl2 and 10% FBS for 1 hr. Next, a binding solution (1× PBS–MgCl2 and 20 mM HEPES, pH 7.0) containing 2 nM AP-Sema3E was applied, and sections were incubated for 2 hr at RT. After five washes in 1× PBS–MgCl2, the sections were briefly soaked in acetone–formaldehyde fixative (60% acetone, 1.1% formaldehyde, and 20 mM HEPES, pH 7.0) and heat-inactivated in 1× PBS at 65°C for 2 hr. Next, the sections were incubated in AP buffer (NBT/BCIP tables, 11697471001, Roche) until clear purple precipitation was observed at RT. For quantification, three brain sections per animal were analyzed and averaged. For the AP-Sema3E binding analysis of growth cones, MSNs grown for 6 d on glass coverslips were washed in 1× PBS, immediately fixed in cold methanol for 5 min, and blocked in TBS buffer (100 mM TBS, 4 mM MgCl2, 4 mM CaCl2, pH 7.4) with 10% FBS at RT for 1 hr. The MSNs were then incubated in 0.5 nM AP-Sema3E ligand diluted in blocking solution at RT for 1 hr. After five washes in TBS buffer, the MSNs were fixed in acetone/formaldehyde solution, heat-inactivated, and incubated in AP buffer as described above.

AP treatment of HUVECs and HCMEC/D3 cells

HUVECs were purchased from Lonza, and the HCMEC/D3 cell line was obtained from Millipore. The cell culture media and culture conditions used followed the information provided by the respective companies. Cultured HUVECs and HCMEC/D3 cells were treated with 2 nM AP or AP-Sema3E for 24 hr. Then, the cells were lysed and prepared for western blotting as described below.

Immunoblotting

Brain tissue was collected in radioimmunoprecipitation assay (RIPA) buffer (50 mM Tris–HCl [pH 8.0], 150 mM NaCl, 1% NP-40, and 1% sodium deoxycholate) with a protease inhibitor cocktail (78444, Thermo Fisher Scientific), and protein amounts were quantified using a BCA protein assay kit (23227, Thermo Fisher Scientific). A total of 40 μg of protein was loaded into each well of a sodium dodecyl sulfate (SDS) polyacrylamide gel, after which it was separated and transferred to a polyvinylidene fluoride membrane (IPVH00010, Merck) at 100 V for 90 min. All membranes were blocked in Everyblot blocking buffer (12010020, Bio-Rad) for 1 hr and probed overnight with primary antibodies in blocking buffer at 4°C. The primary antibodies included the following: anti-Mtss1 (1:1000, Novus, NBP2-24716), anti-Plexin-D1 (1:1000, AF4160, R&D Systems), anti-β-actin (1:5000, 5125S, Cell Signaling), anti-Myc (1:1000, 2276S, Cell Signaling), anti-vsv (1:1000, ab3861, Abcam), anti-Sema3E (1:500, LS-c353198, LSBio), anti-p-AKT (1:1000, 9271, Cell Signaling), and anti-AKT (1:1000, 9272S, Cell Signaling). The membranes were incubated in TBST, and the appropriate horseradish peroxidase (HRP)-conjugated secondary antibodies and bands were developed with enhanced chemiluminescence using Fusion FX7 (Vilber, Germany) and then analyzed using ImageJ software.

Immunoprecipitation

HEK293T cells were transfected with Lipofectamine 2000, and after 24 hr, they were lysed in a buffer consisting of 100 mM Tris–HCl (pH 7.5), 100 mM EDTA, 150 mM NaCl, and 1% Triton X-100 with freshly added phosphate and protease inhibitors. The cell lysates were centrifuged at 13,000 × g for 10 min at 4°C, and supernatants were incubated with antibodies (1:200) at 4°C overnight. Then, the protein lysates were incubated with magnetic beads for 1 hr at 4°C. Next, the beads were washed five times with lysis buffer, and the bound proteins were eluted with a 2× SDS sample buffer by heating the beads at 95°C for 5 min. The samples were then analyzed by SDS-PAGE and western blotting. The following antibodies were purchased from commercial sources: anti-Myc (1:1000, 2276S, Cell Signaling), anti-vsv (1:1000, ab3861, Abcam), anti-Mtss1 (1:1000, NBP2-24716, Novus), anti-Plexin-D1 (1:1000, AF4160, R&D Systems), and anti-β-actin (1:5000, 5125S, Cell Signaling).

Protein‒protein interaction assay

The I-BAR domain of human Mtss1 was purchased from Sino Biological (Cat# 13085-H10E). The human Plexin-D1 cytosolic domain was prepared. Briefly, the coding sequence of the human PLXND1 (NM_105103.3) cytosolic domain (amino acid residue 1297–1925; hPLXND1_Cyto) was subcloned into the mammalian expression vector CAGs-MCS EEV (SBI, Palo Alto, CA) in-framed fused with a C-terminal twin strep tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). HEK293 GnTI- cells were transfected with the PLXND1 expression vector and grown in FreeStyle 293 Expression Medium supplemented with 2% (v/v) FBS in a humidified CO2 incubator (35°C, 5% CO2) with shaking at 150 rpm for 3 d. Cells were harvested, resuspended in resuspension buffer (500 mM NaCl, 10 mM Tris–HCl, pH 8.0, 5% [v/v] glycerol, 3 mM β-mercaptoethanol, protease inhibitor cocktail [Roche], 0.4 mg/ml DNase I [GOLDBIO]), and disrupted by using a Dounce homogenizer followed by sonication. After the removal of cell debris by centrifugation, the cell lysate was loaded onto preequilibrated Strep-Tactin XT 4Flow resin (IBA Lifesciences GmbH, Germany) and washed with wash buffer (500 mM NaCl, 10 mM Tris–HCl, pH 8.0, 5% [v/v] glycerol, 3 mM β-mercaptoethanol). hPLXND1_Cyto with a twin strep tag was eluted with elution buffer (50 mM biotin, 500 mM NaCl, 10 mM Tris–HCl, pH 8.0, 5% [v/v] glycerol, 3 mM β-mercaptoethanol) and further purified by using size-exclusion chromatography on a size-exclusion column (Superdex 200) equilibrated with FPLC buffer (150 mM NaCl, 20 mM Tris, pH 8.0, 10% glycerol [v/v], 2 mM DTT). To obtain the tag-free hPLXND1_Cyto proteins, the C-terminal twin strep tag was removed by incubating with the 3C protease (Takara Bio, Japan; 1.5 unit/50 mg protein) and ran on a size-exclusion column. To analyze direct binding, Mtss1-I-BAR with Plxind-D1-ICD was mixed in binding buffer (50 mM Tris–HCl, 0.1% Triton X-100) and incubated overnight at 4°C. The mixed proteins were then incubated with Ni-NTA beads for 1 hr at 4°C. Next, the beads were washed five times with binding buffer, and the bound protein was eluted with 2× SDS sample buffer by heating the beads at 95°C for 5 min. The samples were then analyzed by SDS-PAGE and stained with Coomassie blue solution. After washing with water five times, the stained gels were visualized using a Bio-Rad instrument.

Cell surface biotinylation and endocytosis analysis

Transfected COS7 cells on a 100 mm dish were biotinylated by incubation in 1 mg/ml NHS-SS-Biotin (21331, Thermo Scientific), diluted in 1× PBS containing 1 mM MgCl2 and 0.1 mM CaCl2 (PBS–MC) for 15 min, washed in PBS–MC containing 10 mM glycine at least three times, and then rinsed in ice-cold PBS–MC twice at 4°C. For the negative control, the cells were incubated in stripping buffer (50 mM glutathione, 75 mM NaCl, 10 mM EDTA, 75 mM NaOH, and 1% bovine serum albumin [BSA]) and washed twice in PBS–MC. For the neutralization of glutathione, the cells were incubated in PBS–MC containing 50 mM iodoacetamide (I1149, Sigma) three times. All biotinylated or stripped cells were lysed in ice-cold RIPA buffer (50 mM Tris–HCl [pH 8.0], 150 mM NaCl, 1% NP-40, and 1% sodium deoxycholate) with a protease inhibitor cocktail, and 100 μg of protein extracts was incubated in prewashed streptavidin agarose resin (20357, Thermo Scientific) overnight and rotated throughout. Cell extracts were serially washed in bead-washing solution (Solution A: 150 mM NaCl, 50 mM Tris–HCl [pH 7.5], and 5 mM EDTA; Solution B: 500 mM NaCl, 50 mM Tris–HCl [pH 7.5], and 5 mM EDTA; Solution C: 500 mM NaCl, 20 mM Tris–HCl [pH 7.5], and 0.2% BSA) followed by another wash in 10 mM Tris–HCl (pH 7.5). The bound biotinylated proteins were recovered by adding 2× sample buffer and boiling extracts for 5 min, and then the supernatants were subjected to western blotting.

To analyze endocytic protein levels, cells were incubated for 25 min at 37°C in the presence of prewarmed culture media with 2 nM AP or AP-Sema3E ligands after surface biotinylation. Then, the biotinylated proteins remaining on the cell surface were removed by stripping procedures, and the rest of the experiment was continued as described in the above section. Except for those used in the ligand stimulation process, all reagents were prechilled, and experiments were performed in an ice or cold chamber.

Immunostaining

For immunocytochemistry, cultured cells or neurons on coverslips were fixed in 4% paraformaldehyde (PFA) for 5 min and washed several times in PBS. Then, the cells were permeabilized in PBST (PBS containing 0.1% Triton X-100) for 5 min, blocked with 5% horse serum in PBST for 60 min at RT, and incubated with primary antibodies diluted in blocking solution overnight at 4°C. The next day, the samples were washed with PBST three times and incubated for 1 hr with Alexa Fluor 488-, 594-, or 647-conjugated secondary antibodies (1:1000, Thermo). To enable visualization of the F-actin, Alexa Fluor-conjugated phalloidin (1:50, Thermo) was added during the secondary antibody incubation. After being washed again with PBST, the samples were mounted with Prolong Diamond antifade solution containing DAPI (P36962, Thermo). Image processing was performed using ImageJ or Adobe Photoshop (Adobe Photoshop CC2019) under identical settings. All other immunostaining procedures were the same as those described above. The following primary antibodies for immunocytochemistry were used: anti-vsv (1:1000, ab3861, Abcam), anti-Myc (1:1000, 2276S, Cell Signaling), phalloidin Alexa Fluor 488 (1:50, A12379, Thermo), phalloidin Alexa Fluor 647 (1:100, A22287, Thermo), anti-RFP (1:1000, ab62341, Abcam), anti-RFP (1:1000, MA5-15257, Thermo), anti-Tau (1:500, sc-1995, Santa Cruz), and anti-alpha-tubulin (1:1000, T5168, Sigma). Images were collected using a Nikon Eclipse Ti-U microscope (Nikon, Japan), Leica TCS SP8 Confocal Microscope (Leica, Germany), or Structured Illumination Microscope (Nikon).

For immunohistochemistry with tissue samples, brains were fixed in 4% PFA overnight and equilibrated with 20% sucrose in 1× PBS. Mouse brain sections were cut into 20 μm slices on a cryostat (Leica Microsystems Inc, Buffalo Grove, IL). Mouse brain sections were permeabilized in PBST (PBS containing 0.2% Triton X-100) for 10 min, blocked with 2% BSA and 5% normal donkey serum in PBST for 60 min at RT, and then incubated in primary antibodies diluted with 2% BSA in PBST overnight at 4°C. The following primary antibodies were used: anti-Mtss1 (1:1000, NBP2-24716, Novus), anti-RFP (1:1000, MA5-15257, Thermo), anti-neurofilament (1:500, 2H3, Hybridoma Bank), anti-CD31 (1:500, 553370, BD Biosciences), and anti-cleaved caspase 3 (1:1000, 9661, Cell Signaling). After being washed with PBS/0.2% Tween 20 (PBST) three times, sections were incubated for 1 hr with Alexa Fluor 488-, 594-, or 647-conjugated secondary antibodies (1:1000, Invitrogen). For negative controls, brain sections were stained with secondary antibodies only. Image processing was performed using ImageJ or Adobe Photoshop (Adobe Photoshop CC2019).

Growth cone collapse and neurite length analysis

For the growth cone collapse assay, striatal neurons at DIV3 were incubated with 5 nM AP or AP-Sema3E 3 for 25 min. For the preservation of the growth cone structure, 8% PFA was directly added to cultured neurons to equalize at 4% PFA for 10 min at 37°C, and subsequently, another 5 min round of 4% PFA fixation was performed on ice before the immunostaining procedure. Growth cone images were collected from tdT-positive neurons using a Structured Illumination Microscope (SIM, Nikon), and collapsed growth cones were determined blindly. Growth cones with broad lamellipodia were considered intact, whereas those with a few filopodia lacking lamellipodia were defined as collapsed according to previous guidelines (Oh and Gu, 2013b).

For measurement of neurite length, dissociated striatal neurons were cultured in the presence of 5 nM ligands and immunostained as described in the above section. The neurons were imaged by a fluorescence microscope (Nikon ECLIPSE Ti-U), and the longest neurite length from tdT-positive neurons was determined using ImageJ software. The neurites that formed a network with another neurite and those whose longest protrusions were smaller than twice the cell body diameter were excluded from measurement according to previous guidelines (Chauvet et al., 2016). For quantification of the degree of colocalization, Pearson’s correlation coefficients were calculated using the manufacturer’s software (Nikon, NIS-Elements software).

In situ hybridization (ISH)

ISH was performed under RNase-free conditions as described in a previous study (Ding et al., 2012). After fixation in 4% PFA for 20 min, 20-μm-thick cryosections were preincubated in hybridization buffer (5× Denhardt’s solution, 5× saline sodium citrate [SSC], 50% formamide, 0.25 mg/ml Baker yeast tRNA, and 0.2 mg/ml salmon sperm DNA) for 2 hr at RT. Next, the sections were hybridized in the same buffer containing the indicated digoxigenin-conjugated riboprobe at 60°C overnight. After hybridization, the sections were washed in a serial SSC buffer and formamide solution and then preincubated in buffer 1 (100 mM Tris–HCl, pH 7.5, 150 mM NaCl) with a 1% blocking reagent (Roche) for 1 hr at RT. Next, the sections were incubated with sheep anti-digoxigenin-AP antibody (1:3000, Roche) for 90 min at RT, washed in buffer 1, and then incubated in AP buffer (100 mM Tris–HCl, pH 9.5; 100 mM NaCl; and 5 mM MgCl2) containing 4-nitro blue tetrazolium chloride (NBT, Roche), 5-bromo-4-chloro-3-indolyl-phosphate (BCIP, Roche), and levamisole (1359302, Sigma) until purple precipitates were observed. After mounting them with coverslips, the samples were analyzed using confocal laser-scanning microscopy with a Nikon Eclipse Ti-U Microscope or Leica TCS SP8 Confocal Microscope. For double fluorescence ISH, the tyramide signal amplification method with minor modifications was used according to the manufacturer’s instructions (NEL753001KT, PerkinElmer). The following antisense riboprobes were used: Plxnd1 (Ding et al., 2012), Sema3e (Gu et al., 2005), and Mtss1 (Allen Brain Atlas, Probe RP_040604_01_B06).

Live-cell imaging

Isolated striatal neurons were transfected with an expression plasmid, as described in the above section, and were plated onto a 35 mm confocal dish (211350, SPL Life Sciences) at a density of 1 × 104 cells/cm2. At DIV6, time-lapse imaging was performed in a stage-top cell incubator (37°C with 5% CO2 supplied). Images were acquired at 1 s intervals for 3 min using a Nikon A1-Rsi confocal microscope. To quantify Plexin-D1-GFP trafficking, time-lapse images were analyzed using Particle Tracking Recipe in AIVIA microscopy image analysis software (Aivia Inc).

Golgi staining and dendrite analysis

Golgi staining was conducted according to the manufacturer’s protocol (FD Rapid GolgiStain Kit [PK401A, FD NeuroTechnologies, Inc]). In brief, P5 mouse brains were immersed in a staining solution for 2 wk before being transferred to a wash solution for 4 d. Then, 100 μm slices were obtained using a vibratome and collected on gelatin-coated slides. During the staining process, the slices were washed twice with distilled water for 4 min, immersed in the staining solution for 10 min, and then washed again. The slices were then dehydrated, cleared in xylene three times for 4 min, mounted with Eukitt Quick-hardening mounting medium (Sigma, 03989), and imaged by light microscopy with Z-stack. Image processing was performed using Neurolucida360 software in 3D analysis.

Whole-embryo immunostaining and clearance

Mouse embryos were fixed in 4% PFA overnight at 4°C and washed three times in PBS. Then, the embryos were permeabilized in PBST (PBS containing 1% Triton X-100) for 2 hr at RT, incubated in blocking solution (75% PBST, 20% dimethyl sulfoxide, 5% normal goat serum) for 3 hr at RT, and incubated in anti-CD31 (1:500, company name) diluted in the blocking solution at RT. After 3 d, the embryos were washed with PBST for 8 hr and incubated with Alexa Fluor 488-conjugated secondary antibody (1:500, Thermo) for 2 d at RT. After washing again with PBST for 8 hr, the embryos were cleared with ethyl cinnamate (ECi; Cat# 112372, Sigma) according to a previous protocol (Klingberg et al., 2017). Briefly, the embryos were subjected to serial dehydration with ethanol (EtOH) (30, 50, and 70% EtOH, pH 9.0 with 2% Tween 20, followed by twice 100% EtOH). The solutions were changed every 12 hr and incubated at 4°C. The samples were transferred to ECi and incubated at RT with gentle shaking until they became transparent, and cleared samples were stored in ECi at RT until imaging. All clearing procedures were performed in the dark. A Dragonfly 502w (Andor Technology) was used for imaging, and Imaris x64 9.6.1 (Bitplane) was used for image reconstruction.

DiI injection and imaging

For the tracing of the neural projection, small crystals of DiI (1.1-dioctadecyl-3,3,3,3-tetramethyl-indocarbocyanine perchlorate, Sigma) were inserted into the thalamus of an E16.5 mouse brain fixed in 4% PFA overnight and sealed with 2% agarose melt in 1× PBS. Then, the brain was incubated in 4% PFA at 37°C for 2 wk and divided into 100 μm thick sections by a vibratome (Leica VT200S). Serial brain slices were immediately collected, and DiI-stained sections were imaged using a fluorescence microscope (Nikon Eclipse Ti-U). To sparsely label the striatonigral projection, DiI crystals were injected into the dorsal striatum of P5 mouse brain and incubated for a month or so under the same conditions as described above. Afterward, the tissue was sectioned into 100-μm-thick slices using a vibratome (Leica VT200S). Z-stack images were obtained by using Leica TCS SP8 Confocal Microscope, and the 3-D images were reconstructed utilizing Leica Application Suite X, an image analysis software.

Striatonigral projection analysis

For the analysis of striatonigral projections, P5 or P30 brains from wild-type (Drd1a-tdT; Mtss1f/f), Mtss1 cKO (Drd1a-tdT; Nes-cre; Mtss1f/f), or Plxnd1 cKO (Drd1a-tdT; Nes-cre; Plxnd1f/f) mice were fixed in 4% PFA overnight and embedded in a 4% agarose block melt in PBS after being washed with PBS three times. Then, the areas of interest in the brain were divided into 100-μm-thick sections by a vibratome (Leica VT200S). Serial brain slices were immediately collected and mounted with Prolong Diamond antifade solution containing DAPI (P36962, Thermo). The sections were imaged with a fluorescence microscope (Nikon Eclipse Ti-U). To analyze the guidance phenotype in the striatonigral projections, we quantified the number of axon bundles intersecting with others between the globus pallidus (Gp) and the entopeduncular nucleus (EP). Since some mutants within the same litter occasionally displayed significant developmental delays, we selectively chose samples from mutant littermates with ±5% body weight variance for a reliable phenotypic assessment.

Quantification and statistical analysis

The estimate of variance was determined by the standard error of the mean (SEM), and statistical significance was set at p<0.05. All data were tested with a Gaussian distribution using the Shapiro‒Wilk test before statistical analysis. Pairwise comparisons were performed using the two-tailed Student’s t-test or Mann–Whitney test, and multiple-group analyses were conducted with one-way or two-way ANOVA with Tukey’s or Bonferroni’s multiple comparisons test or Kruskal‒Wallis test with Dunn’s multiple comparisons test. For the growth cone collapse assay, the χ2 test was used as previously reported (Burk et al., 2017). For the quantification of colocalization, the images were analyzed using the Jacop plugin in ImageJ (National Institutes of Health, Bethesda, MD). Statistical data on colocalization were obtained using Costes’ randomization based on the colocalization module, as previously described (Bolte and Cordelières, 2006). Statistical analyses were performed with Prism 9 (GraphPad Software). At least three pairs of mice were used per experiment for all histological analyses. For the quantification of image data, at least three brain sections per animal were collected and analyzed. All data analyses were performed by an investigator blinded to the groups. No statistical methods were used to predetermine sample sizes, but our sample sizes were similar to those generally employed in the field.

Acknowledgements

We thank Drs. Ayal Ben-Zvi, Soonmoon Yoo, and Chenghua Gu for reading the manuscript and providing critical advice; Dr. Chenghua Gu for providing Sema3e and Plxnd1-flox mice; Drs. Mineko Kengaku and Masayoshi Mishina for providing Mtss1-flox mice; Juhyun Lee for helping with quantification; the Advanced Neural Imaging Center in KBRI for image analysis. This research was supported by the KBRI basic research program of the Korea Brain Research Institute funded by the Ministry of Science and ICT (KBRI 23-BR-01-02), the National Research Foundation (NRF) funded by the Korean government (NRF-2014R1A1A2058234), the Bio & Medical Technology Development Program of the NRF & funded by the Korean government (MSIT) (NRF-2020M3E5D9079766 and NRF-2022M3E5E8017701) to WO, and the Young Researcher Program of the National Research Foundation (NRF) funded by the Korean government (MSIT) (2020R1C1C1010509) to NK.

Appendix 1

Appendix 1—key resources table.

Reagent type (species) or resource Designation Source or reference Identifiers Additional information
Antibody Anti-Mtss1
(rabbit polyclonal)
Novus Biologicals Cat# NBP2-24716;
RRID:AB_2716709
IHC (1:500)
WB (1:500)
Antibody Anti-Plexin-D1
(goat polyclonal)
R&D Systems Cat# AF4160;
RRID:AB_2237261
IHC (1:500)
Antibody Anti-Tau
(goat polyclonal)
Santa Cruz Cat# sc-1995;
RRID:AB_632467
ICC (1:500)
Antibody Anti-Neurofilament
(mouse)
Hybridoma Bank Cat# 2H3;
RRID:AB_ 531793
IHC (1:500)
Antibody Anti-β-actin/HRP
(rabbit monoclonal)
Cell Signaling Technology Cat# 5125S;
RRID:AB_1903890
WB (1:5000)
Antibody Anti-Myc
(mouse monoclonal)
Cell Signaling Technology Cat# 2276;
RRID:AB_331783
WB (1:1000)
Antibody Anti-Vsv
(goat polyclonal)
Abcam Cat# ab3861;
RRID:AB_304118
WB (1:1000)
Antibody Anti-Sema3E
(human polyclonal)
LSBio Cat# LS-c353198 WB (1:500)
Antibody Anti-Phospho-Akt
(rabbit polyclonal)
Cell Signaling Technology Cat# 9271;
RRID:AB_329825
WB (1:1000)
Antibody Anti-Akt
(rabbit polyclonal)
Cell Signaling Technology Cat# 9272;
RRID:AB_ 329827
WB (1:1000)
Antibody Anti-RFP
(rabbit polyclonal)
Abcam Cat# ab62341;
RRID:AB_945213
IHC (1:1000)
Antibody Anti-RFP
(mouse monoclonal)
Thermo Fisher Scientific Cat# MA5-15257;
RRID:AB_10999796
IHC (1:1000)
Antibody Anti-alpha-tubulin
(mouse monoclonal)
Sigma-Aldrich Cat# T5168;
RRID:AB_477579
IHC (1:1000)
Antibody Anti-cleaved caspase3
(rabbit polyclonal)
Cell Signaling Technology Cat# 9661;
RRID:AB_2341188
IHC (1:1000)
Antibody Anti-CD31
(rat monoclonal)
BD Bioscience Cat# 553370;
RRID:AB_394816
IHC (1:500)
Antibody Anti-digoxigenin-alkaline phosphatase
(sheep polyclonal)
Roche Cat# 11093274910;
RRID:AB_2313640
In situ (1:3000)
Antibody Anti-mouse IgG/HRP
(goat polyclonal)
Thermo Fisher Scientific Cat# 31430;
RRID:AB_228307
WB (1:10,000)
Antibody Donkey anti-rabbit IgG/HRP
(rabbit polyclonal)
Jackson Immuno
Research
Cat# 711-035-152;
RRID:AB_10015282
WB (1:10,000)
Antibody Donkey anti-goat IgG/HRP
(goat polyclonal)
Jackson Immuno
Research
Cat# 705-035-147;
RRID:AB_2313587
WB (1:10,000)
Antibody Donkey anti-rabbit IgG, Alexa Fluor 488 Thermo Fisher Scientific Cat# A-21206;
RRID:AB_2535792
ICC (1:1000)
IHC (1:1000)
Antibody Donkey anti-mouse IgG, Alexa Fluor 488 Thermo Fisher Scientific Cat# A-21202;
RRID:AB_141607
ICC (1:1000)
IHC (1:1000)
Antibody Donkey anti-goat IgG, Alexa Fluor 568 Thermo Fisher Scientific Cat# A-11057;
RRID:AB_142581
ICC (1:1000)
IHC (1:1000)
Antibody Donkey anti-rabbit IgG, Alexa Fluor 568 Thermo Fisher Scientific Cat# A-10042;
RRID:AB_2534017
ICC (1:1000)
IHC (1:1000)
Antibody Donkey anti-mouse IgG, Alexa Fluor 568 Thermo Fisher Scientific Cat# A-10037;
RRID:AB_2757558
ICC (1:1000)
IHC (1:1000)
Antibody Donkey anti-mouse IgG, Alexa Fluor 647 Thermo Fisher Scientific Cat# A-31571;
RRID:AB_162542
ICC (1:1000)
IHC (1:1000)
Chemical compound, drug MK2206 SelleckChem Cat# S1078
Chemical compound, drug TRIzolTM Reagent Thermo Fisher Scientific Cat# 15596026
Chemical compound, drug RNasin Ribonuclease Inhibitor Promega Cat# N2115
Chemical compound, drug Halt Protease and Phosphatase Inhibitor Cocktail Thermo Fisher Scientific Cat# 78444
Chemical compound, drug SuperSignal West Pico PLUS
Chemiluminescent Substrate
Thermo Fisher Scientific Cat# 34580
Chemical compound, drug SuperSignal West Femto Maximum
Sensitivity Substrate
Thermo Fisher Scientific Cat# 34096
Chemical compound, drug ProLong Diamond Antifade Mountant
with DAPI
Thermo Fisher Scientific Cat# P36962
Chemical compound, drug Eukitt Quick-hardening mounting medium Sigma-Aldrich Cat# 03989
Chemical compound, drug Alexa Fluor 488 Phalloidin Thermo Fisher Scientific Cat# A12379
Chemical compound, drug Alexa Fluor 568 Phalloidin Thermo Fisher Scientific Cat# A12380
Chemical compound, drug Alexa Fluor 647 Phalloidin Thermo Fisher Scientific Cat# A22287
Chemical compound, drug Gibco DMEM, high glucose, pyruvate Gibco Cat# 11995-065
Chemical compound, drug Penicillin-Streptomycin HyClone Cat# SV30010
Chemical compound, drug Paraformaldehyde Electron Microscopy Sciences Cat# 19202
Chemical compound, drug Poly-d-lysine hydrobromide Sigma-Aldrich Cat# P6407
Chemical compound, drug Corning Laminin Corning Cat# 354232
Chemical compound, drug NBT/BCIP Ready-to-Use Tablets Roche Cat# 11697471001
Chemical compound, drug DiI (1.1-dioctadecyl-3,3,3,3-tetramethylindocarbocyanine perchlorate) Sigma-Aldrich Cat# 468495
Commercial assay or kit QuantiTect Reverse Transcription kit QIAGEN Cat# 205313
Commercial assay or kit Pierce BCA Protein Assay Kit Thermo Fisher Scientific Cat# 23225
Commercial assay or kit Lipofectamine 2000 Transfection Reagent Thermo Fisher Scientific Cat# 11668019
Commercial assay or kit Basic Nucleofector Kit LONZA Cat# VAPI-1003
Commercial assay or kit FD Rapid GolgiStain Kit FD Neurotechnologies Inc Cat# PK401A
Cell line (Homo sapiens) HEK293T
Kidney (embryo)
ATCC CRL-3216;
RRID:CVCL_0063
Cell line (Cercopithecus aethiops) COS7
Kidney
Korean Cell Line Bank Cat# 21651;
RRID:CVCL_0224
Cell line (H. sapiens) HUVEC
Umbilical Vein Endothelial Cells
Lonza CC-2935;
RRID:CVCL_2959
Cell line (H. sapiens) HCMEC/D3
Human temporal lobe microvessels
Millipore SCC066; RRID:CVCL_U985
Strains Mouse: C57BL/6J The Jackson Laboratory Stock# 000664;
RRID:IMSR_JAX:000664
Strains Mouse:
Nestin-Cre
The Jackson Laboratory Stock# 003771;
RRID:IMSR_JAX:003771
Strains Mouse:
Tie2-Cre
The Jackson Laboratory Stock# 008863;
RRID:IMSR_JAX:008863
Strains Mouse:
Drd1a-tdTomato
The Jackson Laboratory Stock# 016204;
RRID:IMSR_JAX:016204
Strains Mouse: Mtss1flox/+ Center for Animal Resources
and Development Database
(CARD) under permission of
Dr. Mineko Kengaku
Card ID#2760
Strains Mouse: Plxnd1flox/flox Obtained from Dr. Chenghua
Gu
Kim et al., 2011
Strains Mouse: Sema3e+/- Obtained from Dr. Chenghua
Gu
Chauvet et al., 2007
Software, algorithm ImageJ NIH https://imagej.nih.gov/ij/
Software, algorithm Prism 9 GraphPad https://www.graphpad.com/scientific-Software/prism/
Software, algorithm Image Lab (v5.2.1) Bio-Rad https://www.bio-rad.com/
Software, algorithm Fusion FX Vilber https://www.vilber.com/fusion-fx/
Software, algorithm LightCycler480 (v1.5.1) Roche https://lifescience.roche.com/
Software, algorithm Leica Application Suite X Leica https://www.leicamicrosystems.com/
Software, algorithm NIS-Elements AR (v4.51.00) Nickon https://www.microscope.healthcare.nikon.com/
Software, algorithm NIS-Elements (v4.50.00) Nickon https://www.microscope.healthcare.nikon.com/
Software, algorithm AIVIA Aivia, Inc https://www.aivia-Software.com/
Other Immobilon-P PVDF Membrane Merck Cat# IPVH00010
Other RNA-seq (P5 mice, striatum) Data and code availability section in this paper GEO: GSE196558

Funding Statement

The funders had no role in study design, data collection and interpretation, or the decision to submit the work for publication.

Contributor Information

Won-Jong Oh, Email: ohwj@kbri.re.kr.

Jun Ding, Stanford University, United States.

K VijayRaghavan, National Centre for Biological Sciences, Tata Institute of Fundamental Research, India.

Funding Information

This paper was supported by the following grants:

  • Korea Brain Research Institute KBRI 23-BR-01-02 to Won-Jong Oh.

  • National Research Foundation of Korea NRF-2014R1A1A2058234 to Won-Jong Oh.

  • National Research Foundation of Korea NRF-2020M3E5D9079766 to Won-Jong Oh.

  • National Research Foundation of Korea NRF-2022M3E5E8017701 to Won-Jong Oh.

  • National Research Foundation Young Researcher Program 2020R1C1C1010509 to Namsuk Kim.

Additional information

Competing interests

No competing interests declared.

Author contributions

Data curation, Software, Formal analysis, Funding acquisition, Validation, Investigation, Visualization, Methodology, Writing - review and editing.

Data curation, Software, Formal analysis, Validation, Investigation, Visualization, Methodology.

Data curation, Formal analysis, Validation, Visualization, Methodology.

Data curation, Formal analysis, Visualization, Methodology.

Data curation, Formal analysis, Visualization.

Data curation.

Data curation, Visualization.

Data curation.

Data curation, Writing - review and editing.

Resources.

Resources, Data curation, Visualization, Writing - review and editing.

Conceptualization, Resources, Data curation, Software, Formal analysis, Supervision, Funding acquisition, Validation, Investigation, Visualization, Methodology, Writing - original draft, Project administration, Writing - review and editing.

Ethics

All protocols for animal experiments were approved by the Institutional Animal Care and Use Committee of Korea Brain Research Institute (IACUC-18-00008, 20-00012). All experiments were performed according to the National Institutes of Health Guide for the Care and Use of Laboratory Animals and ARRIVE guidelines.

Additional files

MDAR checklist

Data availability

The accession number for the RNA-Seq data reported in the present study is GSE196558.

The following datasets were generated:

W-J Oh. 2022. Axon guidance signal ensures neurite growth pace while sensitizing repulsive cues through induction of a dual function facilitator. NCBI Gene Expression Omnibus. GSE196558

W-J Oh. 2023. Axon guidance signal ensures neurite growth pace while sensitizing repulsive cues through induction of a dual function facilitator. MouseMine. GSE196558

References

  1. Ade KK, Wan Y, Chen M, Gloss B, Calakos N. An improved BAC transgenic fluorescent reporter line for sensitive and specific identification of striatonigral medium spiny neurons. Frontiers in Systems Neuroscience. 2011;5:32. doi: 10.3389/fnsys.2011.00032. [DOI] [PMC free article] [PubMed] [Google Scholar]
  2. Aghajanian H, Choi C, Ho VC, Gupta M, Singh MK, Epstein JA. Semaphorin 3d and semaphorin 3e direct endothelial motility through distinct molecular signaling pathways. The Journal of Biological Chemistry. 2014;289:17971–17979. doi: 10.1074/jbc.M113.544833. [DOI] [PMC free article] [PubMed] [Google Scholar]
  3. Arvanitis DN, Jungas T, Behar A, Davy A. Ephrin-B1 reverse signaling controls a posttranscriptional feedback mechanism via miR-124. Molecular and Cellular Biology. 2010;30:2508–2517. doi: 10.1128/MCB.01620-09. [DOI] [PMC free article] [PubMed] [Google Scholar]
  4. Bai G, Chivatakarn O, Bonanomi D, Lettieri K, Franco L, Xia C, Stein E, Ma L, Lewcock JW, Pfaff SL. Presenilin-dependent receptor processing is required for axon guidance. Cell. 2011;144:106–118. doi: 10.1016/j.cell.2010.11.053. [DOI] [PMC free article] [PubMed] [Google Scholar]
  5. Bellon A, Luchino J, Haigh K, Rougon G, Haigh J, Chauvet S, Mann F. VEGFR2 (KDR/Flk1) signaling mediates axon growth in response to semaphorin 3E in the developing brain. Neuron. 2010;66:205–219. doi: 10.1016/j.neuron.2010.04.006. [DOI] [PubMed] [Google Scholar]
  6. Bolte S, Cordelières FP. A guided tour into subcellular colocalization analysis in light microscopy. Journal of Microscopy. 2006;224:213–232. doi: 10.1111/j.1365-2818.2006.01706.x. [DOI] [PubMed] [Google Scholar]
  7. Bonanomi D, Valenza F, Chivatakarn O, Sternfeld MJ, Driscoll SP, Aslanian A, Lettieri K, Gullo M, Badaloni A, Lewcock JW, Hunter T, Pfaff SL. p190RhoGAP filters competing signals to resolve axon guidance conflicts. Neuron. 2019;102:602–620. doi: 10.1016/j.neuron.2019.02.034. [DOI] [PMC free article] [PubMed] [Google Scholar]
  8. Burk K, Mire E, Bellon A, Hocine M, Guillot J, Moraes F, Yoshida Y, Simons M, Chauvet S, Mann F. Post-endocytic sorting of Plexin-D1 controls signal transduction and development of axonal and vascular circuits. Nature Communications. 2017;8:14508. doi: 10.1038/ncomms14508. [DOI] [PMC free article] [PubMed] [Google Scholar]
  9. Chauvet S, Cohen S, Yoshida Y, Fekrane L, Livet J, Gayet O, Segu L, Buhot MC, Jessell TM, Henderson CE, Mann F. Gating of Sema3E/PlexinD1 signaling by neuropilin-1 switches axonal repulsion to attraction during brain development. Neuron. 2007;56:807–822. doi: 10.1016/j.neuron.2007.10.019. [DOI] [PMC free article] [PubMed] [Google Scholar]
  10. Chauvet S, Mire E, Mann F. Semaphorin signaling, methods and protocols. Methods in Molecular Biology. 2016;1493:223–235. doi: 10.1007/978-1-4939-6448-2. [DOI] [PubMed] [Google Scholar]
  11. Chen Y, Aardema J, Corey SJ. Biochemical and functional significance of F-BAR domain proteins interaction with WASP/N-WASP. Seminars in Cell & Developmental Biology. 2013;24:280–286. doi: 10.1016/j.semcdb.2013.01.005. [DOI] [PubMed] [Google Scholar]
  12. Dent EW, Gupton SL, Gertler FB. The growth cone cytoskeleton in axon outgrowth and guidance. Cold Spring Harbor Perspectives in Biology. 2011;3:a001800. doi: 10.1101/cshperspect.a001800. [DOI] [PMC free article] [PubMed] [Google Scholar]
  13. Ding JB, Oh WJ, Sabatini BL, Gu C. Semaphorin 3E–Plexin-D1 signaling controls pathway-specific synapse formation in the striatum. Nature Neuroscience. 2012;15:215–223. doi: 10.1038/nn.3003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  14. Droz B, Koenig HL, Giamberardino LD. Axonal migration of protein and glycoprotein to nerve endings. I. Radioautographic analysis of the renewal of protein in nerve endings of chicken ciliary ganglion after intracerebral injection of [3H]lysine. Brain Research. 1973;60:93–127. doi: 10.1016/0006-8993(73)90852-4. [DOI] [PubMed] [Google Scholar]
  15. Dupin I, Lokmane L, Dahan M, Garel S, Studer V. Subrepellent doses of Slit1 promote Netrin-1 chemotactic responses in subsets of axons. Neural Development. 2015;10:5. doi: 10.1186/s13064-015-0036-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
  16. Dupont S, Wickström SA. Mechanical regulation of chromatin and transcription. Nature Reviews. Genetics. 2022;23:624–643. doi: 10.1038/s41576-022-00493-6. [DOI] [PubMed] [Google Scholar]
  17. Ehrman LA, Mu X, Waclaw RR, Yoshida Y, Vorhees CV, Klein WH, Campbell K. The LIM homeobox gene Isl1 is required for the correct development of the striatonigral pathway in the mouse. PNAS. 2013;110:E4026–E4035. doi: 10.1073/pnas.1308275110. [DOI] [PMC free article] [PubMed] [Google Scholar]
  18. Franze K. Integrating chemistry and mechanics: The forces driving axon growth. Annual Review of Cell and Developmental Biology. 2020;36:61–83. doi: 10.1146/annurev-cellbio-100818-125157. [DOI] [PubMed] [Google Scholar]
  19. Fukuhara K, Imai F, Ladle DR, Katayama K, Leslie JR, Arber S, Jessell TM, Yoshida Y. Specificity of monosynaptic sensory-motor connections imposed by repellent Sema3E-PlexinD1 signaling. Cell Reports. 2013;5:748–758. doi: 10.1016/j.celrep.2013.10.005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  20. Gerfen CR, Surmeier DJ. Modulation of striatal projection systems by dopamine. Annual Review of Neuroscience. 2011;34:441–466. doi: 10.1146/annurev-neuro-061010-113641. [DOI] [PMC free article] [PubMed] [Google Scholar]
  21. Giehl K, Keller C, Muehlich S, Goppelt-Struebe M. Actin-mediated gene expression depends on RhoA and Rac1 signaling in proximal tubular epithelial cells. PLOS ONE. 2015;10:e0121589. doi: 10.1371/journal.pone.0121589. [DOI] [PMC free article] [PubMed] [Google Scholar]
  22. Gu C, Yoshida Y, Livet J, Reimert DV, Mann F, Merte J, Henderson CE, Jessell TM, Kolodkin AL, Ginty DD. Semaphorin 3E and plexin-D1 control vascular pattern independently of neuropilins. Science. 2005;307:265–268. doi: 10.1126/science.1105416. [DOI] [PubMed] [Google Scholar]
  23. Guez-Haddad J, Sporny M, Sasson Y, Gevorkyan-Airapetov L, Lahav-Mankovski N, Margulies D, Radzimanowski J, Opatowsky Y. The neuronal migration factor srGAP2 achieves specificity in ligand binding through a two-component molecular mechanism. Structure. 2015;23:1989–2000. doi: 10.1016/j.str.2015.08.009. [DOI] [PubMed] [Google Scholar]
  24. Harrington AW, Ginty DD. Long-distance retrograde neurotrophic factor signalling in neurons. Nature Reviews. Neuroscience. 2013;14:177–187. doi: 10.1038/nrn3253. [DOI] [PubMed] [Google Scholar]
  25. Hayn-Leichsenring G, Liebig C, Miething A, Schulz A, Kumar S, Schwalbe M, Eiberger B, Baader SL. Cellular distribution of metastasis suppressor 1 and the shape of cell bodies are temporarily altered in Engrailed-2 overexpressing cerebellar Purkinje cells. Neuroscience. 2011;189:68–78. doi: 10.1016/j.neuroscience.2011.05.038. [DOI] [PubMed] [Google Scholar]
  26. Heiman M, Schaefer A, Gong S, Peterson JD, Day M, Ramsey KE, Suárez-Fariñas M, Schwarz C, Stephan DA, Surmeier DJ, Greengard P, Heintz N. A translational profiling approach for the molecular characterization of CNS cell types. Cell. 2008;135:738–748. doi: 10.1016/j.cell.2008.10.028. [DOI] [PMC free article] [PubMed] [Google Scholar]
  27. Jung H, Yoon BC, Holt CE. Axonal mRNA localization and local protein synthesis in nervous system assembly, maintenance and repair. Nature Reviews. Neuroscience. 2012;13:308–324. doi: 10.1038/nrn3210. [DOI] [PMC free article] [PubMed] [Google Scholar]
  28. Kawabata Galbraith K, Fujishima K, Mizuno H, Lee SJ, Uemura T, Sakimura K, Mishina M, Watanabe N, Kengaku M. MTSS1 regulation of actin-nucleating formin DAAM1 in dendritic filopodia determines final dendritic configuration of Purkinje cells. Cell Reports. 2018;24:95–106. doi: 10.1016/j.celrep.2018.06.013. [DOI] [PubMed] [Google Scholar]
  29. Kim J, Oh WJ, Gaiano N, Yoshida Y, Gu C. Semaphorin 3E-Plexin-D1 signaling regulates VEGF function in developmental angiogenesis via a feedback mechanism. Genes & Development. 2011;25:1399–1411. doi: 10.1101/gad.2042011. [DOI] [PMC free article] [PubMed] [Google Scholar]
  30. Kim N, Jun MH, Jeong JY, Oh WJ. Optimized protocol for translatome analysis of mouse brain endothelial cells. PLOS ONE. 2022;17:e0275036. doi: 10.1371/journal.pone.0275036. [DOI] [PMC free article] [PubMed] [Google Scholar]
  31. Klingberg A, Hasenberg A, Ludwig-Portugall I, Medyukhina A, Männ L, Brenzel A, Engel DR, Figge MT, Kurts C, Gunzer M. Fully automated evaluation of total glomerular number and capillary tuft size in nephritic kidneys using lightsheet microscopy. Journal of the American Society of Nephrology. 2017;28:452–459. doi: 10.1681/ASN.2016020232. [DOI] [PMC free article] [PubMed] [Google Scholar]
  32. Kolodkin AL, Tessier-Lavigne M. Mechanisms and molecules of neuronal wiring: A primer. Cold Spring Harbor Perspectives in Biology. 2011;3:a001727. doi: 10.1101/cshperspect.a001727. [DOI] [PMC free article] [PubMed] [Google Scholar]
  33. Kreitzer AC, Malenka RC. Striatal plasticity and basal ganglia circuit function. Neuron. 2008;60:543–554. doi: 10.1016/j.neuron.2008.11.005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  34. Kronman H, Richter F, Labonté B, Chandra R, Zhao S, Hoffman G, Lobo MK, Schadt EE, Nestler EJ. Biology and bias in cell type-specific RNAseq of nucleus accumbens medium spiny neurons. Scientific Reports. 2019;9:8350. doi: 10.1038/s41598-019-44798-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
  35. Kuo HY, Liu FC. Synaptic wiring of corticostriatal circuits in basal ganglia: Insights into the pathogenesis of neuropsychiatric disorders. eNeuro. 2019;6:ENEURO.0076-19.2019. doi: 10.1523/ENEURO.0076-19.2019. [DOI] [PMC free article] [PubMed] [Google Scholar]
  36. Lin J, Liu J, Wang Y, Zhu J, Zhou K, Smith N, Zhan X. Differential regulation of cortactin and N-WASP-mediated actin polymerization by missing in metastasis (MIM) protein. Oncogene. 2005;24:2059–2066. doi: 10.1038/sj.onc.1208412. [DOI] [PubMed] [Google Scholar]
  37. Lin X, Wang H, Lou Z, Cao M, Zhang Z, Gu N. Roles of PIP2 in the membrane binding of MIM I-BAR: insights from molecular dynamics simulations. FEBS Letters. 2018;592:2533–2542. doi: 10.1002/1873-3468.13186. [DOI] [PubMed] [Google Scholar]
  38. Lobo MK, Karsten SL, Gray M, Geschwind DH, Yang XW. FACS-array profiling of striatal projection neuron subtypes in juvenile and adult mouse brains. Nature Neuroscience. 2006;9:443–452. doi: 10.1038/nn1654. [DOI] [PubMed] [Google Scholar]
  39. Lowery LA, Van Vactor D. The trip of the tip: understanding the growth cone machinery. Nature Reviews. Molecular Cell Biology. 2009;10:332–343. doi: 10.1038/nrm2679. [DOI] [PMC free article] [PubMed] [Google Scholar]
  40. Machesky LM, Johnston SA. MIM: a multifunctional scaffold protein. Journal of Molecular Medicine. 2007;85:569–576. doi: 10.1007/s00109-007-0207-0. [DOI] [PubMed] [Google Scholar]
  41. Mata A, Gil V, Pérez-Clausell J, Dasilva M, González-Calixto MC, Soriano E, García-Verdugo JM, Sanchez-Vives MV, Del Río JA. New functions of Semaphorin 3E and its receptor PlexinD1 during developing and adult hippocampal formation. Scientific Reports. 2018;8:1381. doi: 10.1038/s41598-018-19794-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
  42. Mattila PK, Salminen M, Yamashiro T, Lappalainen P. Mouse MIM, a tissue-specific regulator of cytoskeletal dynamics, interacts with ATP-actin monomers through its C-terminal WH2 domain. The Journal of Biological Chemistry. 2003;278:8452–8459. doi: 10.1074/jbc.M212113200. [DOI] [PubMed] [Google Scholar]
  43. Minkeviciene R, Hlushchenko I, Virenque A, Lahti L, Khanal P, Rauramaa T, Koistinen A, Leinonen V, Noe FM, Hotulainen P. MIM-deficient mice exhibit anatomical changes in dendritic spines, cortex volume and brain ventricles, and functional changes in motor coordination and learning. Frontiers in Molecular Neuroscience. 2019;12:276. doi: 10.3389/fnmol.2019.00276. [DOI] [PMC free article] [PubMed] [Google Scholar]
  44. Miralles F, Posern G, Zaromytidou AI, Treisman R. Actin dynamics control SRF activity by regulation of its coactivator MAL. Cell. 2003;113:329–342. doi: 10.1016/s0092-8674(03)00278-2. [DOI] [PubMed] [Google Scholar]
  45. Morello F, Prasad AA, Rehberg K, Vieira de Sá R, Antón-Bolaños N, Leyva-Diaz E, Adolfs Y, Tissir F, López-Bendito G, Pasterkamp RJ. Frizzled3 controls axonal polarity and intermediate target entry during striatal pathway development. The Journal of Neuroscience. 2015;35:14205–14219. doi: 10.1523/JNEUROSCI.1840-15.2015. [DOI] [PMC free article] [PubMed] [Google Scholar]
  46. Moriya J, Minamino T, Tateno K, Okada S, Uemura A, Shimizu I, Yokoyama M, Nojima A, Okada M, Koga H, Komuro I. Inhibition of semaphorin as a novel strategy for therapeutic angiogenesis. Circulation Research. 2010;106:391–398. doi: 10.1161/CIRCRESAHA.109.210815. [DOI] [PubMed] [Google Scholar]
  47. Neuhaus-Follini A, Bashaw GJ. The intracellular domain of the frazzled/DCC receptor is a transcription factor required for commissural axon guidance. Neuron. 2015;87:751–763. doi: 10.1016/j.neuron.2015.08.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  48. O’Donnell M, Chance RK, Bashaw GJ. Axon growth and guidance: receptor regulation and signal transduction. Annual Review of Neuroscience. 2009;32:383–412. doi: 10.1146/annurev.neuro.051508.135614. [DOI] [PMC free article] [PubMed] [Google Scholar]
  49. Oh WJ, Gu C. Establishment of neurovascular congruency in the mouse whisker system by an independent patterning mechanism. Neuron. 2013a;80:458–469. doi: 10.1016/j.neuron.2013.09.005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  50. Oh WJ, Gu C. The role and mechanism-of-action of Sema3E and Plexin-D1 in vascular and neural development. Seminars in Cell & Developmental Biology. 2013b;24:156–162. doi: 10.1016/j.semcdb.2012.12.001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  51. Pecho-Vrieseling E, Sigrist M, Yoshida Y, Jessell TM, Arber S. Specificity of sensory-motor connections encoded by Sema3e-Plxnd1 recognition. Nature. 2009;459:842–846. doi: 10.1038/nature08000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  52. Penrod RD, Kourrich S, Kearney E, Thomas MJ, Lanier LM. An embryonic culture system for the investigation of striatal medium spiny neuron dendritic spine development and plasticity. Journal of Neuroscience Methods. 2011;200:1–13. doi: 10.1016/j.jneumeth.2011.05.029. [DOI] [PMC free article] [PubMed] [Google Scholar]
  53. Percipalle P, Visa N. Molecular functions of nuclear actin in transcription. The Journal of Cell Biology. 2006;172:967–971. doi: 10.1083/jcb.200512083. [DOI] [PMC free article] [PubMed] [Google Scholar]
  54. Poliak S, Morales D, Croteau LP, Krawchuk D, Palmesino E, Morton S, Cloutier JF, Charron F, Dalva MB, Ackerman SL, Kao TJ, Kania A. Synergistic integration of Netrin and ephrin axon guidance signals by spinal motor neurons. eLife. 2015;4:e10841. doi: 10.7554/eLife.10841. [DOI] [PMC free article] [PubMed] [Google Scholar]
  55. Russell SA, Bashaw GJ. Axon guidance pathways and the control of gene expression. Developmental Dynamics. 2018;247:571–580. doi: 10.1002/dvdy.24609. [DOI] [PMC free article] [PubMed] [Google Scholar]
  56. Saarikangas J, Kourdougli N, Senju Y, Chazal G, Segerstråle M, Minkeviciene R, Kuurne J, Mattila PK, Garrett L, Hölter SM, Becker L, Racz I, Hans W, Klopstock T, Wurst W, Zimmer A, Fuchs H, Gailus-Durner V, Hrabě de Angelis M, von Ossowski L, Taira T, Lappalainen P, Rivera C, Hotulainen P. MIM-induced membrane bending promotes dendritic spine initiation. Developmental Cell. 2015;33:644–659. doi: 10.1016/j.devcel.2015.04.014. [DOI] [PubMed] [Google Scholar]
  57. Sakurai A, Gavard J, Annas-Linhares Y, Basile JR, Amornphimoltham P, Palmby TR, Yagi H, Zhang F, Randazzo PA, Li X, Weigert R, Gutkind JS. Semaphorin 3E initiates antiangiogenic signaling through plexin D1 by regulating Arf6 and R-Ras. Molecular and Cellular Biology. 2010;30:3086–3098. doi: 10.1128/MCB.01652-09. [DOI] [PMC free article] [PubMed] [Google Scholar]
  58. Sakurai A, Jian X, Lee CJ, Manavski Y, Chavakis E, Donaldson J, Randazzo PA, Gutkind JS. Phosphatidylinositol-4-phosphate 5-kinase and GEP100/Brag2 protein mediate antiangiogenic signaling by semaphorin 3E-plexin-D1 through Arf6 protein. The Journal of Biological Chemistry. 2011;286:34335–34345. doi: 10.1074/jbc.M111.259499. [DOI] [PMC free article] [PubMed] [Google Scholar]
  59. Samarakoon R, Goppelt-Struebe M, Higgins PJ. Linking cell structure to gene regulation: signaling events and expression controls on the model genes PAI-1 and CTGF. Cellular Signalling. 2010;22:1413–1419. doi: 10.1016/j.cellsig.2010.03.020. [DOI] [PMC free article] [PubMed] [Google Scholar]
  60. Scott-Solomon E, Kuruvilla R. Mechanisms of neurotrophin trafficking via Trk receptors. Molecular and Cellular Neurosciences. 2018;91:25–33. doi: 10.1016/j.mcn.2018.03.013. [DOI] [PMC free article] [PubMed] [Google Scholar]
  61. Surmeier DJ, Ding J, Day M, Wang Z, Shen W. D1 and D2 dopamine-receptor modulation of striatal glutamatergic signaling in striatal medium spiny neurons. Trends in Neurosciences. 2007;30:228–235. doi: 10.1016/j.tins.2007.03.008. [DOI] [PubMed] [Google Scholar]
  62. Tata A, Stoppel DC, Hong S, Ben-Zvi A, Xie T, Gu C. An image-based RNAi screen identifies SH3BP1 as a key effector of Semaphorin 3E-PlexinD1 signaling. The Journal of Cell Biology. 2014;205:573–590. doi: 10.1083/jcb.201309004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  63. Tessier-Lavigne M, Goodman CS. The molecular biology of axon guidance. Science. 1996;274:1123–1133. doi: 10.1126/science.274.5290.1123. [DOI] [PubMed] [Google Scholar]
  64. van der Zwaag B, Hellemons A, Leenders WPJ, Burbach JPH, Brunner HG, Padberg GW, Van Bokhoven H. PLEXIN-D1, a novel PLEXIN family member, is expressed in vascular endothelium and the central nervous system during mouse embryogenesis. Developmental Dynamics. 2002;225:336–343. doi: 10.1002/dvdy.10159. [DOI] [PubMed] [Google Scholar]
  65. Vitriol EA, Zheng JQ. Growth cone travel in space and time: the cellular ensemble of cytoskeleton, adhesion, and membrane. Neuron. 2012;73:1068–1081. doi: 10.1016/j.neuron.2012.03.005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  66. Winckler B, Mellman I. Trafficking guidance receptors. Cold Spring Harbor Perspectives in Biology. 2010;2:a001826. doi: 10.1101/cshperspect.a001826. [DOI] [PMC free article] [PubMed] [Google Scholar]
  67. Yamashita N, Usui H, Nakamura F, Chen S, Sasaki Y, Hida T, Suto F, Taniguchi M, Takei K, Goshima Y. Plexin-A4-dependent retrograde semaphorin 3A signalling regulates the dendritic localization of GluA2-containing AMPA receptors. Nature Communications. 2014;5:3424. doi: 10.1038/ncomms4424. [DOI] [PubMed] [Google Scholar]
  68. Yamashita N. Retrograde signaling via axonal transport through signaling endosomes. Journal of Pharmacological Sciences. 2019;141:91–96. doi: 10.1016/j.jphs.2019.10.001. [DOI] [PubMed] [Google Scholar]
  69. Yeh ML, Gonda Y, Mommersteeg MTM, Barber M, Ypsilanti AR, Hanashima C, Parnavelas JG, Andrews WD. Robo1 modulates proliferation and neurogenesis in the developing neocortex. The Journal of Neuroscience. 2014;34:5717–5731. doi: 10.1523/JNEUROSCI.4256-13.2014. [DOI] [PMC free article] [PubMed] [Google Scholar]
  70. Yu J, Lin S, Wang M, Liang L, Zou Z, Zhou X, Wang M, Chen P, Wang Y. Metastasis suppressor 1 regulates neurite outgrowth in primary neuron cultures. Neuroscience. 2016;333:123–131. doi: 10.1016/j.neuroscience.2016.07.002. [DOI] [PubMed] [Google Scholar]
  71. Yu R, Kim N-S, Li Y, Jeong J-Y, Park S-J, Zhou B, Oh W-J. Vascular Sema3E-Plexin-D1 signaling reactivation promotes post-stroke recovery through VEGF downregulation in mice. Translational Stroke Research. 2022;13:142–159. doi: 10.1007/s12975-021-00914-4. [DOI] [PMC free article] [PubMed] [Google Scholar]

Editor's evaluation

Jun Ding 1

In this manuscript, the authors proposed a novel and attractive model to address a fundamental question of how the locational and function of axon guidance molecules are regulated. They presented convincing data to support their working model. They showed important findings that Sema3E-Plexin-D1 signaling regulates the expression of Mtss1, which regulates the localization of Plexin-D1 and contributes to striatonigral axonal growth and turning.

Decision letter

Editor: Jun Ding1

In the interests of transparency, eLife publishes the most substantive revision requests and the accompanying author responses.

Decision letter after peer review:

[Editors’ note: the authors submitted for reconsideration following the decision after peer review. What follows is the decision letter after the first round of review.]

Thank you for submitting the paper "Repulsive Sema3E-Plexin-D1 signaling coordinates both axonal extension and steering via activating an autoregulatory factor, Mtss1" for consideration by eLife. Your article has been reviewed by 3 peer reviewers, and the evaluation has been overseen by a Reviewing Editor and a Senior Editor. The following individuals involved in review of your submission have agreed to reveal their identity: Hisashi Umemori (Reviewer #2); Pirta Hotulainen (Reviewer #3).

Comments to the Authors:

We are sorry to say that, after consultation with the reviewers, we have decided that this work will not be considered further for publication by eLife, at least in the present form.

Specifically, all three reviewers agree that this study is interesting with regard to the regulation of Mtss1 mRNA expression by the presence of PlexD1, and the requirement for Mtss1 to mediate Sema3E repulsive signaling in neurons in vitro. However, mechanistic insight is lacking. In particular, two key questions remain unanswered: how does Sema3E-PlexD1 regulate Mtss1 translation? What the actual functional link is between Mtss1 and Sema3E/PlexD1 signaling? If you are able to address these issues, we would be willing to reconsider the story in the form of a new submission.

Reviewer #1 (Recommendations for the authors):

In this study Kim et al. investigate mechanisms of axon extension and repulsive guidance mediated by signaling involving the secreted semaphorin 3E (Sema3E), its receptor plexin D1 (PlexD1), and the cytosolic membrane remodeling protein metastasis suppressor 1 (Mtss1). Sema3E/PlexD1 signaling has been shown to mediate classical repulsive guidance in developing CNS neurons and vasculature, and also select synapse formation for direct-pathway medium spina neurons (MSNs) that project to the substantia nigra (SNr). Here, the authors show using bulk transcriptomic profiling in striatal tissue that in PlexD1-/- mutants there is a dramatic down regulation of Mtss1 mRNA expression, and this can be observed in the striatum in situ and also when assessing Mtss1 protein biochemically. In heterologous non-neuronal cells in culture the authors show that the PlexD1 cytoplasmic domain and also the Mtss1 I-BAR domain are required for a direct interaction between these two proteins in a Sema3E-independent manner (similar assessment of these interactions in neurons in vivo or culture is not presented). In COS cells it is observed that co-expression of PlexD1 and Mtss1 leads to protrusive shape changes with co-localization of these two proteins that appears in part dependent upon the Mtss1 BAR domain-similar co-localization is seen in striatal neurons in culture. Importantly, Mtss1 is shown to be required for Sema3E neuronal growth cone collapse, and also for normal neurite outgrowth. Significant but modest defects in neuronal pathways reaching the SNr are presented in Mtss1 mutants, and these are shown in the context of the striatonigral pathway to be similar to what is observed in PlexD1 mutants.

Overall, this study is interesting with regard to regulation of Mtss1 mRNA expression by the presence of PlexD1, and the requirement for Mtss1 to mediate Sema3E repulsive signaling in neurons in vitro. However, we do not learn whether or not Mtss1 functions more generally in PlexD1-expressing cells that respond to Sema3E (i.e. vasculature), what the mechanism of action is regarding how PlexD1 regulates Mtss1 translation, or what the actual functional link is between Mtss1 and Sema3E/PlexD1 signaling-much of these data presented here are correlative.

1. Figure 1- Are similar effects on Mtss1 expression seen in Sema3E mutants? This is key, regardless of the result, in order to inform conclusions relating to actual activation of PlexD1 signaling with regulating of Mtss1 expression. Further, is there evidence directly showing that in neurons stimulated with Sema3E, Mtss1 expression is increased and, as a control, that this is not observed in Plxnd1-KO neurons. In Figure 1H, is Mtss1 present only in neuronal bodies? And what is the Mtss1 expression pattern in theSNr? Also, is there an explanation for why at P7 (Figure 1G) Mtss1 decreases while PlxnD1 is still elevated?

2. Page 6 – The claim that failure to see elevated Mtss1 expression in cultured striatal neurons shows that Mtss1 expression is regulated in a "cell autonomous manner" is not supported by this experiment since non-cell-autonomous interactions among these neurons in culture are not ruled out using this approach.

3. Figure 2 – Are any of these interactions assessed at the level of Western analysis between PlexD1 and Mtss1 observed in neurons, either in culture or in vivo? Further, if PlexD1 loss-of-function (LOF) leads to loss of Mtss1 expression, are the direct interactions between PlexD1 and Mtss1 in any way required to regulate Mtss1 expression (either in heterologous cell culture or in neurons)? Indeed, is Mtss1 mRNA expression regulated by Sema3E/PlexD1 in COS cells? Further, given results from others involving neuropilin-1 (Nrp1) in PlexD1-medated CNS axon guidance (Chauvet et al., 2007), has this co-receptor component been explored in the context of these interactions with Msst1 or Sema3E-dependence for them (or for that matter any other aspects of Mtss1 function in subsequent experiments in this study)?

4. Figure 3 – Does Sema3E affect the co-localization of PlexD1 and Mtss1 observed in COS cells? Further, the statement on page 8 "….These results confirm that the Plexin-D1 and Mtss1proteins form a complex in specialized cell structures such as filopodia…" is not supported by these imaging data-at best this modest co-localization is correlative.

5. Figure 4 – These data show a degree of co-localization of overexpressed PlexD1 and Mtss1 in Mtss1-/- neurons and the strong result that Mtss1 is required for Sema3E collapse. However, the conclusion that somehow PlexD1membrane targeting is the mechanism that mediates this effect is not strongly supported by these data. Does loss of Mtss1 affect membrane targeting of exogenous and also endogenous PlexD1? Can a transmembrane domain-containing PlexD1 protein targeted to the membrane affect neuronal morphology independent of Mtss1? Also, does the Mtss1 Bar-domain deletion construct fail to rescue Sema3E growth cone collapse in these neurons in vitro? Finally, what is the link to PlexD1 signaling with regard to effects of Mtss1 on neurite outgrowth? Clearly loss of Mtss1 does affect neurite outgrowth, but this is not directly linked in this study to PlexD1 and appears to be independent of Plexin signaling.

Also, what are the growth rates and growth cone responses at DIV6? Based on the Western blos from Figure 1L, there is a large difference between expression of Plxnd1/Mtss1 at DIV3 (when Sema3E-treatments were done in Figures 4H and Suppl. Figure 5) and at DIV 6.

6. Figure 5 – I am not convinced that there is reduced PlexD1 localization on axon trajectories-Sema3E-AP binding is reduced, however so is the trajectory be assessed, so in the absence of a ratiometric assessment of PlexD1 (as evidenced by Sema3E-AP binding) this is not convincing. Further, the statement "….Since no significant change in Plexin-D1 levels was observed in the striatum of Mtss1-deficient mice compared to those in littermate controls…" is not supported by bulk Western analysis of PlexD1 protein since no neuronal localization information is provided by these data.

7. Figure 6 – Have the authors looked in cross section at the Drd1a-tdT-labeled striatonigral pathways in order to provide data supporting the schematic in panel L? This could include higher resolution assessment of axon numbers in this pathway, which would support the overall conclusions regarding guidance effects mediated by Mtss1.

8. Have the authors attempted to generalize their analysis of Mtss1 function to the developing vasculature? Given that the strongest results here relate to regulation of Mtss1 mRNA expression by PlexD1 and also the requirement for Mtss1 for neuronal growth cone collapse, generalizing Mtss1 function to other PlexD1-expressing tissues known to respond to Sema3E would strengthen this study.

9. The authors are urged to review work in the guidance field involving the regulation of transcription by guidance cue receptors so that statements in the Discussion can be brought in line with work in this area (for example, netrin-mediated DCC signaling to the nucleus that regulates commissureless expression-see Russell and Bashaw, 2019, for a review).

Reviewer #2 (Recommendations for the authors):

Kim, Li et al. identified Mtss1 as a molecule regulated by Sema3E-Plexin-D1 signaling and investigated its roles in striatonigral axon growth and turning. They first showed that Sema3E-Plexin-D1 signaling induces Mtss1 expression in striatonigral projecting neurons. They then showed that Mtss1 physically interacts with Plexin-D1 and that Plexin-D1 localization at the axon growth cone appears to be perturbed in the absence of Mtss1. Finally, the authors showed that striatonigral axonal projections are impaired in Mtss1 KO mice, an outcome that is phenocopied in Plexin-D1 KO mice. With these data, the authors propose that Mtss1 is upregulated in response to Sema3E, possibly from the thalamostriatal neurons, through Plexin-D1, then interacts with Plexin-D1, facilitates the transport of Plexin-D1 to the growth cone, and sensitizes striatal axons to Sema3E for axonal repulsion, while contributing to axonal extension. This is a novel and exciting model proposing how axonal growth and pathfinding are regulated in the thalamo-striato-nigral circuit. However, additional data would help fully support their model. Furthermore, images and quantifications could be improved, and quantification methods could be clearly described. Specific points are listed below.

1. An interesting aspect of the proposed model is that Sema3E from the thalamostriatal neurons upregulates Mtss1 expression in striatonigral neurons. However, currently, the paper only includes the expression pattern of Sema3E. The authors could experimentally show the role of thalamic Sema3E.

2. Another interesting aspect of the proposed model is that Mtss1 binds to and transports Plexin-D1 to the growth cone. While the authors' data suggest that Plexin-D1 in the growth cone appears to be altered in the absence of Mtss1, the authors could demonstrate that indeed Mtss1 and Plexin-D1 are co-trafficked along axons.

3. The quality of images could be improved. Also, quantifications are missing for several figures. Furthermore, where quantifications are done, the methods used for the quantifications are not clearly described in the methods.

4. The discussion can be expanded. The authors may discuss more about their proposed model (Supplementary Figure 7).

Specific suggestions are listed below.

1. An interesting aspect of the proposed model is that Sema3E from the thalamostriatal neurons upregulates Mtss1 expression in striatonigral neurons. Regarding this point, the authors could inactivate Sema3E from thalamostriatal neurons and demonstrate the effect on Mtss1 expression and striatonigral axonal pathfinding.

2. Another interesting aspect of the proposed model is that Mtss1 binds to and transports Plexin-D1 to the growth cone. Regarding this point, the authors could demonstrate that indeed Mtss1 and Plexin-D1 are co-trafficked along axons, ideally with live imaging.

3. The quality of images should be improved. It is difficult to evaluate colocalization (e.g., Figure 3C, 4A), membrane localization (e.g., Figure 1H), axonal growth and pathfinding from the images presented. Also, quantifications are missing for several figures (including staining and Western blotting). Please quantify (e.g., Figure 1G, 1H, 2). Furthermore, where quantifications are done, the methods used for the quantifications are not clearly described in the methods. Please describe the methods, including the methods of normalization and verification of reproducibility (e.g., Figure 3D, 4B, 4C, 5-7).

Related to this point, Pearson's R may not be sufficient to establish colocalization as it could be influenced by the amount of protein expression. The authors may perform additional colocalization analysis, for example, by using a pixel scrambled image and demonstrating that the colocalization is not random. Also, the authors may consider quantifying the percent of Mtss1 that is positive for Plexin-D1 and vice versa.

4. The discussion can be expanded. The authors may discuss more about their proposed model (points #1 to #4 in Supplementary Figure 7), including the mechanistic insights into the roles of Mtss1 in axonal turning vs. growing.

Additional comments:

1. The term "cell-autonomous" may not be used appropriately by the authors in the paper. Since the authors propose that Sema3E from the thalamus activates Plexin-D1 to upregulate Mtss1, this does not appear cell-autonomous.

2. Plexin-D1-Mtss1 binding in a cell line may involve other molecules. Hence the binding could be indirect.

3. In Figure 4, if Plexin-D1 is not localizing to the growth cone, then where is it localized? The authors could include a lower magnification image showing the cell body and axon and quantify Plexin-D1 localization in these cellular compartments.

4. The use of AP-Sema3E is an established way of detecting Plexin-D1 localization. However, since it is expected that Mtss1 KO mice would have defects in both Plexin-D1 expression/localization and axon projections, the Sema3E binding may not be sufficient to conclude both "poor neuronal projection" and "reduced Plexin-D1 localization". Additionally, here, too, the authors need to explain how the quantifications were done to determine the Plexin-D1 positive path (%).

5. In Supplementary Figure 4E, Mtss1deltaWH2-myc seems to have much weaker effects. Since this construct contains the I-BAR domain, the authors may want to add some explanation.

Reviewer #3 (Recommendations for the authors):

In the developing nervous system, the axons of newly generated neurons extend toward destination targets following an exquisitely designed program. Axon guidance molecules are critical for neuronal pathfinding because they regulate both directionality and growth pace. This study describes a novel role for a Mtss1 in axon guidance. In general this is a good study but as Mtss1 has not been found earlier to be expressed in axons, expression and localization of endogenous Mtss1 in axons should be shown convincingly.

I think that authors convincingly show that Sema3E-Plexin-D1signaling regulates Mtss1 expression in projecting striatonigral neurons. Also Plexin-D1 – Mtss1 interaction seems clear as well. I like the idea that Plexin-D1 brings Mtss1 to filopodia where Plexin-D1 can bind Sema3E. However, the results presented for this idea were not convincing. First of all, expression and localization of endogenous Mtss1 should be shown. This is especially important because we did not find Mtss1 from axons (Saarikangas et al., Dev Cell 2015, Supplementary figure 2). There can be many reasons for this, age or cell type, for example, but due to this controversy, expression and localization of endogenous Mtss1 in axons must be shown convincingly.

In Figure 4, overexpressed Mtss1 localization is not supporting the idea of bringing Plexin-D1 to filopodia and plasma membrane. To me this localization looks quite strange. I am not sure what to do with this but maybe localization of endogenous Mtss1 will help here. Maybe overexpressed construct is not folding right? Is it dynamic? Actin looks strange in this cell as well (Figure 4A) (F-actin in the middle, where are filopodia, arcs, lamellipodia?).

Furthermore, the text says on line 195 that "Mtss1 targeting of Plexin-D1 to the growth cone is critical for robust Sem3E-induced repulsive signaling." For this, it would be good to show Plexin-D1 localization (endogenous) in Mtss1 cKO cells vs. control cells. Is there a change? Mtss1 overexpression seems to keep Plexin-D in the middle of growth cone rather than bringing Plexin-D to the filopodia and plasma membrane (Figure 4A). Plexin-D localization without Mtss1 overexpression is missing (is there a change in localization?).

Text says on lines 218-221 that "In mice expressing wild-type Mtss1 showed a significant level of Plexin-D1 in the neuronal pathway reaching the substantia nigra, whereas Mtss1-knockout mice exhibited poor neuronal projection and reduced Plexin-D1 localization on E17.5 (Figure 5A).

I have struggled by myself in measuring dendrite length in vivo and therefore I ask, how it was ensured that slices are from same depth and same cutting angle? If they vary, does it affect on results?

These are the critical issues. If Mtss1 is not expressed in axons (just as a possibility), is it possible that it affects axons by other mechanisms?

eLife. 2024 Mar 25;13:e96891. doi: 10.7554/eLife.96891.sa2

Author response


[Editors’ note: the authors resubmitted a revised version of the paper for consideration. What follows is the authors’ response to the first round of review.]

Comments to the Authors:

We are sorry to say that, after consultation with the reviewers, we have decided that this work will not be considered further for publication by eLife, at least in the present form.

Specifically, all three reviewers agree that this study is interesting with regard to the regulation of Mtss1 mRNA expression by the presence of PlexD1, and the requirement for Mtss1 to mediate Sema3E repulsive signaling in neurons in vitro. However, mechanistic insight is lacking. In particular, two key questions remain unanswered: how does Sema3E-PlexD1 regulate Mtss1 translation? What the actual functional link is between Mtss1 and Sema3E/PlexD1 signaling? If you are able to address these issues, we would be willing to reconsider the story in the form of a new submission.

We appreciate the editors and reviewers for their valuable input on the manuscript we generated in this study. We have incorporated new data as suggested by the editors and reviewers and have carefully addressed their comments in the new manuscript. Thank you for your time and effort in helping us improve the quality of our research.

Key Question 1. how does Sema3E-PlexD1 regulate Mtss1 translation?

First, to support the Mtss1 expression through Sema3E-Plexin-D1 signaling, we examine Mtss1 levels by adding exogenous Sema3E ligand directly to the cultured Sema3e-deficient striatal neurons at DIV2, prior to in vitro neuronal connections according to the scheme in Figure 2E. Sema3E administration increases Mtss1 expression in cultured MSNs from Sema3e-null striatum, but not from Plxnd1 knockout mice (Figures 2E-2I).

We also examined the expression of Mtss1 after treatment with an Akt inhibitor, MK2206 because Akt is already known to mediate the Sema3E-Plexin-D1 signaling cascade in neurons (Burk et al., 2017). We found that the inhibition of Akt signaling attenuated the induction of Mtss1 expression by Sema3E-Plexin-D1 signaling in the cultured MSNs (Figures 2J-2M). Additionally, MK2206 treatment attenuated the increased Mtss1 expression caused by the addition of exogenous Sema3E in the Sema3e-knockout neurons (Figures 2N-2O), suggesting that Sema3E-Plexin-D1 pathway is involved in Mtss1 expression through Akt signaling.

We are highly intrigued by the prospect of deciphering the molecular mechanism through which these repulsive axon guidance molecules mediate specific signaling cascades to regulate gene expression profiles in the future investigations. To pursue this research, we will need to identify an appropriate homogeneous cellular model and conduct in-depth gene regulation studies. We discussed other possibilities in the revised manuscript (Lines 384-417).

Key Question 2. What the actual functional link is between Mtss1 and Sema3E/PlexD1 signaling?

To explore the functional link between Mtss1 and Sema3E-Plexin-D1 signaling, we performed a few more experiments. First, we conducted the rescue experiments by overexpressing Mtss1 in the cultured Plxnd1 KO MSNs. As shown in Figures 3K-3L, Mtss1 overexpression rescued the growth reduction phenotype in Plxnd1 KO MSNs, suggesting that Sema3E-Plexin-D1 signaling regulates axonal growth through Mtss1.

Second, we have shown that Mtss1 is not only involved in axonal projections, but also in Plexin-D1 trafficking in navigation of striatonigral projections. To investigate the functional link in Plexin-D1 trafficking, we performed an AP-Sema3E binding assay to label the endogenous Plexin-D1 in the growth cones of cultured Drd1a-positive MSNs at DIV6 derived from WT or Mtss1 cKO mice. The data show that the intensity of Plexin-D1 was significantly decreased in Mtss1-deficient MSNs compared to WT, indicating that the absence of Mtss1 disrupts the normal trafficking of Plexin-D1 to the growth cones in cultured MSNs (Figures 5L-5M). To further investigate the role of Mtss1 in Plexin-D1 trafficking, we performed the time-lapse live imaging in cultured MSNs from WT or Mtss1 cKO mice. As shown in Figures 5G-5K and Videos 1-4, the dynamic transport of Plexin-D1-containing vesicles was defective in Mtss1-deficient MSNs. These data provide strong evidence that Mtss1 regulates Plexin-D1 trafficking, and its localization in combination with the co-localization analysis in Figures 5A-5F.

Third, using ratiometric assessment of Plexin-D1 localization in Mtss1-KO mice, we found in vivo evidence that despite reduced neuronal projections in the Mtss1-deficient MSNs, Plexin-D1 localization in striatonigral projections was more severely reduced in Mtss1-KO mice (Figures 7A-7E and 7N-7Q). These findings suggest that Mtss1 plays a role in facilitating the dynamic transport of Plexin-D1 along the growing neurites of direct-pathway MSNs, leading to an increased rate of Plexin-D1 localization in growing cones (Figures 5, 7A-7E, and 7N-7Q).

Fourth, we performed additional experiments to investigate whether Mtss1-mediated Plexin-D1 localization to the growth cones accelerates the repulsive response to the Sema3E ligand. We performed a growth cone collapse assay in cultured MSNs (Figures 6A-6F). In the initial submission, we found that WT Drd1a-tdT-positive MSNs showed a high collapse rate after exogenous Sema3E treatment, but MSNs lacking Mtss1 exhibited a lower collapse rate. For this revised manuscript, we performed rescue experiments by reintroducing WT Mtss1 into Mtss1-KO MSNs. We found that reintroduction of Mtss1 resulted in significant growth cone collapse, whereas overexpression of Mtss1 without the I-BAR domain, which does not bind to Plexin-D1, showed a reduced response to Sema3E (Figures 6A-6D). We also observed an irregular projection pattern in Mtss1 cKO mice or Plxnd1 cKO or Sema3e KO mice (Figure 8 and Figure 7—figure supplement 10). These results showed that the repulsive signaling by Plexin-D1 in response to Sema3E was significantly impaired by Mtss1 deficiency. However, unlike SH3BP1 or GIPC (Tata et al., 2014; Burk et al., 2017), Mtss1 was not involved in Plexin-D1 endocytosis and Plexin-D1 display on the plasma membrane (Figure 5—figure supplements 5A-D). Therefore, these results suggest that Mtss1 functions as a facilitator of Plexin-D1 trafficking and enhances the repulsive guidance of Sema3E-Plexin-D1 signaling.

Finally, we conducted experiments to explore whether Mtss1, under the Sema3E-Plexin-D1 signaling, also plays a role in the vasculature as a downstream mediator of common guidance cues. However, we found that (1) Mtss1 is not expressed in the developing vasculature and (2) its expression is not induced in the cultured endothelial cells (Figure 8—figure supplement 11). These results suggest that Mtss1 activation by Sema3E-Plexin-D1 signaling pathway and its function in neurons appear to be selective and distinct. We discussed this in the revised manuscript (Lines 538-551)

Taken together, we believe that our new data provide more compelling evidence to elucidate the mechanism of Mtss1 expression and its functional association with Plexin-D1.

Reviewer #1 (Recommendations for the authors):

In this study Kim et al. investigate mechanisms of axon extension and repulsive guidance mediated by signaling involving the secreted semaphorin 3E (Sema3E), its receptor plexin D1 (PlexD1), and the cytosolic membrane remodeling protein metastasis suppressor 1 (Mtss1). Sema3E/PlexD1 signaling has been shown to mediate classical repulsive guidance in developing CNS neurons and vasculature, and also select synapse formation for direct-pathway medium spina neurons (MSNs) that project to the substantia nigra (SNr). Here, the authors show using bulk transcriptomic profiling in striatal tissue that in PlexD1-/- mutants there is a dramatic down regulation of Mtss1 mRNA expression, and this can be observed in the striatum in situ and also when assessing Mtss1 protein biochemically. In heterologous non-neuronal cells in culture the authors show that the PlexD1 cytoplasmic domain and also the Mtss1 I-BAR domain are required for a direct interaction between these two proteins in a Sema3E-independent manner (similar assessment of these interactions in neurons in vivo or culture is not presented). In COS cells it is observed that co-expression of PlexD1 and Mtss1 leads to protrusive shape changes with co-localization of these two proteins that appears in part dependent upon the Mtss1 BAR domain-similar co-localization is seen in striatal neurons in culture. Importantly, Mtss1 is shown to be required for Sema3E neuronal growth cone collapse, and also for normal neurite outgrowth. Significant but modest defects in neuronal pathways reaching the SNr are presented in Mtss1 mutants, and these are shown in the context of the striatonigral pathway to be similar to what is observed in PlexD1 mutants.

Overall, this study is interesting with regard to regulation of Mtss1 mRNA expression by the presence of PlexD1, and the requirement for Mtss1 to mediate Sema3E repulsive signaling in neurons in vitro. However, we do not learn whether or not Mtss1 functions more generally in PlexD1-expressing cells that respond to Sema3E (i.e. vasculature), what the mechanism of action is regarding how PlexD1 regulates Mtss1 translation, or what the actual functional link is between Mtss1 and Sema3E/PlexD1 signaling-much of these data presented here are correlative.

1. Figure 1- Are similar effects on Mtss1 expression seen in Sema3E mutants? This is key, regardless of the result, in order to inform conclusions relating to actual activation of PlexD1 signaling with regulating of Mtss1 expression. Further, is there evidence directly showing that in neurons stimulated with Sema3E, Mtss1 expression is increased and, as a control, that this is not observed in Plxnd1-KO neurons. In Figure 1H, is Mtss1 present only in neuronal bodies? And what is the Mtss1 expression pattern in theSNr? Also, is there an explanation for why at P7 (Figure 1G) Mtss1 decreases while PlxnD1 is still elevated?

We deeply appreciate and value the insightful feedback the reviewer have provided us. We performed the experiments as you suggested and found a reduction in Mtss1 expression in the striatum of Sema3e KO mice (Figures 1F-1G) as well as in the cultured neurons isolated from Sema3e KO (Figures 2C-2D).

As your suggestion, we checked the expression of Mtss1 in neurons after activating Sema3E-Plexin-D1 signaling by treating with Sema3E ligand. Mtss1 expression was increased by Sema3E replenishment in Sema3e-knockout neurons, whereas it was not altered in Plxnd1-knockout neurons (Figures 2E-2I).

Regarding the localization of Mtss1, we observed Mtss1 in the neuronal bodies in the striatum (Figure 1J) and observed in striatonigral axon tract and SNr (Figure 7—figure supplement 7). Intriguingly, we also found Mtss1 in the axonal side of the cultured MSNs at DIV3 (Figure 3A). While we observed the presence of Mtss1 in the SNr region, we cannot exclude the possibility that substantia nigra neurons may express Mtss1 at this stage.

We appreciate the reviewer’s comment. We have also been contemplating deeply about the issue that you have raised. Our study revealed that the regulation of Mtss1 expression is not solely dependent on Sema3E-Plexin-D1 signaling. As shown in Figures 1K, 1L, 2A, and 2B, Mtss1 expression was observed at basal levels both in vivo and in cultured MSNs even in the absence of Sema3E-Plexin-D1 signaling. This indicates the presence of an additional regulatory mechanism in Mtss1 expression. During the developmental stage of P7, which coincides with the arrival of axons at their target destination, there is a noticeable decrease in the expression of Mtss1. This correlation between the reduction of Mtss1 expression and the completion of axonal projection has led us to speculate that retrograde signaling, possibly mediated by target-derived factors, may play a role in regulating the expression of Mtss1. A possible alternative explanation is that certain factors that suppress the expression of Mtss1 may begin to be expressed as Drd1a+ MSNs mature. We discussed in the revised manuscript (Lines 403-417).

2. Page 6 – The claim that failure to see elevated Mtss1 expression in cultured striatal neurons shows that Mtss1 expression is regulated in a "cell autonomous manner" is not supported by this experiment since non-cell-autonomous interactions among these neurons in culture are not ruled out using this approach.

We have removed the mentioned phrase in the revised manuscript in accordance with your suggestion.

3. Figure 2 – Are any of these interactions assessed at the level of Western analysis between PlexD1 and Mtss1 observed in neurons, either in culture or in vivo? Further, if PlexD1 loss-of-function (LOF) leads to loss of Mtss1 expression, are the direct interactions between PlexD1 and Mtss1 in any way required to regulate Mtss1 expression (either in heterologous cell culture or in neurons)? Indeed, is Mtss1 mRNA expression regulated by Sema3E/PlexD1 in COS cells? Further, given results from others involving neuropilin-1 (Nrp1) in PlexD1-medated CNS axon guidance (Chauvet et al., 2007), has this co-receptor component been explored in the context of these interactions with Msst1 or Sema3E-dependence for them (or for that matter any other aspects of Mtss1 function in subsequent experiments in this study)?

We appreciate the reviewer’s suggestions. We quantified the interaction between Mtss1 and Plexin-D1 in Figure 4F. We attempted to perform co-immunoprecipitation with in vivo striatum tissue to see the direct interaction between them. However, due to the nonspecific band issues of similar sizes, we were not able to clearly see their interaction in vivo and cultured neurons. Instead, we confirmed their direct interaction using pull-down assay using purified proteins as shown in Figure 4G. Furthermore, we performed additional immunoprecipitation experiments to test whether Mtss1 binds to other Plexin family proteins or, conversely, whether Plexin-D1 can interact with any BAR domain-containing protein (Figure 4—figure supplement 4). Our data clearly show that the formation of Mtss1-Plexin-D1 complex is relatively specific.

In this study, despite endogenous Mtss1 expression, Sema3E treatment did not induce Mtss1 expression in the Plexin-D1-overexpressing Cos7 cells or endothelial cells (Figure 3—figure supplements 3A-B and Figure 8—figure supplement 11C). Thus, we do not believe that the Plexin-D1-Mtss1 interaction is directly involved in the regulation of Mtss1 expression in general. Instead, we clearly demonstrated that Mtss1 functions as a specific transporter for Plexin-D1 trafficking in the direct-pathway MSNs (Figures 5G-5M).

Neurophilin is not expressed in the striatum (Ding et al., 2013). We mentioned that in the discussion part of revised manuscript (Lines 470-471).

4. Figure 3 – Does Sema3E affect the co-localization of PlexD1 and Mtss1 observed in COS cells? Further, the statement on page 8 "….These results confirm that the Plexin-D1 and Mtss1proteins form a complex in specialized cell structures such as filopodia…" is not supported by these imaging data-at best this modest co-localization is correlative.

We are thankful for your question and comments. We observed no effect of Sema3E treatment on the co-localization of Plexin-D1 and Mtss1 in the immunocytochemistry of COS cells (Figure 5—figure supplement 5H) and co-immunoprecipitation (Figures 4E-4F). The results suggest that ,unlike SH3BP1 that binds to Plexin-D1, Mtss1 is not involved in the Sema3E-Plexin-D1 signaling pathway but participated in trafficking of Plexin-D1 from cell body to axons.

We have deleted the sentence in the revised manuscript as you mentioned.

5. Figure 4 – These data show a degree of co-localization of overexpressed PlexD1 and Mtss1 in Mtss1-/- neurons and the strong result that Mtss1 is required for Sema3E collapse. However, the conclusion that somehow PlexD1membrane targeting is the mechanism that mediates this effect is not strongly supported by these data. Does loss of Mtss1 affect membrane targeting of exogenous and also endogenous PlexD1? Can a transmembrane domain-containing PlexD1 protein targeted to the membrane affect neuronal morphology independent of Mtss1? Also, does the Mtss1 Bar-domain deletion construct fail to rescue Sema3E growth cone collapse in these neurons in vitro? Finally, what is the link to PlexD1 signaling with regard to effects of Mtss1 on neurite outgrowth? Clearly loss of Mtss1 does affect neurite outgrowth, but this is not directly linked in this study to PlexD1 and appears to be independent of Plexin signaling.

We appreciate the reviewer’s comments. As shown in Figure 5—figure supplements 5A-D. Mtss1 did not affect membrane targeting of Plexin-D1 nor endocytosis of Plexin-D1. Mtss1 was crucial for transportation of Plexin-D1 to the growth cone, as shown in the time-lapse imaging and AP-Sema3E binding experiments in cultured MSNs (Figure 5) and aided to receive repulsive signals to Sema3E (Figure 6). Currently, it is not clear whether Plexin-D1 and Mtss1 are present as a complex at the membrane surface of the growth cone, but at least Mtss1 contributes to Plexin-D1 transport between the soma and the growth cone. We discussed this in the revised manuscript (Lines 363-368).

Ectopic expression of vsv-Plexin-D1DICD, which does not interact with Mtss1 (Figure 4C) did not rescue the reduced collapse phenotype shown in Plexin-D1-deficient MSNs, whereas full-length Plexin-D1 did. (Figure 6F).

Mtss1 lacking I-BAR domain construct failed to rescue the reduced collapse phenotype shown in Mtss1-deficient MSNs (Figures 6A-6D).

To explore whether the phenotype in Plexin-D1 null MSNs at DIV6 due to the reduction of Mtss1, we performed the rescue experiment by overexpressing Mtss1 in Plxnd1 KO neurons. As shown in Figures 3K-3L, the neurite outgrowth defect was recovered, suggesting that Plexin-D1 controls the axonal length of MSNs at DIV6 via regulation of Mtss1 expression in cultured MSNs.

Also, what are the growth rates and growth cone responses at DIV6? Based on the Western blos from Figure 1L, there is a large difference between expression of Plxnd1/Mtss1 at DIV3 (when Sema3E-treatments were done in Figures 4H and Suppl. Figure 5) and at DIV 6.

We appreciate the reviewer’s comments. We performed additional experiments at DIV6. As shown in Figures 3I-3J and 6E, the growth rates and growth cone responses of Plxnd1-null MSNs at DIV6 were significantly reduced. Neurite outgrowth in Mtss1-deficient MSNs was impaired at both DIV3 and DIV6. However, axon length abnormalities in Plexin-D1 null MSNs were only observed at DIV6, but not at DIV3 (Figures 3B-3J). We believe that phenotype is due to the fact that Mtss1 was not regulated by Plexin-D1 in the cultured MSNs at DIV3, as shown in Figures 2A and 2B.

6. Figure 5 – I am not convinced that there is reduced PlexD1 localization on axon trajectories-Sema3E-AP binding is reduced, however so is the trajectory be assessed, so in the absence of a ratiometric assessment of PlexD1 (as evidenced by Sema3E-AP binding) this is not convincing. Further, the statement "….Since no significant change in Plexin-D1 levels was observed in the striatum of Mtss1-deficient mice compared to those in littermate controls…" is not supported by bulk Western analysis of PlexD1 protein since no neuronal localization information is provided by these data.

We greatly appreciate to your profound insight and suggestions. As you suggested, we have performed a ratiometric assessment of Plexin-D1 and axons in WT or Mtss1-KO (Figures 7A-7E and 7N-7Q). At E17.5 in Mtss1 cKO mice, both Plexin-D1 and neurofilament decreased in the striatonigral tract, but the decrease in Plexin-D1 was significantly greater than that in neurofilament, as shown in Figures 7A-7E. Furthermore, we performed additional experiments to convince that Mtss1 affects both striatonigral extension and Plexin-D1 trafficking by quantifying the intensity of Plexin-D1 relative to tdT expression in neonatal pups at P5 (Figures 7N-7Q). We believe that these additional data contribute to more confident conclusions in our study.

7. Figure 6 – Have the authors looked in cross section at the Drd1a-tdT-labeled striatonigral pathways in order to provide data supporting the schematic in panel L? This could include higher resolution assessment of axon numbers in this pathway, which would support the overall conclusions regarding guidance effects mediated by Mtss1.

As the reviewer recommended, we improved the images of axons in the Drd1a-tdT-labeled striatonigral pathway by using Leica TCS SP8 confocal microscope (Figures 7K, 7R, Figure 7—figure supplement 8A, Figure 7—figure supplement 8D, and Figure 7—figure supplement 10A).

8. Have the authors attempted to generalize their analysis of Mtss1 function to the developing vasculature? Given that the strongest results here relate to regulation of Mtss1 mRNA expression by PlexD1 and also the requirement for Mtss1 for neuronal growth cone collapse, generalizing Mtss1 function to other PlexD1-expressing tissues known to respond to Sema3E would strengthen this study.

We appreciate the reviewer’s constructive comments on our study. To address the reviewer’s points, we obtained endothelial cell-specific Tie2-cre mice and investigated the expression of Mtss1 and its potential role in the developing vasculature using Mtss1 cKO mice (Tie2-cre; Mtss1f/f). As shown in Figure 8—figure supplement 11, our results showed that Mtss1 mRNA was not as highly expressed as Plexin-D1 mRNA in the vasculature at E14.5, and we did not observe any significant phenotype in the Mtss1 cKO mice unlike Plxnd1 cKO mice (Gu et al., 2005). In addition, when we performed the Sema3E ligand treatment experiment in endothelial cell lines (HUVEC (human umbilical vein endothelial cells) or HCMEC/D3 (human cerebral microvascular endothelial cells)), Mtss1 was not induced by Sema3E-Plexin-D1 signaling, unlike in the cultured MSNs (Figure 2 and Figure 8—figure supplement 11C). We discussed this in the revised manuscript (Lines 538-554).

9. The authors are urged to review work in the guidance field involving the regulation of transcription by guidance cue receptors so that statements in the Discussion can be brought in line with work in this area (for example, netrin-mediated DCC signaling to the nucleus that regulates commissureless expression-see Russell and Bashaw, 2019, for a review).

We added it in the discussion of revised manuscript (Lines 375-379).

Reviewer #2 (Recommendations for the authors):

Kim, Li et al. identified Mtss1 as a molecule regulated by Sema3E-Plexin-D1 signaling and investigated its roles in striatonigral axon growth and turning. They first showed that Sema3E-Plexin-D1 signaling induces Mtss1 expression in striatonigral projecting neurons. They then showed that Mtss1 physically interacts with Plexin-D1 and that Plexin-D1 localization at the axon growth cone appears to be perturbed in the absence of Mtss1. Finally, the authors showed that striatonigral axonal projections are impaired in Mtss1 KO mice, an outcome that is phenocopied in Plexin-D1 KO mice. With these data, the authors propose that Mtss1 is upregulated in response to Sema3E, possibly from the thalamostriatal neurons, through Plexin-D1, then interacts with Plexin-D1, facilitates the transport of Plexin-D1 to the growth cone, and sensitizes striatal axons to Sema3E for axonal repulsion, while contributing to axonal extension. This is a novel and exciting model proposing how axonal growth and pathfinding are regulated in the thalamo-striato-nigral circuit. However, additional data would help fully support their model. Furthermore, images and quantifications could be improved, and quantification methods could be clearly described. Specific points are listed below.

1. An interesting aspect of the proposed model is that Sema3E from the thalamostriatal neurons upregulates Mtss1 expression in striatonigral neurons. However, currently, the paper only includes the expression pattern of Sema3E. The authors could experimentally show the role of thalamic Sema3E.

2. Another interesting aspect of the proposed model is that Mtss1 binds to and transports Plexin-D1 to the growth cone. While the authors' data suggest that Plexin-D1 in the growth cone appears to be altered in the absence of Mtss1, the authors could demonstrate that indeed Mtss1 and Plexin-D1 are co-trafficked along axons.

3. The quality of images could be improved. Also, quantifications are missing for several figures. Furthermore, where quantifications are done, the methods used for the quantifications are not clearly described in the methods.

4. The discussion can be expanded. The authors may discuss more about their proposed model (Supplementary Figure 7).

Specific suggestions are listed below.

1. An interesting aspect of the proposed model is that Sema3E from the thalamostriatal neurons upregulates Mtss1 expression in striatonigral neurons. Regarding this point, the authors could inactivate Sema3E from thalamostriatal neurons and demonstrate the effect on Mtss1 expression and striatonigral axonal pathfinding.

We highly appreciate the reviewer’s insightful and helpful comments on our manuscript. To address the suggested concern, we observed the phenotype of striatonigral tract in Sema3e KO mice, as observed in Plxnd1 cKO or Mtss1 cKO mice. In Sema3e KO mice, we found a significant reduction in the width of the striatonigral tract, accompanied by irregular projections, as shown in Figure 7—figure supplements 10A-G. It is important to note, however, that this phenotype was comparatively milder than that observed in Plxnd1 cKO or Mtss1 cKO mice. Typically, the receptor phenotype is more severe than the ligand phenotype in axon guidance molecules. This trend is evident in Figures 7K-7M, 7R-7T, 8A-8F, Figure 7—figure supplements 8A-H, and Figure 7—figure supplements 10A-G, where the phenotype in Plxnd1 cKO or Mtss1 cKO mice is more pronounced than in Sema3e KO mice.

2. Another interesting aspect of the proposed model is that Mtss1 binds to and transports Plexin-D1 to the growth cone. Regarding this point, the authors could demonstrate that indeed Mtss1 and Plexin-D1 are co-trafficked along axons, ideally with live imaging.

We appreciate the reviewer’s constructive comments. We checked the localization of Mtss1 and Plexin-D1 along axons by using structured illumination microscopy (N-SIM). As shown in Figures 5A-5C, Plexin-D1 and Mtss1 proteins colocalized along growing axons, but the Mtss1 mutant lacking the I-BAR domain showed reduced Plexin-D1 levels as well as a low colocalization rate (Due to the reduced intensity, we employed Costes’ randomized pixel scrambled image method for quantification).

To further address the trafficking issue, we conducted time-lapse live imaging experiment. We generated a Plexin-D1-GFP and Mtss1-RFP fusion DNA construct and co-transfection into MSNs. Unfortunately, we were unable to detect co-transfected healthy MSNs due to extremely low transfection efficiency. Instead, we analyzed the live trafficking of Plexin-D1 from WT or Mtss1 KO MSNs after single transfection of the Plexin-D1-GFP construct (Figures 5G-5K, Videos 1–4). To analyze Plexin-D1 trafficking, we utilized Particle Tracking Recipe in AIVIA microscopy image analysis software (Aivia lnc.). As shown in Figures 5G-5I, both velocity and total distance of Plexin-D1-GFP were significantly reduced in MSNs derived from Mtss1 KO mice. This observation is consistent with the diminished levels of endogenous Plexin-D1 in the growth cone of MSN derived from Mtss1 KO mice (Figures 5L-5M).

3. The quality of images should be improved. It is difficult to evaluate colocalization (e.g., Figure 3C, 4A), membrane localization (e.g., Figure 1H), axonal growth and pathfinding from the images presented. Also, quantifications are missing for several figures (including staining and Western blotting). Please quantify (e.g., Figure 1G, 1H, 2). Furthermore, where quantifications are done, the methods used for the quantifications are not clearly described in the methods. Please describe the methods, including the methods of normalization and verification of reproducibility (e.g., Figure 3D, 4B, 4C, 5-7).

Related to this point, Pearson's R may not be sufficient to establish colocalization as it could be influenced by the amount of protein expression. The authors may perform additional colocalization analysis, for example, by using a pixel scrambled image and demonstrating that the colocalization is not random. Also, the authors may consider quantifying the percent of Mtss1 that is positive for Plexin-D1 and vice versa.

We appreciate the reviewer’s comments. We have improved the quality of the images (Figures 5D, 7K, 7R, Figure 7—figure supplements 8A and 8D). And we softened our claims about the colocalization in Figure 5—figure supplement 5F because the reviewer #1 also pointed out it. We replaced Figure 1H into Figures 1H and 1J in the revised manuscript. In addition, we have added the new supporting data in Figure 7—figure supplement 7 to clearly show the localization of Mtss1 in the striatonigral tract in vivo. As the reviewer recommended, we performed the quantifications (Lines 106-107, Figures 1N, 4F, 5C, 5F, and Figure 5—figure supplement 5G). Moreover, the detailed methods for the quantification were described in the Figure legend section and Quantification and Statistical analysis section in Materials and methods (Lines 846-859).

As commented by the reviewer, we employed Costes’ randomized pixel scrambled image method in Figures 5C, 5F, and Figure 5—figure supplement 5G. Images were analyzed for colocalization using the Just Another Colocalization Program (Jacop) plugin on ImageJ, which statistical data are reported from the Costes’ randomization based colocalization module (Bolte and Cordelieres, 2006) to account for the influence by the amount of protein expression. We described that in the Figure legend section and Quantification and Statistical analysis section in Materials and methods (Lines 846-859).

4. The discussion can be expanded. The authors may discuss more about their proposed model (points #1 to #4 in Supplementary Figure 7), including the mechanistic insights into the roles of Mtss1 in axonal turning vs. growing.

We expanded our Discussion section in the revised manuscript as the reviewer recommended.

Additional comments:

1. The term "cell-autonomous" may not be used appropriately by the authors in the paper. Since the authors propose that Sema3E from the thalamus activates Plexin-D1 to upregulate Mtss1, this does not appear cell-autonomous.

We have removed the phrase in the revised manuscript in accordance with your suggestion.

2. Plexin-D1-Mtss1 binding in a cell line may involve other molecules. Hence the binding could be indirect.

We appreciate the reviewer’s comments. To explore whether the binding between Plexin-D1 and Mtss1 is direct or not, we performed an in vitro binding assay with the purified Plexin-D1 (intracellular domain) and the I-BAR domain of Mtss1 protein. As shown in Figure 4G, they directly bind to each other.

3. In Figure 4, if Plexin-D1 is not localizing to the growth cone, then where is it localized? The authors could include a lower magnification image showing the cell body and axon and quantify Plexin-D1 localization in these cellular compartments.

We appreciate the reviewer’s feedback. We quantified the levels of Mtss1 and Plexin-D1 in the cell body (Figure 5—figure supplements 6A-B) and along axons (Figures 5A-5C) using structured illumination microscopy (N-SIM). Inhibiting the interaction with Mtss1 significantly reduced Plexin-D1 levels in axons. However, the expression levels of vsv-Plexin-D1 or Mtss1-myc or Mtss1DI-BAR -myc in the cell body remained unchanged, at least in our overexpression system. We speculated that this was likely due to the limited proportion of proteins transported to the nerve endings within the total protein pool. Although the extent to which the synthesized proteins in the cell body can be transported to nerve terminals is not fully understood, a previous study in chick peripheral nerve revealed that about 5% of slowly transported proteins can reach to the axoplasm (Droz B. et al., 1973). Thus, we believe that the majority of newly synthesized Plexin-D1 proteins are stored in the cell body and actively transported either anterogradely or retrogradely on demand. We mentioned this possibility in the result part of revised manuscript (Lines 231-234). As shown in Figures 5G-5K and Videos 1-4, the movement of Plexin-D1-positive vesicles dramatically reduced. These results indicate that Mtss1 facilitates the dynamic transportation of Plexin-D1 along the growing neurites of MSNs, leading to an increased rate of Plexin-D1 localization in the growth cones, as shown in Figures 5L-5M. We discussed this in the revised manuscript (Lines 418-432).

4. The use of AP-Sema3E is an established way of detecting Plexin-D1 localization. However, since it is expected that Mtss1 KO mice would have defects in both Plexin-D1 expression/localization and axon projections, the Sema3E binding may not be sufficient to conclude both "poor neuronal projection" and "reduced Plexin-D1 localization". Additionally, here, too, the authors need to explain how the quantifications were done to determine the Plexin-D1 positive path (%).

We appreciate the reviewer’s valuable comments. As the reviewer#1 suggested, we conducted a ratiometric evaluation of Plexin-D1 and axons in WT or Mtss1-KO, as shown in Figures 7A-7E and 7N-7Q. At E17.5 in Mtss1 cKO mice, both Plexin-D1 and neurofilament exhibited a decrease in the striatonigral tract. However, reduction in Plexin-D1 was notably more significant than that in neurofilament, as shown in Figures 7A-7E. Additionally, we performed supplemental experiments to substantiate that Mtss1 influences both striatonigral extension and Plexin-D1 trafficking by quantifying the intensity of Plexin-D1 relative to tdT expression in neonatal pups at P5 (Figures 7N-7Q). We believe that these additional data contribute to more confident conclusions in our study. We described the quantification method in Figure7 legend (Lines 1204-1207).

5. In Supplementary Figure 4E, Mtss1deltaWH2-myc seems to have much weaker effects. Since this construct contains the I-BAR domain, the authors may want to add some explanation.

We appreciate the reviewer’s comments. Mtss1 lacking the WH2 domain showed a much weaker effect because WH2 is an important region for Mtss1 interaction with F-actin (Mattila et al., 2003). We explained that in the result part of revised manuscript (Lines 148-149).

Reviewer #3 (Recommendations for the authors):

In the developing nervous system, the axons of newly generated neurons extend toward destination targets following an exquisitely designed program. Axon guidance molecules are critical for neuronal pathfinding because they regulate both directionality and growth pace. This study describes a novel role for a Mtss1 in axon guidance. In general this is a good study but as Mtss1 has not been found earlier to be expressed in axons, expression and localization of endogenous Mtss1 in axons should be shown convincingly.

I think that authors convincingly show that Sema3E-Plexin-D1signaling regulates Mtss1 expression in projecting striatonigral neurons. Also Plexin-D1 – Mtss1 interaction seems clear as well. I like the idea that Plexin-D1 brings Mtss1 to filopodia where Plexin-D1 can bind Sema3E. However, the results presented for this idea were not convincing. First of all, expression and localization of endogenous Mtss1 should be shown. This is especially important because we did not find Mtss1 from axons (Saarikangas et al., Dev Cell 2015, Supplementary figure 2). There can be many reasons for this, age or cell type, for example, but due to this controversy, expression and localization of endogenous Mtss1 in axons must be shown convincingly.

In Figure 4, overexpressed Mtss1 localization is not supporting the idea of bringing Plexin-D1 to filopodia and plasma membrane. To me this localization looks quite strange. I am not sure what to do with this but maybe localization of endogenous Mtss1 will help here. Maybe overexpressed construct is not folding right? Is it dynamic? Actin looks strange in this cell as well (Figure 4A) (F-actin in the middle, where are filopodia, arcs, lamellipodia?).

We appreciate the valuable comments from the reviewer. The indicated image has been replaced with a new one (Figure 5D). We believe that the F-actin enriched structure in the center of the growth cone is an F-actin arc. Furthermore, Mtss1 was not involved in the plasma membrane localization of Plexin-D1 (Figure 5—figure supplements 5A-B). Instead, Mtss1 facilitates Plexin-D1 trafficking from the cell body to the axons (Figures 5, 7A-7E, 7N-7Q, and Videos 1-4). Notably, we observed endogenous Mtss1 expression in axons of cultured MSNs (Figure 3A) at DIV3 in vitro and in striatonigral projecting axons (Figure 7—figure supplement 7) in vivo.

Furthermore, the text says on line 195 that "Mtss1 targeting of Plexin-D1 to the growth cone is critical for robust Sem3E-induced repulsive signaling." For this, it would be good to show Plexin-D1 localization (endogenous) in Mtss1 cKO cells vs. control cells. Is there a change? Mtss1 overexpression seems to keep Plexin-D in the middle of growth cone rather than bringing Plexin-D to the filopodia and plasma membrane (Figure 4A). Plexin-D localization without Mtss1 overexpression is missing (is there a change in localization?).

We appreciate the reviewer’s constructive suggestions. As shown in Figures 5L-5M, we observed the diminished level of endogenous Plexin-D1 in the growth cone of MSN derived from Mtss1 cKO mice compared to control. The result is consistent with the significant reduction of velocity and total distance of Plexin-D1-GFP in Mtss1-deficient MSNs in time-lapse live imaging experiment (Figures 5G-5K and Videos 1-4).

Text says on lines 218-221 that "In mice expressing wild-type Mtss1 showed a significant level of Plexin-D1 in the neuronal pathway reaching the substantia nigra, whereas Mtss1-knockout mice exhibited poor neuronal projection and reduced Plexin-D1 localization on E17.5 (Figure 5A).

I have struggled by myself in measuring dendrite length in vivo and therefore I ask, how it was ensured that slices are from same depth and same cutting angle? If they vary, does it affect on results?

We appreciate the reviewer’s comments. Regarding to the depth, we collected all sections from brain samples and matched them individually by comparing other brain areas such as ventricles, hippocampus, and cerebellum. For the section angle, we placed the brain in a plastic cryomolds in the correct orientation.

These are the critical issues. If Mtss1 is not expressed in axons (just as a possibility), is it possible that it affects axons by other mechanisms?

As shown in Figure 3A and Figure 7—figure supplement 7B, we observed endogenous Mtss1 expression in axons of MSNs at DIV 3 and in striatonigral tracts in vivo at this stage. However, we did not exclude the possibility that Mtss1 has functions in dendrites of MSNs. We discussed that in the Discussion section of the revised manuscript (Lines 418-454).

Associated Data

    This section collects any data citations, data availability statements, or supplementary materials included in this article.

    Data Citations

    1. W-J Oh. 2022. Axon guidance signal ensures neurite growth pace while sensitizing repulsive cues through induction of a dual function facilitator. NCBI Gene Expression Omnibus. GSE196558
    2. W-J Oh. 2023. Axon guidance signal ensures neurite growth pace while sensitizing repulsive cues through induction of a dual function facilitator. MouseMine. GSE196558

    Supplementary Materials

    Figure 1—source data 1. Western blots shown in Figure 1D, F, K, and M.
    Figure 1—figure supplement 1—source data 1. RT-PCR shown in Figure 1—figure supplement 1B.
    Figure 1—figure supplement 2—source data 1. Western blots shown in Figure 1—figure supplement 2C.
    Figure 2—source data 1. Western blots shown in Figure 2A, C, F, G, J, K, and N.
    Figure 3—figure supplement 1—source data 1. Western blots shown in Figure 3—figure supplement 1A.
    Figure 4—source data 1. Western blots and gel shown in Figure 4B, C, D, E, and G.
    Figure 4—figure supplement 1—source data 1. Western blots shown in Figure 4—figure supplement 1A–E.
    Figure 5—figure supplement 1—source data 1. Western blots shown in Figure 5—figure supplement 1A and C.
    Figure 7—figure supplement 3—source data 1. Raw uncropped western blot & gel images.

    Western blots shown in Figure 7—figure supplement 3F and H.

    Figure 8—figure supplement 1—source data 1. Western blots shown in Figure 8—figure supplement 1C.
    MDAR checklist

    Data Availability Statement

    The accession number for the RNA-Seq data reported in the present study is GSE196558.

    The following datasets were generated:

    W-J Oh. 2022. Axon guidance signal ensures neurite growth pace while sensitizing repulsive cues through induction of a dual function facilitator. NCBI Gene Expression Omnibus. GSE196558

    W-J Oh. 2023. Axon guidance signal ensures neurite growth pace while sensitizing repulsive cues through induction of a dual function facilitator. MouseMine. GSE196558


    Articles from eLife are provided here courtesy of eLife Sciences Publications, Ltd

    RESOURCES