Abstract
Amino acid availability is monitored by animals to adapt to their nutritional environment. Beyond gustatory receptors and systemic amino acid sensors, enteroendocrine cells (EECs) are believed to directly percept dietary amino acids and secrete regulatory peptides. However, the cellular machinery underlying amino acid-sensing by EECs and how EEC-derived hormones modulate feeding behavior remain elusive. Here, by developing tools to specifically manipulate EECs, we find that Drosophila neuropeptide F (NPF) from mated female EECs inhibits feeding, similar to human PYY. Mechanistically, dietary L-Glutamate acts through the metabotropic glutamate receptor mGluR to decelerate calcium oscillations in EECs, thereby causing reduced NPF secretion via dense-core vesicles. Furthermore, two dopaminergic enteric neurons expressing NPFR perceive EEC-derived NPF and relay an anorexigenic signal to the brain. Thus, our findings provide mechanistic insights into how EECs assess food quality and identify a conserved mode of action that explains how gut NPF/PYY modulates food intake.
Subject terms: Nutrient signalling, Feeding behaviour, Neuroendocrinology, Calcium signalling
Enteroendocrine cells in the gut sense food to regulate feeding behavior. Here, the authors show in Drosophila L-glutamate reduces the frequency of calcium oscillations in enteroendocrine cells and decreases the release of NPF, thereby reducing the activation of a pair of anorexic enteric neurons.
Introduction
Proper dietary protein intake has been increasingly recognized to promote growth and enable health and life span benefits1. Malnutrition due to insufficient protein consumption causes growth retardation and body wasting coupled with severe multiple tissue damages and anorexia, while dietary restriction for proteins or specific amino acids (AAs) extends lifespan in various organisms1,2. Apart from their roles as the building blocks of proteins and as neurotransmitters, AAs also regulate diverse animal physiology and behaviors3,4. Gaining mechanistic insights into AA detection and the physiological feedback signals emanating from AA limitation or excess should inform new strategies to maintain energy homeostasis and to improve health and lifespan.
In mammals, AA-sensing mechanisms have been deployed at multiple levels to detect the presence and survey the abundance of AAs available, further informing the nervous system on whether and how much to eat. First, taste receptors can detect AAs in the environment5. After ingestion, AAs become systemically available to organs and tissues and are further surveyed by cellular sensors including mTOR and GCN26,7. During digestion, digested dietary proteins are presented to intestinal epithelial cells where both absorption and concurrent food content evaluation take place8. Scattered throughout the intestinal epithelium, enteroendocrine cells (EECs) are directly exposed to and sense luminal nutrients9,10. In response to AAs, EECs release neuropeptides11,12 and modulate food intake13–16. In particular, enteroendocrine L-cells rapidly release the anorexigenic hormone, peptide YY (PYY), following ingestion of protein-rich food to avoid overeating17,18. EEC-derived PYY exerts its function through the NPY family receptors expressed in the vagal afferent neurons19, part of the enteric nervous system (ENS) that surveys the gastrointestinal milieu and relays information to the brain20. In vitro studies using EEC cell lines have shown that CaSR, GPRC6A and LPR5 are all general protein sensors that induce the secretion of regulatory peptides21. A specific L-glutamate sensor, metabotropic glutamate receptor 4 (mGluR4), is also expressed in a murine EEC cell line with considerable overlap with PYY expression22. However, the in vivo cellular mechanisms by which EECs detect AAs remain unknown10.
Drosophila has long been a leading model organism to uncover the fundamental principles of AA-sensing and the consequential modulation of animal behaviors and physiology in an integrated and whole-organismal manner23. Apart from its powerful genetics, efficient dietary manipulation has enabled accurate analysis of the effects of any single dietary AA24,25. The molecular basis and neuronal organization of AA perception have been extensively studied26–28. A broadly expressed ionotropic receptor, Ir76b, is necessary for AA preference in larval and adult Drosophila, and Ir76b-expressing neurons physiologically respond to AAs and yeast29–31. As in mammals, systemic AA levels are mainly sensed by the GCN2-ATF4 axis and the mTOR pathway, with the former principally detecting deficits of any AA and the latter being activated by only a few AAs including Leucine and Arginine7,32. GCN2 also plays a key role in sensing AA imbalance, a condition that is detrimental to many juvenile and adult traits33,34. Diverse internal cell types, ranging from the fat body cells35–40, enterocytes33, intestinal stem cells (ISCs)41 to neurons and glial cells34,35,42, have been reported to sense systemic AA availability. AA-sensing in turn enables coordination of organismal growth35–37,40 and energy metabolism39 with nutrient availability to adapt to nutritional environment. Remarkably, AA-sensing also instructs feeding behaviors, driving animals not only to adjust the quantity of food intake38,40,42, but also to choose between different food qualities to meet physiological demands so as to increase their fitness33–35. Despite the reports that several gustatory receptors can be detected in EECs43 and that a subset of EECs expressing Diuretic Hormone 31 (DH31)44 and tachykinin (Tk) can be activated by AAs45, the mechanism by which fly EECs detect AAs and the mode of action that gut peptides modulate organismal physiology and behaviors, however, remain unknown.
Vertebrates and insects share many features in the origin, specification, and function of EECs46. Notch signaling and bHLH proneural factors act in concert to control stem cell lineage decision and to specify EEC fate47–50. Notably, in mammals, EECs are specified by a bHLH factor of the Neurogenin family, Ngn 351, for which a single homolog, called Target of Pox neuro (Tap) is encoded in Drosophila genome with expression in a subset of EEC46,52. In both mammals and flies, the gene networks active in EECs overlap largely with those controlling the neurons, in addition to the fact that both cell types are excitable and secrete via dense core vesicles (DCVs) and synaptic vesicle (SVs)53. Such similarities between EECs and neurons, together with the fact that most EEC derived neuropeptides are also produced in the brain by neurosecretory cells54–56, make it technically challenging to clearly demonstrate the function of gut-derived neuropeptides in physiological studies using genetic approaches. Moreover, whether and how the same neuropeptide of gut or brain origin differs in its physiological function requires careful demonstration. An intriguing example of such discrepancy is the mammalian NPY family peptides, with NPY from the brain promoting feeding sharply contrasting with gut-derived PYY that conveys a satiety signal57.
Here, we analyze the role of EECs in AA-sensing by developing methods to specifically manipulate EECs without affecting the central nervous system (CNS). We first found that flies ablated for EECs (EEC-less flies) dramatically increased food intake. Both loss of NPF+ EECs and gut-specific depletion of the NPF neuropeptide recapitulated the upregulated food appetite seen in EEC-less flies. We further uncovered that NPF+ EECs directly sense dietary L-Glu via the metabolic glutamate receptor (mGluR). L-Glu sensing reduced NPF release into circulation, by slowing down calcium (Ca2+) oscillations that underlies the secretary activity of EECs. This in turn caused a drop in systemic NPF levels and promoted feeding by reducing the activity of a pair of enteric afferent neurons that express the NPF receptor (NPFR). Finally, we found that NPFR+ enteric neurons using dopamine synapsed with neurons in the subesophageal zone (SEZ), a brain center known to control feeding, to inhibit food intake. Hence, our work uncovers a key molecular basis of AA-sensing by EECs and reports a highly conserved mode of action by which gut-derived PYY/NPF restricts appetite by acting on ENS neurons.
Results
Loss of EECs increases food intake
To demonstrate the role of EECs in AA-sensing, EEC-specific manipulations without affecting the development or function of other cells, in particular neurons, are highly demanding. Because EEC specification shares a common root with that of sensory neurons46 and most EEC-derived neuropeptide hormones are also produced in the brain54–56, none of the available Gal4 drivers allows for EEC-specific manipulations58,59. Tachykinin (gut)-Gal4 (Tkg-Gal4) was reported to be specific to TK+ EECs60, and has been used in a number of intestinal studies61–66. However, Tkg-Gal4 was later found to drive substantial expression in brain62,67. In addition, a Gal80 transgene driven by an enhancer fragment (R57C10) of neuronal Synaptobrevin (nSyb) is often used in combination with Gal4 drivers to suppress Gal4 transcriptional activity in CNS, with the expectation that only EECs are manipulated68,69. However, the R57C10 fragment is also active in EECs58,70. An attempt has been made to ablate EECs by knocking down a proneural factor Scute (Sc) using the intestinal progenitor driver, esg-Gal461. Although EEC-less adult flies are generated with this method, it is not suitable for studying adult traits, since the ISCs are also eliminated by sc knockdown (Extended Data Fig. 1a–c, 1a’–b’). In addition, esg-Gal4>scRNAi may affect the development of the nervous system (Extended Data Fig. 1d). Therefore, new tools need to be developed to study EEC function.
An alternative way to remove EECs is to combine esg-Gal4>scRNAi with a temporal control using the TARGET system71 and restrict sc knockdown to a critical time window of EEC specification. Sc is required in ISCs for EEC specification at mid-pupal stage47, a stage when esg-Gal4 is not expressed in the nervous system (Extended Data Fig. 1d). Using the temperature-inducible ISC driver esg-Gal4 tub-Gal80ts UAS-GFP (esgts) to deplete sc for 10 h at 30 °C in this pupal stage (via shifting esgts>scRNAi pupae between different temperatures) (Fig. 1a, see Methods), rendered midguts with less than 10 EECs in young flies (3 days after eclosion (AE)) (Fig. 1b, c). In adults, EECs were slowly regenerated from ISCs, resulting in about 100 EECs on day 7 AE and about 500 on day 10 AE (Fig. 1b, c). We refer to this pupal-phase knockdown of sc to prevent EEC generation as esgP>scRNAi. Notably, removing EECs using this method changed neither the number of adult ISCs nor the rate of ISC division (Extended Data Fig. 1e–h).
Fig. 1. Loss of EECs increases the food intake.
a Schematic representation of genetic manipulation to specifically eliminate EECs before eclosion (esgP>scuteRNAi). APF, after pupal formation. AE, after eclosion. b, c Quantification b and representative images c of Pros+ (red) EECs in control and esgP>scuteRNAi midguts at 3, 7 and 10 d AE. Here and in all images, cell nuclei are stained for 4′, 6-diamidino-2-phenylindole (DAPI; blue). d Food intake of six different control lines and esgP>scuteRNAi flies at 3, 7 and 10 d AE. n = 15 in each genotype. e Standard cornmeal diet (SCD) consumption of control lines and esgP>scuteRNAi flies at 3 d AE measured using the dye-based food intake measurement. f Schematic representation of genetic manipulation to eliminate EECs during pupal and adult (esgP+A>scuteRNAi). g Quantification of Pros+ EECs in control and esgP+A>scuteRNAi midguts at 2, 4, 6 and 10 d AE. h Food intake of control and esgP+A>scuteRNAi flies at 2, 4, 6 and 10 d AE. n = 15 in each genotype. P values were shown in the figure. i The working status of the temperature control (TCD) device. j-o, Immunostaining of brains (red NC82 staining j, l, n) and midguts k, l, o of prosts > GFP+hid flies at 18 °C j, k, 30 °C l, m and in the TCD n, o. Note that GFP and Hid were not expressed in the head at 18 °C j and EECs were present k. EECs in prosts > GFP+hid flies m or prosTCD > GFP+hid flies o were eliminated at 30 °C, while prosts > l but not prosTCD > n drove GFP expression in the brain at 30 °C. 15 flies each were examined. p Food intake of control and prosTCD>hid flies. n = 5 in each genotype. Data are represented as mean ± SD. Significance was determined using two-sided unpaired t-test d, e, h, p. n, number of guts b, g, number of groups (5 flies in each group) performed for quantification of food intake d, h, p, or number of groups (20 flies in each group) performed for quantification of food consumption e. Source data are provided as a Source Data file. Scale bars, 20 μm except where otherwise specified.
As impaired AA-sensing is often associated with abnormal feeding, we measured food intake of esgP>scRNAi mated female flies using the Capillary Feeder (CAFE) assay72. esgP>scRNAi flies ingested significantly more at 3 day AE compared with control flies of six different backgrounds (Fig. 1d). We also used a dye-based food intake measurement to examine the feeding levels of EEC-less flies on a standard cornmeal diet (SCD)38,73. Our results show a significant increase in the amount of esgP>scRNAi flies feeding on SCD at 3 day AE compared to controls (Fig. 1e). In the following experiments, unless otherwise stated, we measured food intake using the CAFE assay.
Along with the gradual recovery of EECs, food intake of esgP>scRNAi flies dropped to the level of control groups by 10 day AE (Fig. 1d). To further demonstrate that EEC loss was responsible for the rise in food intake, we continued to prevent EEC regeneration by placing esgP>scuteRNAi adults at 30 °C upon eclosion (designated as esgP+A) (Fig. 1f), thereby limiting the number of EECs to no more than 10 (Fig. 1g). In this setting, we found a significant increase in food intake of esgP+A>scuteRNAi flies at 2, 4, 6 and 10 days AE compared to the control (Fig. 1h), again suggesting that the absence of EECs led to an increase in feeding. Despite overeating, these EEC-less flies defecated more (Extended Data Fig. 1i, j) and cleared the gut luminal contents faster than control (Extended Data Fig. 1k, l), with overall metabolic indexes (body mass (Extended Data Fig. 1m), glucose level (Extended Data Fig. 1n), protein (Extended Data Fig. 1o), triacylglyceride (TAG) (Extended Data Fig. 1p) and Oil red O staining (neutral lipids) of midgut epithelium (Extended Data Fig. 1q) indistinguishable from that of control flies.
As a complementary approach, we sought to eliminate EECs through targeted expression of a pro-apoptotic factor Hid74 using the pan-EEC driver prosperoV1 (pros)-Gal475,76. However, pros-Gal4 drives expression also in the brain77. To solve this problem, based on our previous study78, we developed a temperature control device (TCD) that enables well-controlled heating of the fly abdomen at a sub-millimeter scale (Fig. 1i and Extended Data Fig. 2a–h, see Methods). Combined with the temperature-sensitive EEC driver (pros-Gal4, tub-Gal80ts), TCD allows turning on hid expression only in EECs but not in the brain. We termed this method as prosTCD. Indeed, prosTCD>hid killed all EECs without triggering Hid expression in the brain (Fig. 1j–o). CAFE assays further confirmed a significant increase in food intake in these EEC-less prosTCD>hid flies (Fig. 1p). Thus, our data obtained with two methods to specifically monitor all the EECs indicated that EECs function to inhibit food intake.
EEC-derived NPF inhibits food intake
Next, we asked how the loss of EECs would lead to an increase in food intake. Since the gut microbiota-derived metabolites regulate food intake79–81, we first examined the composition of gut microbiota in intestines without EECs. Our results show that there was no significant difference in the composition of gut microbiota in the intestine of esgP>scuteRNAi 3d AE flies compared to the control (Extended Data Fig. 2i), suggesting that the rise in food intake due to EEC loss was not caused by changes in gut microbiota. In addition, we examined food intake between control flies and EEC-less flies (esgP>scRNAi) reared under conventional and germ-free conditions 3 d AE. Our results show that regardless of microbiome status, EEC-less flies always consumed more food than control flies (Extended Data Fig. 2j, k), demonstrating that the gut microbiota is not responsible for the increased food intake due to the loss of EECs.
We then speculated that neuropeptides secreted by EECs inhibit feeding. EECs display a high degree of cellular diversity in the neuropeptides they secrete54. However, esgP>scRNAi and prosTCD are not compatible with sub-dissection of EECs. Since Tkg-Gal4 drives expression in both brain and EECs (Extended Data Fig. 3a), an EEC-specific driver was still required. Encouraged by the homology between Tap and mammalian Ngn3 and the report that Tap is not a proneural protein in Drosophila46,52, we checked if tap enhancers drove expression in EECs. A 1.3 kb enhancer fragment of tap conferred gene expression in both EECs and the brain (Extended Data Fig. 3b). To our delight, the gut and brain expression could be separated when this 1.3 kb element was sub-dissected (Extended Data Fig. 3c). While a 399 bp fragment, referred as tap1.3-A, drove Gal4 expression in the brain (Extended Data Fig. 3d), a 432 bp fragment, termed tap1.3-B, directed Gal4 expression only in EECs (Fig. 2a). Specifically, tap1.3-B-Gal4 is expressed in each one of the paired EECs in midgut regions R2c, R3 (copper cell region) and R4a (Fig. 2a)82.
Fig. 2. EEC-derived NPF reduces food intake.
a Upper, expression pattern of tap1.3-B-Gal4 > GFP in CNS and midgut. No GFP was observed in the CNS. Lower, schematic representation of the distribution of tap1.3-B-Gal4 > GFP expressing EECs. 18 flies were examined. b Food intake of control and tap1.3-B-Gal4 > TNT flies. An impotent TNT (TNT-imp) was used as a control. c Food intake of control (attp empty) and tap1.3-B-Gal4>TrpA1 flies at 18 °C or 30 °C. d tap1.3-B-Gal4 > GFP+ cells were co-stained with NPF (red). 17 midguts were examined. e Emerging EECs were co-stained with NPF (green) in esgP>scuteRNAi midguts after 10 days recovery. 17 midguts were examined. f, g NPF staining (green) in brains and midguts of control f and tap1.3-B-Gal4 > NPFRNAi g flies. 24 flies each were examined. h Food intake of control and tap1.3-B-Gal4 > NPFRNAi flies. i, j Feeding time i and food intake j of control and tap1.3-B-Gal4 > NPFRNAi flies measured using the MAFE assay. k Food consumption of control and tap1.3-B-Gal4 > NPFRNAi flies measured using the dye-based food intake measurement. l Ectopic NPF supplements were achieved by injecting 100 nM NPF into the thorax. m Food intake of control and tap1.3-B-Gal4 > NPFRNAi flies after PBS and NPF injection. n Food intake of 3 d AE control and esgP>scuteRNAi flies after PBS and NPF injection. o Food intake of heterozygous (NPF1/+ and NPFnull/+) and homozygous NPF mutant (NPF1 and NPFnull) flies after PBS and NPF injection. p, q CAFE assay p and dye-based food intake measurement q of heterozygous (NPF1/+), homozygous NPF mutant (NPF1) and EECs-specific NPF recovery under NPF mutant condition (tap1.3-B-Gal4 > NPF, NPF1) flies. Data are represented as mean ± SD. Significance was determined using two-sided unpaired t-test b, c, h, k, m–q. n, number of groups performed for quantification of food intake (5 flies in each group) b, c, h, m–p, number of flies i, j, or number of groups (20 flies in each group) performed for quantification of food consumption k, q. Source data are provided as a Source Data file. Scale bars, 20 μm except where otherwise specified.
Neuropeptides are sorted into DCVs and released from peptidergic neurons by Ca2+-triggered exocytosis83. To test if neuropeptides secreted from tap1.3-B EECs regulate food intake, we blocked the secretion of tap1.3-B EECs by expression of the tetanus toxin light chain (TNT)84, a protease that cleaves nSyb, a SNARE that is required for DCV fusion with the plasma membrane85. tap1.3-B > TNT flies ingested significantly higher amounts of food than control flies (Fig. 2b). Moreover, exciting tap1.3-B EECs by expressing the transient receptor potential cation channel A1 (TrpA1), a temperature-sensitive cation channel86, significantly decreased food intake at 30 °C (Fig. 2c). By contrast, tap1.3-B>TrpA1 flies did not reduce food intake at 18 °C. These results suggest that neuropeptide(s) secreted by tap1.3-B EECs regulates food intake.
TK, NPF and Allatostatin C (Ast-C) are expressed in gut regions defined by tap1.3-B-Gal454,56. TK and NPF are expressed in the same EECs in this region, but TK-NPF and AstC display a mutually exclusive pattern in one pair of EECs50,54,87. TK (Extended Data Fig. 3e) and NPF (Fig. 2d) expression in tap1.3-B EECs was confirmed by immunostaining, suggesting Ast-C is not expressed in those cells. Moreover, both TK (Extended Data Fig. 3f) and NPF (Fig. 2e) positive EECs were recovered in EEC-less esgP>scRNAi flies raised to 10d AE, a time point that the overeating phenotype was suppressed. These expression analyses place TK and NPF as candidate neuropeptides that inhibit food intake.
Knock-down experiments of each neuropeptide genes were then performed. First, driving TkRNAi with either tap1.3-B-Gal4 or Tkg-Gal4 eliminated TK expression in tap1.3-B (Extended Data Fig. 3g–i) or all EECs (Extended Data Fig. 3k). However, food intake was not changed in either case (Extended Data Fig. 3j, l). By contrast, eliminating NPF in EECs but not in the brain using tap1.3-B-Gal4 (Fig. 2f, g and Extended Data Fig. 4a–h) or Tkg-Gal4 (Extended Data Fig. 4i) to drive NPFRNAi, significantly increased food intake (Fig. 2h and Extended Data Fig. 4j). This indicates that NPF, but not TK, secreted by tap1.3-B EECs inhibits feeding. In addition to the CAFE assay, we also utilized the Manual Feeding (MAFE) assay to depict details of the feeding behavior of individual flies88. We found that depletion of NPF in tap1.3-B EECs resulted in an increase in feeding time and total amount of food intake (Fig. 2i, j and Supplementary movie 1). Finally, not only sucrose food but also SCD was consumed significantly more by tap1.3-B > NPFRNAi flies (Fig. 2k), suggesting that knockdown of NPF in EECs increases the appetite of the flies.
In tap1.3-B > NPFRNAi flies, metabolic indexes of body mass (Extended Data Fig. 4k) and protein content (Extended Data Fig. 4l) were not changed compared with control flies. However, the glucose content (Extended Data Fig. 4m), body TAG level (Extended Data Fig. 4n) and Oil red O staining of guts (Extended Data Fig. 4o, p) were all significantly decreased, consistent with a previously described energy wasting status in flies depleted of gut NPF, which regulates lipid metabolism through glucagon-like and insulin-like hormones66,69. In summary, our genetic analysis demonstrates that EEC-derived NPF inhibits food intake.
EECs sustain systemic NPF to restrict feeding
In insects, EECs secrete regulatory peptides into the hemolymph, an open circulatory system which most internal organs directly bathing in44. As in a previous work66, our attempts to quantify the levels of NPF in the circulation with western blot or ELISA failed, likely due to the small size of mature NPF peptides. To support the idea that reduced NPF levels in the hemolymph (systemic NPF) underlies the increased food appetite seen in EEC-specific NPF knockdown (tap1.3-B > NPFRNAi) or EEC loss (esgP>scRNAi), synthesized NPF peptides were directly injected into the body cavity of flies (Fig. 2l). Re-supplying systemic NPF in this way suppressed the increase in food intake seen in flies devoid of gut NPF and EECs (Fig. 2m, n). To rule out any contribution from the NPF neurons in the brain to systemic NPF, thorax NPF injection was again performed using two null mutants of NPF62,89 and was still sufficient to reduce the food intake of NPF mutant flies (Fig. 2o). These results, together with our genetic evidence that EEC-derived NPF is required to avoid overeating, point to a specific role of EECs in maintaining NPF levels in the circulation. Of note, we noticed a significant reduction in food intake in these two null mutants of NPF that lack both brain NPF and gut NPF (Fig. 2o), consistent with a previous claim that brain-derived NPF promotes feeding90,91. It thus appears that the orexigenic effect of brain NPF overrides the role of gut NPF in restricting appetite. We then compared the food intake levels between NPF heterozygous mutant (NPF1/+), NPF homozygous mutant (NPF1) and gut-specific re-supply of NPF under the NPF mutant background (tap1.3-B-Gal4 > NPF, NPF1). Our results show that gut-derived NPF not only failed to rescue the reduced food intake caused by the NPF mutation, but also further suppressed food intake (Fig. 2p, q). These results support that NPF secreted by the brain and gut play opposing roles in appetite regulation, and that NPF secreted by the gut cannot replace the function of NPF secreted by the brain.
L-Glu sensing reduces NPF secretion from EECs
Next, we wondered whether different nutrients would affect the secretion of NPF in EECs. Flies were allowed to ingest food containing different major macronutrients and monitored for their gut NPF levels. We discovered that the intensity of NPF immunostaining in EECs was significantly increased when flies ingested high-protein food (5% yeast extract or yeast paste), but not high-sugar (10% sucrose) or high-fat (25% coconut oil)92 diets (Fig. 3a, b). This implied a role for gut NPF in AA-sensing. To determine which AAs were responsible for the increased NPF immunostaining, flies were allowed to ingest food supplemented with each of the 20 AAs. From this screen, we determined that NPF staining was dramatically enhanced upon 1% L-glutamate (Glu) or 1% L-asparagine (Asn) supplementation (Fig. 3c, d and Extended Data Fig. 5a–c). Because of the important role of L-Glu in umami perception and metabolism93,94, we focused here on the role of dietary L-Glu in regulating NPF secretion in EECs. Notably, L-Glu promoted NPF retention in EECs in a dose-dependent manner and its effect was prominent only at concentrations above 0.5% (Extended Data Fig. 5d, e). This is in line with the fact that commonly used cornmeal fly food with L-Glu content below 0.5% did not result in enhanced NPF retention (Fig. 3a). In addition, we examined the effect of 1% L-Glu on NPF expression in EECs of different regions of the midgut and in the brain. At the anterior end of midgut R2, if there was no NPF expression in the EEC before 1% L-Glu feeding, then high L-Glu failed to induce NPF staining in these regions (Extended Data Fig. 5f). In the brain, neither the high protein diets nor 1% L-Glu had an effect on NPF transcription or the intensity of NPF antibody staining (Extended Data Fig. 6a–c), suggesting that the high protein diet and 1% L-Glu only modulate NPF-expressed EEC in the midgut.
Fig. 3. Dietary L-Glu inhibits NPF secretion from EECs.
a, b Representative images a and quantification b of NPF staining after ingestion of different foods. n = 75 in each group. c Quantification of NPF staining after feeding of single L-amino acids. Red dash line boxes indicate the two AAs, L-Asn and L-Glu, that significantly elevated NPF intensity. n = 75 in each group. d Representative images of NPF staining after feeding of 5% sucrose, 5% sucrose +1% L-Glu or 5% sucrose +1% L-Asn. e Normalized NPF mRNA levels after feeding different food by RT-qPCR. Each genotype corresponded to 3 biological replicates of 50 midguts each. f, g Representative images f and quantification g of pANF-EMD staining (green) after ingestion of different food. n = 30 in each group. h, i Under 1% L-Glu feeding condition, representative images h and quantification i of NPF staining in EECs of control and tap1.3-B-Gal4>TrpA1 flies at 18 °C and 30 °C. n = 75 in each group. j Food intake of control and tap1.3-B-Gal4>TrpA1 flies under 1% L-Glu feeding condition at 18 °C and 30 °C. k, l High-sugar (SCD + 10% sucrose), high-fat (SCD + 25% coconut oil) and high-protein (SCD + 10%yeast) food consumption of control and tap1.3-B-Gal4 > NPFRNAi flies k or esgP>scuteRNAi flies at 3 d AE l measured using the dye-based food intake. m Schematic representation of the regulation of feeding by L-Glu that acts not only via neural perception, but also promotes appetite by inhibiting NPF release. n Food intake of control and tap1.3-B-Gal4 > NPFRNAi flies under different combinations of treatment (400 mM sucrose, 1% L-Glu, and NPF injection). Data are represented as mean ± SD. Significance was determined using two-sided unpaired t-test b, c, e, g, i–l, n. n, number of EECs b, c, g, i, number of groups performed for quantification of food intake (5 flies in each group) j, n, or number of groups (20 flies in each group) performed for quantification of food consumption k, l. Source data are provided as a Source Data file. Scale bars, 20 μm.
It is possible that the rise in NPF immunostaining in EECs was due to enhanced transcription of NPF and/or reduced peptide secretion. Since RT-qPCR revealed no transcriptional change in NPF mRNA from midgut of flies raised under multiple nutritional conditions (Fig. 3e), protein-rich food and L-Glu supplementation led to NPF retention in EECs was likely due to reduced secretion. To support this idea, we monitored neuropeptide secretion in DCVs by expressing a GFP-tagged rat atrial natriuretic factor (preproANF-EMD)83 in tap1.3-B+ EECs. After ruling out the possibility that tap1.3-B-Gal4 expression is regulated by high-protein diets or 1% L-Glu (Extended Data Fig. 6d), we revealed that pANF-EMD signals were significantly enhanced in EECs of flies ingesting high-protein and L-Glu diets, but not high-sugar or high-fat diet (Fig. 3f, g), indicating that protein/L-Glu-sensing by EECs reduced their secretory activity. To further confirm these observations, tap1.3-B>TrpA1 flies were reared on high-protein/L-Glu conditions and then underwent excitation. A concurrent and dramatic decrease in NPF immunostaining was observed when tap1.3-B>TrpA1 flies were shifted from 18 °C to 30 °C to open the TRP channels (Fig. 3h, i and Extended Data Fig. 6e–g), indicating that L-Glu triggered a rise in NPF staining by blocking the release of NPF from EECs. Although L-Glu greatly enhanced appetite, exciting tap1.3-B EECs to release NPF into circulation was still able to decrease animal food intake on an L-Glu diet (Fig. 3j). Consistent with these findings, flies with knockdown of NPF (Fig. 3k) or EEC loss (Fig. 3l) consumed similar amounts of food to controls only upon a high protein diet, suggesting that only a high protein diet inhibits the release of NPF into the circulation, whereas high sucrose and high fat diets do not. Thus, sensing of dietary L-Glu promotes feeding by inhibiting NPF secretion from EECs.
L-Glu can promote food intake of flies via Ir76b+ neurons in the labellum and legs and DH44+ neurons in the brain28,29,42. To integrate our findings of EEC perception of AAs with previously reported neuronal perception of L-Glu, we measured the effect of L-Glu in regulating food intake of animals with either normal or depleted gut NPF (Fig. 3m, n). While depletion of gut NPF led to increased food intake in a basic diet with only sucrose, supplying L-Glu in the diet to block NPF release blunted the effect of gut-specific loss of NPF although tap1.3-B > NPFRNAi flies trended to eat more but not to a level required for statistical significance (Fig. 3n). Moreover, on an L-Glu diet, NPF injection was still sufficient to significantly reduce food intake regardless of the presence or absence of gut NPF (Fig. 3n), further confirming a role of systemic NPF in restricting appetite. The observation that the anorexigenic effect of NPF injection only partially antagonized L-Glu-induced increase in food intake, supports the idea that NPF+ EECs in the gut act as a secondary system that feeds back (to the brain) and adjusts feeding upon umami perception by neurons.
L-Glu sensing slows down Ca2+ oscillation in EECs
Since the secretion of DCVs in neuroendocrine cells is regulated by Ca2+ signaling95,96, we hypothesized that high-protein/L-Glu diets inhibit NPF release by affecting Ca2+ signaling in EECs. We expressed a genetically encoded Ca2+ sensor GCaMP6f97 under the control of tap1.3-B-Gal4 and performed Ca2+ imaging in midguts dissected from flies reared on different diets (see Methods). Although the peak Ca2+ activities did not differ between various feeding conditions (Extended Data Fig. 7a and Supplementary movie 2, 3), quantification of the frequency of Ca2+ oscillations in individual tap1.3-B EECs revealed that high-protein/L-Glu diets, but not high-sugar or high-fat diets, significantly decelerated Ca2+ oscillations (Fig. 4a, b, Extended Data Fig. 7b–d and Supplementary movie 2, 3).
Fig. 4. Calcium oscillations of EECs regulate NPF secretion.
a, b Representative heatmap records of GCaMP intensity of 10 individual EECs a and quantification of calcium peaks in EECs b within 10 min (660 frames) under different feeding conditions. c Schematic representation of the regulation of Ca2+ flux. IP3R causes release of Ca2+ (red dots) from the ER to the cytoplasm. Stim senses the decline of Ca2+ in the ER, and induces extracellular Ca2+ influx into the cytoplasm, forming a high [Ca2+]. Excessive cytoplasmic Ca2+ is pumped into the ER by SERCA or out of the cell by PMCA, resulting in a decrease in cytoplasmic [Ca2+]. d, e Quantification of calcium peaks in EECs d and representative heatmap records of GCaMP intensity of 10 individual EECs e of flies with the indicated genotypes within 10 min. f, g Representative images f and quantification g of pANF-EMD staining in EECs of flies with the indicated genotypes. n = 30 in each genotype. h, i Representative images h and quantification i of NPF staining in EECs of flies with the indicated genotypes. n = 75 in each genotype. j Food intake of flies of control and the indicated genotypes. Data are represented as mean ± SD. Significance was determined using two-sided unpaired t-test b, d, g, I, j. n, number of EECs a, b, d, g, i, or number of groups performed for quantification of food intake (5 flies in each group) j. Source data are provided as a Source Data file. Scale bars, 20 μm.
We then wondered if the speed of Ca2+ oscillation in EECs underlies NPF secretion via DCVs. To this aim, we first sought to modify the frequency of Ca2+ oscillations in EECs by knocking down known regulators of cytosolic [Ca2+] (Fig. 4c)98–101. Cytosolic [Ca2+] are dynamically controlled by influx and efflux processes102. Specifically, GPCR signaling activity produces 1, 4, 5-inositol trisphosphate (IP3) that binds to the IP3 receptor (IP3R), an ER Ca2+ channel, allowing diffusion of Ca2+ from the ER into the cytosol101,103. Decreased ER [Ca2+] is sensed by the stromal interaction molecule (Stim), an ER membrane protein that opens the plasma membrane Ca2+ channel Orai, allowing influx of extracellular Ca2+ into the cytosol104–106. Conversely, the sarco/endoplasmic reticulum Ca2+-ATPase (SERCA) pumps cytosolic Ca2+ into the ER while the plasma membrane Ca2+ ATPase (PMCA) and Sodium calcium exchanger (NCX) channel extrudes Ca2+ out of the cell107–110. We found that knockdown of stim greatly accelerated Ca2+ oscillations, while depletion of SERCA, PMCA and IP3R significantly decreased the oscillation frequency (Fig. 4d, e, Extended Data Fig. 7e–j and Supplementary movie 4-7). Using these tools to manipulate Ca2+ oscillations specifically in tap1.3-B EECs, we uncovered a strong correlation among the speed of Ca2+ oscillations, the levels of DCV (Fig. 4f, g), NPF immunostaining (Fig. 4h, i) and animal food intake (Fig. 4j). During faster Ca2+ oscillations (stimRNAi), a reduction in the retention of both pANF-EMD and NPF in EECs (thereby increased NPF secretion) was observed (Fig. 4f–i), and these flies ate significantly less (Fig. 4j). By contrast, slower Ca2+ oscillations (SERCARNAi, PMCARNAi and IP3RRNAi), reminiscent of L-Glu feeding, elevated pANF-EMD and NPF retention in EECs (Fig. 4f–i), indicative of decreased NPF secretion. As a result, these flies consistently ingested more (Fig. 4j). Taken together, these data strongly support that the secretory capacity of EECs is instructed by cytosolic Ca2+ oscillations rather than absolute [Ca2+]. Thus, L-Glu sensing in EECs slows down Ca2+ oscillations to reduce the secretion of NPF into the circulation, where NPF is anorexigenic.
EECs sense dietary L-Glu through mGluR
Sixteen glutamate receptors are encoded in the fly genome89, including 2 metabotropic L-Glu receptors (mGluRs), 2 NMDA ionotropic receptors and 12 non-NMDA ionotropic receptors. We speculated that knocking down the L-Glu receptor(s) that mediates dietary L-Glu’s inhibitory effects in the secretory capacity of tap1.3-B EECs would enhance NPF secretion into the hemolymph, and in turn suppress food intake. With this idea, we performed an RNAi screen for glutamate receptors that sustain flies’ appetite to high L-Glu diet. We found that knockdown of mGluR (CG11144) but not other glutamate receptors in tap1.3-B EECs reduced the intake of L-Glu food (Fig. 5a), suggesting that mGluR in EECs senses dietary L-Glu to promote feeding. We subsequently found that knockdown of mGluR significantly accelerated Ca2+ oscillations in tap1.3-B EECs of flies raised under high L-Glu diet and yeast diets (Fig. 5b, e and Extended Data Fig. 8a, d). Consistently, the faster Ca2+ oscillations were accompanied with a decrease in the retention of both pANF-EMD (Fig. 5c, f and Extended Data Fig. 8b, e) and NPF (Fig. 5d, g and Extended Data Fig. 8c, f) in EECs. In sum, these results identified mGluR as the receptor that senses L-Glu by a subset of EECs.
Fig. 5. mGluR regulates the secretion of NPF from EECs.
a Food intake of flies depleted for different glutamate receptors in EECs under 1% L-Glu feeding condition. Red-dash line box indicates the two mGluRRNAi lines that significantly decreased the food intake. b Under 1% L-Glu feeding condition, representative heatmap records of GCaMP intensity of 10 individual EECs in control and tap1.3-B-Gal4>mGluRRNAi flies within 10 min. c Representative images of pANF-EMD staining in EECs of control and tap1.3-B-Gal4>mGluRRNAi flies under 1% L-Glu feeding condition. d Representative images of NPF staining in EECs of control and tap1.3-B-Gal4>mGluRRNAi flies under 1% L-Glu feeding condition. e–g Quantification of calcium peaks e, pANF-EMD f and NPF g staining in EECs of control and tap1.3-B-Gal4>mGluRRNAi flies under 1% L-Glu feeding condition. n = 30 f and =75 g. Data are represented as mean ± SD. Significance was determined using two-sided unpaired t-test (a, e–g). n, number of groups performed for quantification of food intake (5 flies in each group) a, or number of EECs e–g. Source data are provided as a Source Data file. Scale bars, 20 μm.
Two enteric neurons expressing NPFR (NPFRENS neurons) inhibit food intake
We next sought to understand the mode of action that EEC-derived systemic NPF exerts its function in restricting appetite. A single NPF receptor (NPFR) is encoded in the fly genome111. In line with the strong orexigenic effect of brain NPF (Fig. 2o), NPFR mutant flies also ingested less food than that of heterozygous controls (Fig. 6a), suggesting that the food intake of NPFR mutant flies recapitulates NPFR function in the brain111. Since brain- and EEC-derived NPF have opposite effects on feeding, it is less likely that the systemic NPF maintained by EECs acts through NPFR in the brain. Therefore, we speculated that NPFR-expressing cells outside the CNS perceive the systemic NPF secreted from EECs.
Fig. 6. A pair of NPFR-expressing enteric neurons senses NPF secreted from EECs and inhibits feeding.
a Food intake of NPFR heterozygous control (NPFR8/+ and NPFRnull/+) and NPFR mutant (NPFR8 and NPFRnull) flies. b NPFR staining (green) in EECs of control and tap1.3-B-Gal4 > NPFRRNAi flies. 30 midguts each were examined. c Food intake of control and tap1.3-B-Gal4 > NPFRRNAi flies. d The GFP expression pattern driven by NPFRRA/C-Gal4 in CNS (1), enteric neurons in the hypocerebral ganglion (HCG) (2), midgut circular muscle (3) and longitudinal muscle (4), EECs (5) and neuronal projection to the hindgut (6) and rectal ampulla (7). 25 flies were examined. e GFP expression pattern driven by GMR60E02 (NPFRENS)-Gal4. White dashed box frames the cell body of a pair of enteric neurons, with magnified view shown in the lower right corner. AKH staining (red) indicates the location of the corpora cardiaca. The enhanced GFP channel (white) is shown on the right. 31 flies were examined. f Food intake of flies with NPFR knockdown in NPFRENS neurons or elimination of this pair of neurons ( > hid). g Food intake of flies with the indicated genotypes. Note that inhibition of NPFRENS neurons ( > shits, 30 °C) promoted feeding, whereas exciting NPFRENS neurons ( > TrpA1, 30 oC) inhibited food intake. h, i Upon indicated manipulations, representative images h and quantification i of relative CaLexA intensity in NPFRENS neurons. j, k Food intake of flies with the indicated genotypes under 1% L-Glu feeding condition. NPFR knockdown in NPFRENS neurons j or inhibition of NPFRENS neuron function (k, >shits, 30 °C) had a similar food intake as control in PBS injection group, whereas NPFR knockdown j or inhibition of NPFRENS neurons k had a higher food consumption than control in NPF injection group. l Under 1% L-Glu feeding condition, activation of NPFRENS neurons ( > TrpA1, 30 oC) inhibited food intake. Data are represented as mean ± SD. Significance was determined using two-sided unpaired t-test a, c, f, g, i–l. n, number of groups performed for quantification of food intake (5 flies in each group) a, c, f, g, j–l, or the number of NPFRENS-Gal4+ cells i. Source data are provided as a Source Data file. Scale bars, 20 μm unless otherwise specified.
Using an anti-NPFR antibody, we were able to detect NPFR expression in tap1.3-B-Gal4+ EECs (Fig. 6b) and NPFR staining colocalizes with NPF antibody staining (Extended Data Fig. 9a). With the help of a transgenic reporter controlled by an NPF enhancer (NPF-0.7-GFP, Extended Data Fig. 9b, c), we confirmed that the same EECs express both NPF and NPFR (Extended Data Fig. 9d). However, knockdown of NPFR using tap1.3-B-Gal4 did not change food intake (Fig. 6b, c). To better follow endogenous NPFR expression, we generated a NPFR3xHA knock-in line, in which a 3xHA tag was inserted immediately before the stop codon of NPFR using homologous recombination assisted by CRISPR/Cas9 (Extended Data Fig. 9e). However, HA staining was too weak to be detected in tissues except EECs (Extended Data Fig. 9f). To find additional tissues expressing NPFR, we further examined two T2A-Gal4 knock-in lines that report NPFR isoform-specific expression patterns, NPFRRA/C-Gal4 and NPFRRB/D-Gal489. While both lines drove similar expression pattern in the brain, ventral nerve cord (VNC), visceral muscles and neuronal projections to the hindgut and rectal ampulla regions, NPFR-RA/C-Gal4 was additionally expressed in EECs, corpora cardiaca (CC)66,69 and enteric neurons in the hypocerebral ganglion (HCG) (Fig. 6d and Extended Data Fig. 10a)63.
Guided by the expression pattern, we investigated if NPFR is required in the visceral muscles or enteric neurons for feeding. Knocking down NPFR by muscle drivers vm-Gal4112 or How-Gal4113 did not alter food intake (Extended Data Fig. 10b), excluding a role for NPFR from gut muscles. To obtain a driver in NPFR+ enteric neurons, we screened a collection of putative NPFR enhancer-Gal4 lines114. Among them, GMR60E02-Gal4 containing 667 bp of the fourth intron of NPFR drove expression in HCG neurons (Fig. 6e and Extended Data Fig. 10c, d). Detailed inspection revealed a pair of enteric neurons with cell bodies located immediately anteriorly to the proventriculus of the adult gut (inset in Fig. 6e and Extended Data Fig. 10e). Their neurites ascend to the subesophageal zone (SEZ), a well-known brain center for feeding control115, and descend along the midgut wall to the end of the R1 region (Fig. 6e and Extended Data Fig. 10f)82. Stochastic labeling by MultiColor-FlpOut technique116 reveals that these two neurons have similar but diverse projections to the SEZ (Extended Data Fig. 10g). With an intersectional strategy (NPFRA/C-LexA ∩ GMR60E02-Gal4)117, we determined that GMR60E02-Gal4 neurons are truly NPFR expressing cells (Extended Data Fig. 10h). These two neurons are not the previously described NPFR-expressing cells in the CC66, as they stained negative for AKH, a CC marker (Fig. 6e and Extended Data Fig. 10i). This driver was termed as NPFRENS-Gal4 to refer its highly specific expression in the enteric nervous system. Strikingly, depleting NPFR using NPFRENS-Gal4 greatly increased animal food intake (Fig. 6f), implicating the two NPFRENS neurons in relaying the appetite control signal emanating from gut-derived NPF.
We then carried out functional characterization of the NPFRENS neurons in more detail. First, targeted ablation of NPFRENS neurons by expressing the proapoptotic factor Hid74,118 relieved restriction on fly appetite (Fig. 6f). Second, inhibiting NPFRENS neuronal activity by expressing a temperature-sensitive, dominant-negative form of Dynamin, shibirets (shits), elevated food intake when the releasable pool of synaptic vesicles was disrupted by raising flies at 30 °C (Fig. 6g). Third, activating NPFRENS neurons by expressing TrpA1 led to feeding inhibition at 30 °C (Fig. 6g), a condition that the TrpA1 cation channel is opened to depolarize neurons. Thus, NPFRENS neurons function to suppress feeding.
We further tested whether NPFRENS neurons mediate the physiological changes imposed by dietary L-Glu. A calcium-sensitive reporter CaLexA119 that drives GFP expression proportionally to cumulative neuronal activity, was applied to check if NPFRENS neurons respond to L-Glu supplementation by changing their activity. We determined that L-Glu or high-protein diets that were found to reduce gut secretion of NPF into the circulation, inhibited the activity of NPFRENS neurons compared to cornmeal food, 10% sucrose and 25% coconut oil food (Fig. 6h, i and Extended Data Fig. 10j, k). Conversely, directly supplying systemic NPF by injecting NPF peptides into the hemolymph significantly excited the NPFRENS neurons and completely blunted the suppressive effects imposed by L-Glu or high-protein diets (Fig. 6h, i and Extended Data Fig. 10j, k). Food intake was further measured to confirm that NPFRENS neurons mediate the anorexigenic effects of systemic NPF released from EECs. As previously described, 1% L-Glu feeding resulted in reduced NPF secretion from the EECs, and in this condition, knocking down NPFR in the NPFRENS neurons, or inhibiting NPFRENS neuronal activity by shits, did not alter the levels of food intake (Fig. 6j, k). This indicates that when systemic NPF levels turn low, NPFRENS neurons become no longer essential for the feeding control. By contrast, while NPF injection was sufficient to reduce the food intake of wild type control (NPFRENS>attp) flies raised on L-Glu diet, it no longer caused a drop in food intake of flies with depleted NPFR in NPFRENS neurons (Fig. 6j) or in flies whose NPFRENS neurons were silenced by shits (Fig. 6k). These data are consistent with a model that the two NPFRENS neurons are required to perceive systemic NPF levels and control feeding.
Further supporting our model, activation of NPFRENS neurons by expressing TrpA1, reduced feeding of flies raised both on normal diets (Fig. 6g) and on L-Glu diet, a condition with low systemic NPF (Fig. 6l). This indicates that permanently exciting NPFRENS neurons decouples feeding from the control by systemic NPF and is sufficient to convey a dieting signal.
Dopamine is required for NPFRENS neuron function
Encouraged by the crucial role of the two NPFRENS neurons in relaying the gut “feeling” of food quality into the brain, we went on to characterize the cellular and molecular nature of NPFRENS neurons. Combining the GFP-tagged presynaptic marker (nSyt::GFP)120 and the RFP-tagged dendritic marker (DenMark)121, we revealed that the neurites of NPFRENS neurons in the SEZ are axonal while the neurites innervating the midgut are dendrites (Fig. 7a).
Fig. 7. Axons of dopaminergic NPFRENS neurons connect to the SEZ and AL regions in the brain.
a NPFRENS neurons are labeled by nSyt::GFP (green, axons) and Denmark (red, dendrites). 24 flies were examined. b Food intake of flies expressing RNAi against key factors for the synthesis and function of different neurotransmitters in NPFRENS neurons. Red-dash line box indicates expressing RNAi lines against two key enzymes for the synthesis of dopamine (DA) significantly increases the food intake. c NPFRENS neurons (NPFRENS-Gal4 > mCD8:RFP, red) are co-labeled with the dopaminergic neuron marker Ddc-LexA>myr:GFP. Note they have the same dendritic pattern in the SEZ region. The white dashed box frames the cell body of NPFRENS neurons, with magnified views in the lower right corner. 23 flies were examined. d NPFRENS neurons (NPFRENS-Gal4 > mCD8:GFP, green) stained positive for Tyrosine hydroxylase (TH, red). 15 flies were examined. e Trans-tango experiment shows that NPFRENS neurons are synaptically connected with neurons (red, HA staining) in the subesophageal zone (SEZ) and antennal lobe (AL). 25 flies were examined. f Proposed model of EEC sensing of L-Glu and its downstream circuit. L-Glu sensing by EECs inhibits NPF secretion from EECs by slowing down Ca2+ oscillations, thereby blocking the activation of dopaminergic NPFR+ enteric neurons that inhibit feeding. Data are represented as mean ± SD. Significance was determined using two-sided unpaired t-test. n, number of groups performed for quantification of food intake, 5 flies in each group b. Source data are provided as a Source Data file. Scale bars are indicated in panels.
To further investigate the molecular mechanism whereby NPFRENS neurons inhibit feeding, we carried out an RNAi screen for genes coding for synthetases or transporters of neurotransmitters, by specifically knocking them down in NPFRENS neurons followed by food intake analyses (Fig. 7b). Inhibiting dopaminergic signaling by RNAi against Dopa decarboxylase (Ddc) or Vesicular monoamine transporter (Vmat) dramatically increased food intake (Fig. 7b). Consistent with the functional assay, the dopaminergic nature of the NPFRENS neurons was supported by their co-labeling with the dopaminergic marker Ddc-LexA > GFP both in the cell body and the neurites (Fig. 7c). Furthermore, immunostaining against Tyrosine hydroxylase (TH), an enzyme required for dopamine synthesis, confirmed the dopaminergic identity of NPFRENS neurons (Fig. 7d). Taken together, our data indicate that NPFRENS neurons use dopamine to signal feeding inhibition.
Finally, anterograde trans-synaptic labeling was performed to map the postsynaptic partners of NPFRENS neurons using a genetically encoded reporter trans-Tango122. This method identified neurons in the SEZ and antennal lobe (AL) that synapse with NPFRENS neurons (Fig. 7e). The dendritic pattern and cell body locations of those SEZ neurons revealed by trans-Tango reminded us of motor neurons115 and interneurons123,124 that control feeding. Such synaptic organization of NPFRENS neurons, reminiscent of the mammalian vagal afferent neurons125, is consistent with their role in facilitating communication between the periphery and the brain, by dynamically surveying the intestine and talking to the SEZ, the central pattern generator for feeding behaviors115.
Discussion
Our study has identified EECs as critical intestinal sensors of AAs. EECs along with the established gustatory and systemic AA sensors constitute a complete AA-sensing network dynamically evaluating food quality at each step of food ingestion and further informing the brain to adjust appetite. Through developing three approaches, we managed to perform clean manipulations of EECs. Remarkably, we uncovered that the modulation of specific features of intracellular Ca2+ signaling in EECs following L-Glu sensing adjusts animal feeding behavior via a gut-brain axis sustained by the NPF/NPFR system (Fig. 7f). Of note, our study highlights the secretory capacity of EECs is regulated by the frequency rather than peak intensity of Ca2+ oscillations and that gut-derived neuropeptides do not necessarily enter the brain to impact animal behaviors.
Upon AA sensing, EECs also regulate food intake in rodent models13–16. Further adding to the parallel, the two AAs (L-Glu and L-Asn) identified in our study that limit the secretion of NPF are also the two main AAs that trigger secretion of EECs via Ca2+ signaling in mammals. Thus, EECs in flies and in mammals share a high degree of functional similarities, suggesting the mechanisms that we have provided here with the unique power of Drosophila as a research paradigm should greatly advance understanding of the fundamental principles of EEC nutrient sensing process in human.
EECs are primary nutrient sensors, detecting luminal content and trans-epithelial flux of nutrients ranging from sugar, fat to protein and AAs126. The nutrient sensing process is usually initiated via recognition of specific nutrient molecule by receptors or transporters located in the plasma membrane8,10,127–131. However, the molecular engine driving the EEC secretory machinery following nutrient sensing had not been previously studied. As is the case with the excitation of neurons, fly work reveals that EECs respond to dietary proteins by changing cytosolic Ca2+ activity. CaLexA and GCaMP Ca2+ indicators revealed that a subset of EECs co-expressing DH31, CCHa1 and TK in the posterior midgut were activated by proteins and AAs45. These EECs responded to both essential and nonessential amino acids, but not to either single AAs, sugar or fat44,132. Thus, it appears that EECs of the II-p population54 dynamically evaluate the overall dietary protein levels but not specific AAs and in turn enhance secretory activity through elevated intensity of Ca2+ signaling.
This is in sharp contrast to NPF+ EECs that sense specific AAs as demonstrated here. NPF+ EECs were recently reported to sense dietary sugar and modulate fly feeding and metabolism66,69, although different SLC2-family sugar transporters (sut1 vs sut2) were deemed important in mediating sugar sensing in these studies. The discrepancy with our conclusion may have arisen from different feeding protocols. In our experiment, flies were only fasted for 3 h, or treated without fasting period (dye-based food intake measurement), after which we measured the food intake of flies over a 24-h period, whereas the two studies mentioned above looked at NPF function under acute starvation and sugar-refeeding conditions. Furthermore, Rewitz and colleagues found that NPF release upon sugar sensing or NPF injection limited sugar intake but promoted protein consumption indirectly through the glucagon-like factor AKH that mobilizes stored energy in adipose tissues69. In light of our findings that the two identified NPFRENS enteric neurons perceive NPF in circulation and directly synapse with SEZ neurons in the brain to terminate feeding, it is less likely that the NPF+ EEC-NPFRENS enteric neuron-SEZ circuit we identified in this work is responsible for nutrient-specific feeding decisions. Nevertheless, it is highly possible that NPF+ EECs can sense both AAs and sugar and adjust feeding behavior tightly depending on the exact feeding context and the downstream circuits.
By combining live Ca2+ imaging and genetic perturbations that alter Ca2+ oscillations, we noticed that L-Glu supplementation induced an mGluR-dependent deceleration of Ca2+ oscillations in EECs, causing retention of DCVs and their neuropeptide cargos. Our study reveals a crucial role of the frequency of Ca2+ oscillations in driving EEC secretion. By contrast, peak intensity of Ca2+ oscillations did not correlate with the secretory capacity of EECs. This finding is remarkable, as previous studies often simply highlight the intensity of Ca2+ oscillations as critical for cellular activities of neurons and EECs, without detailing the oscillation frequency. We reason that compared to neurons that use fast-acting small-molecule transmitters at synapses, EECs act via slow-acting neuromodulator peptides mostly through circulation and therefore need to keep releasing peptides to generate systemic concentrations above a critical threshold required to signal to the receptor in remote tissues.
Dietary L-Glu also activates Drosophila intestinal stem cells (ISCs) in an mGluR-dependent manner. Similarly, L-Glu slows down Ca2+ oscillations in ISCs as well and induces ISC proliferation by creating high cytosolic Ca2+ concentrations that drive stem cell dividing101. Thus, EECs and ISCs favor Ca2+ oscillation frequency and intensity respectively for their activity (secretion vs proliferation). In this way, different epithelial cell types generate a concerted response to L-Glu ingestion by simultaneously reducing release of NPF from EECs to increase food intake and activating stem cell activity to support intestinal growth and regeneration. It is plausible that distinct features of Ca2+ signaling have been opted for various cellular activities, necessitating examining oscillatory features of Ca2+ activity in future work.
NPY family of peptides including NPY itself, peptide YY (PYY) and pancreatic polypeptide (PP), are well known central regulators of feeding behavior in mammals. Drosophila encodes a single homolog of the NPY family peptide, NPF133. As a gut-brain peptide, our study reveals opposite roles for brain NPF and gut NPF in regulating feeding. We first confirmed previous claims that brain NPF promotes feeding90,91 and further mechanistically dissected the role and mode of action of gut-derived NPF. Similar to brain NPF, NPY is mainly expressed in the brain and promotes feeding134,135. Moreover, reminiscent of gut NPF in flies, PYY secretion is postprandially activated in enteroendocrine L-cells to restrict feeding13,57. Together, NPY/NPF are deeply conserved in feeding control depending on the location where the peptide is released.
The compartmentalized function of brain- and gut-derived NPF on feeding raises an interesting notion that some peptide hormones do not cross the blood-brain barrier (BBB), a specialized endothelial structure governing entry and exit of all small molecules to and from the brain interstitial space136, and therefore can act on target tissues in different ways. Our data do not support the notion that EEC-derived NPF interferes with the action of brain NPF, and vice versa. Our study provides an example of the functional compartmentalization of hormones between the brain and the periphery in Drosophila. The ability of BBB penetration may differ between neuropeptides as a few studies have reported that gut peptides are able to excite brain neurons despite no direct evidence supporting their BBB crossing44,66,132,137. While visualizing neuropeptide release and diffusion through circulation remains technically challenging138,139, future work should define the permeability and transportation features of the BBB.
While EECs release PYY upon ingestion of protein-rich food to limit appetite in mammals17, our genetic analysis together with NPF injection experiments shows that gut-derived NPF sustains a systemic function of NPF in restricting feeding in flies. Thus, intestinal epithelium-derived NPF/PYY exhibit an evolutionarily conserved role in restricting food appetite from flies to mammals. Intriguingly, PYY/NPF secretion from EECs appears to have been differentially regulated to fulfill respective nutritional demands of flies and mammals. Ingestion of protein-rich food leads to a reduction in NPF secretion from Drosophila gut, but instead promotes PYY secretion in mice. This is consistent with a notion that while mammals need to tightly adjust the overall energy balance to avoid metabolic disorders associated with uncontrolled food intake140, insects tend to maximize the acquisition of nutritious protein food for their reproduction and adaptation into the fast-changing nutritional environment. As a striking example, mosquitoes can typically consume an amount more than their own body weight in a single blood meal that is rich in proteins, and are then locked in a satiety state for 3-4 days, a process that requires the activity of an NPY-like receptor although its in vivo ligand and tissue source remain unclear141. The disparate control of NPF/PYY secretion upon AA-sensing in EECs of flies and mammals remains an interesting question and warrants further work to mechanistically dissect such diversified EEC response to the same nutrients.
Our study has provided an integrated view of how a gut peptide modulates animal behavior by acting on very specific enteric neurons. Enteric neurons form the “enteric” brain that not only execute all basic functions in the absence of input from the brain142, but also physically connect the gut to the brain with vagal afferent nerves143. While the mammalian ENS shows great complexity144,145, the gut innervations by neurons have recently been detailed in flies63. Enteric neurons regulate many aspects of physiology in flies and mammals20,146. Given their sensory capabilities, vagal afferents are best positioned to regulate food intake, either through gut hormones147,148 or by distension of the GI tract63,149–152.
Surprisingly, the two NPFR-expressing enteric neurons identified in this work exhibit striking capacity in controlling feeding. This pair of enteric neurons translate signals on food nutrition sent by NPF+ EECs. Importantly, their depolarization and silencing are both sufficient to decrease and increase food intake respectively, regardless of feeding conditions and systemic NPF levels, thus establishing themselves as previously unrecognized enteric neurons that play central role in appetite regulation. Like dedicated vagal afferent neurons, they have their cell bodies in the HCG outside the brain, innervate the anterior midgut to collect information and further send axons to the SEZ in the brain. The organization and function of the fly NPFRENS neurons should stimulate the search for specific vagal afferent neurons that upon activation reduce appetite in human.
Methods
Fly strains and culture
Flies were reared on a standard cornmeal diet (210 g dry inactivated yeast, 900 g yellow cornmeal, 120 g soy flour, 100 g agar (Biosharp), 800 ml light corn syrup, 150 ml propionic acid and 12 L water) at 25 °C and 65% humidity with a 12-h light:12-h dark daily cycle, unless otherwise indicated. The animals were transferred to fresh food every third day. Only mated female flies were used in all our experiments. The following lines were obtained from the TsingHua Fly Center: UAS-scuteRNAi (THU2205); UAS-NPFRNAi (THU2569); UAS-TkRNAi (THU2022); UAS-stimRNAi (THU2581); UAS-SERCARNAi (THU2107); UAS-PMCARNAi (THU1887); UAS-IP3RRNAi (TH02220.N); UAS-CG11155RNAi (THU3285); UAS-EkarRNAi (THU3080); UAS-GluRIARNAi 1 (TH201500449.S); UAS-GluRIARNAi 2 (THU2683); UAS-GluRIARNAi 3 (THU5238); UAS-GluRIBRNAi 1 (THU2758); UAS-GluRIBRNAi 2 (THU5273); UAS-GluRIBRNAi 3 (THU5358); UAS-GluRIIARNAi (THU2659); UAS-GluRIIBRNAi (THU3089); UAS-GluRIICRNAi (THU2049); UAS-GluRIIDRNAi (THU2151); UAS-GluRIIERNAi (THU3986); UAS-GrikRNAi (THU3979); UAS-KaiR1DRNAi (THU3982); UAS-mGluRRNAi 1 (THU5288); UAS-mGluRRNAi 2 (THU2115); UAS-mttRNAi 1 (THU0827); UAS-mttRNAi 2 (THU5594); UAS-Nmdar1RNAi 1 (THU2118); UAS-Nmdar1RNAi 2 (THU5286); UAS-Nmdar1RNAi 3 (THU5287); UAS-Nmdar2RNAi 1 (THU5240); UAS-Nmdar2RNAi 2 (THU5249); UAS-Nmdar2RNAi 3 (THU5862); UAS-NPFRRNAi (THU2116); UAS-ChATRNAi 1 (TH02505.N); UAS-ChATRNAi 2 (TH201500313.S); UAS-DdcRNAi (THU2416); UAS-VmatRNAi (TH01473.N); UAS-GadRNAi 1 (TH02214.N); UAS-GadRNAi 2 (TH201500431.S); UAS-VGATRNAi (THU4304); UAS-HdcRNAi (THU2140); UAS-TbhRNAi 1 (TH02221.N); UAS-TbhRNAi 2 (TH201500898.S); UAS-Tdc2RNAi (THU2075); UAS-TrhRNAi (THU2052); UAS-VGlutRNAi (THU2700). The following lines were obtained from the University of Indiana Bloomington Drosophila Stock Center (BDSC): esg-Gal4 (BL#93857); UAS-attp2 empty (BL#36303); UAS-attp40 empty (BL#36304); canton-s (BL#64349); tap1.3-Gal4 (BL#46377); UAS-nls-GFP (BL#4776); UAS-clumsyRNAi (BL#28351); vm-Gal4 (BL#48547)112; How-Gal4 (BL#1767)153; GMR60E02-Gal4 (BL#39250); GMR60G05-Gal4 (BL#39259); GMR61H06-Gal4 (BL#39281); GMR65C12-Gal4 (BL#39348); 20XUAS-6xGFP (BL#52262); nsyb-FlpL;; UAS>stop > FLAG, UAS>stop > HA (BL#64087); UAS-shits (BL#66600); Ddc-LexA (BL#54218). w1118 was obtained from Vienna Drosophila Resource Center. NRE-LacZ, esg-Gal4, tub-Gal80ts, UAS-GFP154 and UAS-hid was kindly donated from Benjamin Ohlestin (University of Texas Southwestern Medical Center). OreR (BL#5) was kindly donated from the laboratory of Jianhua Huang (Zhejiang University). Tkg-Gal460 was kindly donated from the laboratory of Wei Song (Wuhan University). UAS-TNT-imp (BL#28841) and UAS-TNT-G2 (BL#28838) were kindly donated from the laboratory of Zhihua Liu (Hubei University). UAS-TrpA1 (BL#26263)155; UAS-Denmark,UAS-nsyt:GFP (BL#33065)156; 13XLexAop-myr:GFP, UAS-mCD8:RFP;;10XUAS-CaLexA119; 8xLexAop-FlpL,UAS>stop>myr:GFP157; trans-tango122 and 13xLexAop-myr:GFP,UAS-mCD8:RFP157 strains were kindly donated from the laboratory of Yufeng Pan (Southeast University). NPFRRA/C-Gal4; NPFRRB/D-Gal4; NPFRRA/C-LexA; NPFattP (NPFnull) and NPFRattP (NPFRnull) were kindly donated from the laboratory of Yi Rao (Peking University)89. Prosv1-Gal4,tub-Gal80ts,UAS-GFP158 was kindly donated from Jean-François Ferveur (Université Paris-Sud). UAS-pANF-EMD83 was kindly donated from David Deitcher (Cornell University). NPFsk1 (NPF1) and NPFR8 were kindly donated from Shu Kondo (Tokyo University of Science)62. UAS-GCaMP6f was kindly donated from Shan Jin (Hubei University). UAS-tdTomato was kindly donated from Kenneth Irvine (Rutgers University). UAS-NPF111 was kindly donated from Todd Schlenke (University of Arizona). UAS-mCD8:GFP, UAS-Redstinger159,160 was kindly donated from Woo Jae Kim (HIT Center for Life Sciences, HIT). The fly lines used are listed in Supplementary Table 1. No ethical approval is needed for the use of the fruit fly Drosophila.
Generation of transgenic flies
tap1.3-A-Gal4, tap1.3-B-Gal4 and NPF-0.7-GFP
To generate gut specific driver and reporter constructs, primers shown below were used to amplify the regulatory regions of tap and NPF. The PCR products were first cloned into pENTR-D-TOPO (Thermo Fisher Scientific, Cat# K240020SP) vector, and then swapped into pBPGUw (to make Gal4 reporter) or pBPGUw-eGFP (to make GFP reporter) destination vector161. Germline transformation was performed in BestGene Inc to insert the tap1.3-A-Gal4 at attP2 site, tap1.3-B-Gal4 at attP40 and attP2 site and NPF-0.7-GFP at attP40 site. All the constructs were verified by sequencing.
Primer sequences:
tap1.3-A_F: CACCTAAATTAGCCCCCTCGACAC
tap1.3-A_R: AGATTCAATTACCATCAACTC
tap1.3-B_F: CACCACGAGCTTTGATGATGCCG
tap1.3-B_R: CGTCTCGCGTGCCCGCAC
NPF-0.7_F: CACCAGCGTTAATTAGTCAGAACGC
NPF-0.7_R: TGGGTGGGCGGTATGGAAATG
NPFR3XHA
NPFR3XHA was constructed using a CRISPR/Cas9 mediated homologous recombination method. Cas9 targeting site (GACTACCCTGTGCTTTAccg) was selected near the stop codon of NPFR to induce double strand breaks (DSBs).
To obtain guide RNA vector (NPFR-gRNA), one pair of primers with targeting site was synthesized: NPFR-gRNA-F: gtcgGACTACCCTGTGCTTTACCG
NPFR-gRNA-R: aaacCGGTAAAGCACAGGGTAGTC
After annealing, guide RNA was subcloned into single guide RNA (sgRNA) vector (modified PMD18T, a kind gift from Haiyang Chen’s lab), which was digested using BbsI (NEB, Cat# R3535S), by T4 DNA Ligase (NEB, Cat# M0202S). To assemble the sgRNA into the PCR8 vector, one pair of primers with adaptor sequences:
BsaI-U6-F: ATGCGGTCTCCTGACGCTCACCTGTGATTGCTC
BsaI-SgRNA-R: ATGCGGTCTCGGAGTAAAAAAAGCACCGACTCGGTGC was used to amplify the guide RNA. The PCR product and PCR8 vector was digested using BsaI (NEB, Cat# R0535V). The digestion products were assembled through the T4 DNA Ligase. The sgRNA (PCR8-NPFR-gRNA) was then exchanged to the pUAST-attB vector through attP/attB recombination (Invitrogen Gateway® LR Clonase® Enzyme Mix, Cat# 11791019) to obtain the pUAST-attB-NPFR-gRNA.
To induce homolog based integration and the plasmid cutting by the Cas9 vector, a NPFR-Hom-3XHA plasmid carrying a 3XHA at the C-terminal of NPFR with two flanked homolog arms ( ~ 0.9 k and ~1.7 k respectively) was constructed as follows: the homolog arms were amplified (TOYOBO, Cat# KOD-211) from the fly genome
(primer pairs sequences:
NPFR-5′_F:GTGATCGTGTACCCCACGC NPFR-5′_R:CCGCGGCATCAGCTTGGT
NPFR-3′_F:AGCACAGGGTAGTCCTAAGG NPFR-3′_R:AAGTTAAGTGTTCGGCGGGT)and sub-cloned into pEASY-Blunt (TransGen Biotech, Cat# CB111-01). Then, three pairs of primers with a linker sequence were used to amplify
the N terminal homolog arm:
NPFR-5′-1_F:gccagtgccaagcttgcatgcGTGATCGTGTACCCCACGCG
NPFR-5′-1_R:aggaacatcgtatgggtaCCGCGGCATCAGCTTGGT
3XHA tag:
HA-5′_F:ggTACCCATACGATGTTCCTGACTATG
HA-5′_R:taggactaccctgtgctTCACGTGGACCGGTGTCCG and the C terminal homolog arm:
NPFR-3′-1_F:tgaAGCACAGGGTAGTCCTAAGGTCC
NPFR-3′-1_R:tacgaattcgagctcggtaccAAGTTAAGTGTTCGGCGGGTC.
The three segments were assembled into the NPFR-Homo plasmid by replacing the sequences between SphI (NEB, Cat# R3182V) and KpnI (NEB, Cat# R3142S) sites on modified PMD18T plasmid using the multi-site clone Kit (Vazyme, Cat# C113-02). All the constructs were verified by sequencing.
The pUAST-attB-NPFR-gRNA was integrated into the 51D site by microinjection (performed by Unihuaii. Ltd) to obtain the NPFR-gRNA transgenic fly. The NPFR-gRNA transgenic fly was crossed with yw; nos-Cas9 (II-attP40) to induce DSBs. The F1 embryos with DSBs were injected with NPFR-Hom-3XHA plasmid. After eclosion, they were single crossed with yw122; If/CyO; MKRS/TM6B flies of the opposite sex. The F2 male flies were single crossed with yw122; If/CyO; MKRS/TM6B, and the recombination events were verified with PCR (NPFR-seq-F: GCCGCGGTACCCATACGATG, NPFR-seq-R: CGAGCTCTTAGTCGCGTGTG, 997 bp) and immunostaining of HA. The efficiency of the recombination was about 6.5% (3/46).
Generation of NPF antibody
Rabbit anti-NPF serum was generated by Eurogentec. Antigen was a synthetic peptide GEFARGFNEEEIF, which corresponds to the C-terminus of the NPF precursor. We thank Jan Veenstra for sharing the antigen.
Immunostaining and fluorescent microscopy
Flies were anesthetized by CO2. Then the intestines and brains of mated female flies were dissected in 1 × PBS (Solarbio, Cat# P1010) solution. The samples were fixed in 4% formaldehyde (Sigma, Cat# F8775) for 3 h for intestines or 30 min for brains at room temperature, washed three times for 20 min by 0.3% PBT (1 × PBS solution containing 0.3% Triton X-100 (Sangon Biotech, Cat# A110694-0500). Intestines and brains were incubated with primary antibodies for 3 h at room temperature, washed three times for 20 min by 0.3% PBT. Then samples were incubated in secondary antibodies for 3 h at room temperature, washed three times for 20 min by 0.3% PBT. Lastly, samples were incubated with 100 µL DAPI (1 µg/mL, Sigma, Cat# D9542) for 5 min, washed three times for three times by 0.3% PBT and mounted in 70% glycerol (Sinopharm Chemical Reagent, Cat# 10010618). Images were taken with Carl Zeiss LSM 800 confocal microscopy and then processed by Adobe Photoshop and Adobe Illustrator. The following primary antibodies were used in this paper: chicken anti-GFP (1:10,000, Abcam, Cat# AB13970), rabbit anti-RFP (1:10000, Abcam, Cat#62341), mouse anti-Pros (1:200, Developmental Studies Hybridoma Bank, Cat# 528440), mouse anti-NC82 (1:100, Developmental Studies Hybridoma Bank, Cat# 2314866), rabbit anti-LacZ (1:4000, CUSABIO, Cat# CSB-PA009476LA01ENV), rabbit anti-PH3 (1:10000, Millipore, Cat# MMI-06-570), mouse anti-NPF (1:200, a kind gift from Veenstra, J. A.)56, rabbit anti-NPF (1:4000, this paper), rabbit anti-Tk (1:4000, a kind gift from Benjamin Ohlstein)162, rabbit anti-HA (1:4000, Cell Signaling Technology, Cat# 3724S), rabbit anti-NPFR (1:2000, RayBiotech, Cat# RB-19-0003-200), rabbit anti-AKH (1:10000, a kind gift from Wei Song)163, rabbit anti-TH (1:4000, Abcam, Cat# AB112). The following secondary antibodies were used: Alexa Flour goat anti-chicken 488 (1:4000, Invitrogen, Cat# A11039), Alexa Flour goat anti-rabbit 488 (1:4000, Invitrogen, Cat# A11008), Alexa Flour goat anti-rabbit 555 (1:4000, Invitrogen, Cat# A21428), Alexa Flour goat anti-mouse 555 (1:4000, Invitrogen, Cat# A21422), Alexa Flour goat anti-mouse 647 (1:4000, Invitrogen, Cat# A21235).
For NPF intensity and pANF-EMD intensity measurement, guts from mated female flies were dissected, fixed, stained in the same setting. Fresh primary antibodies were used each time. Images were taken with Carl Zeiss LSM 800 confocal microscope using the same setting. The average protein intensity of single cell was calculated by ImageJ.
For relative CaLexA intensity measurement, 13XLexAop-myr:GFP, UAS-mCD8:RFP;; 10XUAS-CaLexA/NPFRENS-Gal4 mated female flies were used in this experiment. Brains and gut were dissected together and put on ice. Samples were fixed, stained in the same setting. Fresh primary antibodies were used each time. Images were taken with Carl Zeiss LSM 800 confocal microscopy in the same setting. The total GFP and RFP intensity of single cell body was calculated by ImageJ. Measuring the total GFP and RFP intensity in the same area next to the cell body as blank intensity. Relative CaLexA intensity = (total GFP intensity - blank GFP intensity) / (total RFP intensity - blank RFP intensity).
Food intake measurement
The Capillary Feeder (CAFE) assay72, Manual Feeding (MAFE) assay88 and dye-based food intake measurement were used to measure the food intake of 3-5 d mated female flies in this paper.
For the CAFE assay, flies of the indicated ages were fasted for 3 h by placing them in vials containing only water. Five flies were collected as a group and transferred to a vial containing ddH2O at the bottom and a capillary tube (World Precision Instruments, Cat# 1B100F-4) inserted through a 10 μl pipette tip. The capillary contained 10 μl of 5% sucrose (Sinopharm Chemical Reagent, Cat# 10021418) with 0.25% (v/v) blue dye solution (AmeriColor, Cat# 102) (unless otherwise stated) and Halocarbon oil 700 (Sigma, Cat# H8898) at the top. To account for evaporation, we placed 2 vials with capillary tubes containing 10 μL of 5% sucrose with 0.25% (v/v) blue dye without flies as a negative control. The liquid level in each capillary tube was marked at the start of the assay. Flies were allowed to feed for 24 h, after which we marked the level of fluid in each capillary. Total food consumption was calculated as the difference in fluid levels in the capillaries, corrected for the average evaporation that occurred in the negative control vials.
For the MAFE assay, flies of the indicated ages were fasted for 36 h by placing them in vials containing only water. Flies were then individually fixed in a 200 µl pipette tip and blocked with cotton. The proboscis was exposed. Flies were then presented with 5 μl of 5% sucrose containing 0.25% (v/v) blue dye liquid food in a glass capillary until they stopped responding to food stimuli for ten serial food stimuli. Food consumption was calculated on the basis of the volume change before vs. after feeding and the time of feeding.
For the dye-based food intake measurement38,164, 20 flies of the indicated genotypes were collected as a group. 10% sucrose, 25% coconut oil (v/v) or 10% yeast were added to standard cornmeal diet to produce a high-sugar, high-fat or high-protein diet, respectively. In order to measure the food intake of the flies under physiological conditions and to reduce the effect of defecation on the measurements, fasting was omitted in these experiments. Flies were transferred to new vials with food containing 0.5% erioglaucine disodium salt (Sigma, Cat# 861146) for 24 h to allow flies to consume blue food. To avoid food and fly tissue interference, 20 flies of the same genotype and age were placed on food without erioglaucine disodium salt as a negative control. Flies were collected in 1.5 ml tubes and processed at −20 °C for 2 h. Flies were snap frozen in liquid nitrogen for 1 min and then were shaken vigorously to remove the heads, legs and wings of flies. The remaining parts of the flies were collected in new tubes. 600 μL of PBS solution was added to the tubes, homogenized and centrifuged (15900 × g, 30 min). 100 μL supernatants were added to a 96-well plate and the absorbance was measured at 620 nm. Three measurements were made for each sample. Absorbance was calculated as (mean absorbance of flies feeding on blue food) - (mean absorbance of negative control flies).
Defecation and gut-clearance assay
We performed the defecation and gut-clearance assay according to the previously described method with slight modifications61. For the defecation assay, we first fed the mated female flies by placing them in vials containing 5% sucrose/blue dye for 24 h. We then divided 5 flies in each group into new vials. Two capillaries containing 10 μl of 5% sucrose with 0.25% (v/v) blue dye solution with Halocarbon oil 700 at the top were inserted into the vials using 10 μl pipette tips. The filter papers were placed on the top and the wall of each vial. The blue deposits on the filter paper of each vial were counted after 24 h.
For gut clearance assays, mated female flies were first fed 5% sucrose containing 0.25% (v/v) blue dye for 48 h, and ten flies with blue abdomen were transferred to a new vial containing 5% sucrose only. After 24 h, flies were counted according to whether they still had a blue abdomen or not.
Measurement of the mass and metabolite content
To measure the mass of flies, 10 mated female flies at indicated ages were anesthetized by CO2 and collected in a tube. Measuring the mass of flies and the tube by precision balance (Sartorius, Cat# BSA223S). The mass of single fly was calculated as (the mass of flies and the tube - the mass of the tube) /10.
To measure the glucose content of flies, 5 mated female flies were weighed and then homogenized in 1 ml 70 °C ddH2O. Glucose (Go) assay kit (Sigma, Cat# GAGO20) was used to measure the glucose of supernatant. The absorbances at 540 nm were recorded after reaction.
BCA protein quantification kit (Thermo Fisher, Cat# 23225) was used to measure the protein content of flies. Before measuring, 20 mated female flies were collected in a tube, weighed and then homogenized in 1 ml PBS solution. Heat-inactivate at 95 °C for 5 min. The absorbances at 562 nm were recorded after reaction.
To measure the content of TAG, 10 mated female flies were collected on ice in screw-cap tubes and weighed. Add 250 ul 1xPBS containing 0.1% Tween-20 (Sigma, Cat# P1379) into the tube and homogenize for 30 s. Heat-inactivate (HI) at 70 °C for 5–10 min. Centrifuge for 3-5 min and transfer 150 ul supernatant to new tubes. Distribute 20 ul HI homogenate and add 20 ul PBS (control) or Triglyceride Reagent (Sigma, Cat# T2449) to 96-well plate. Gently tap plate to mix and centrifuge at maximum speed for 3 min. Incubate for 30 min at 37 °C. Add 40 ul/well standards (free glycerol, Sigma, Cat# G7793) to plate plus blank background, 140 ul H2O with no reagents. Add 100 ul Free Glycerol Reagent (Sigma, Cat# F6428) to samples and standards. Incubate for 5–10 min at 37 °C. The absorbances at 540 nm were recorded after reaction. TAG = free glycerol (Triglyceride reagent-treated) - free glycerol (PBS-treated).
For Oil Red O staining, midguts from mated female flies were dissected in cold 1xPBS, then fixed in 4% formaldehyde for 20 min. After fixation, specimens were rinsed three times with distilled water and incubated for 25 min in Oil Red O (Sigma, Cat# O0625) solution (mix of 6 ml isopropanol with 0.1% Oil Red O and 4 ml distilled water, prepared fresh and filtrated to remove the precipitation).
Rearing in germ-free conditions
Germ-free flies were generated as previously described165 with slight modifications. esg-Gal4, tub-Gal80ts, UAS-GFP virgins were allowed to mate with control (UAS-attp empty) or UAS-scuteRNAi males and lay eggs on 1% agar plate covered with diluted yeast paste at 18 oC for no more than 8 h. Embryos of the indicated genotype were collected from the agar plate and washed three times with 1 ml 3.3% Walch (1 ml Walch + 30 ml sterile water). The embryos were then washed once with 1 ml 70% absolute ethanol (Sinopharm Chemical Reagent, Cat# 10009218) and 1 ml 2.7% sodium hypochlorite solution (Macklin, Cat# S817439). Finally, embryos were washed three times with sterile 0.3% PBST and transferred to sterile standard cornmeal feed at 18 oC. The development of flies in germ-free condition is slower than that of flies in conventionally fed condition, so at 90 h APF, esgts>scuteRNAi pupae were transferred to 30 °C for 10 h to block the formation of EECs and then returned to 18 °C until eclosion. Food intake of 5 d AE conventionally fed and germ-free flies was measured by both the CAFE assay and the dye-based food intake measurement. For the CAFE assay, germ-free flies were collected in a sterile environment and then fasted for 3 h by placing them in sterile vials containing only sterile water. The vials, ddH2O, capillary tubes, 10 μl pipette tips and 5% sucrose with 0.25% (v/v) blue dye used in the CAFE assay were sterilized using a vertical autoclave (Zealway, Cat# GI80TW). The CAFE assay was performed in a sterile environment. For the dye-based food intake assay, germ-free flies were collected in a sterile environment and then transferred to new sterile vials with sterile food containing 0.5% erioglaucine disodium salt (Sigma, Cat# 861146) for 24 h to allow the flies to consume blue food. Experiments were conducted in a sterile environment.
Eliminating EECs during pupal development
EECs from adult flies were generated in the pupal stage by pupal ISCs after 44 h APF (after pupal formation) at 25 °C47. Therefore, we performed a genetic approach to inhibit the production of EECs during the pupal stage. esgts>scuteRNAi flies were reared at 18 °C. 80 h after pupal formation (APF), esgts>scuteRNAi pupae were transferred to 30 °C for 10 h, and then were returned to 18 °C. Flies blocked in EEC formation during the pupal stage were designated as esgP>scuteRNAi flies. The midguts of esgP>scuteRNAi flies were dissected at 3d, 7d and 10d AE.
Fabrication of the Temperature Control Device
The Temperature Control Device (TCD) was composed of five parts: (1) the removable fly-placing pad, (2) the heating element, (3) the temperature sensor and control circuit, (4) computer and the temperature control software, and (5) a fanner to decrease the temperature of the head.
(1) The removable fly-placing pad consisted of three parts: (a) a glass slide (7.5 cm × 2.5 cm × 0.1 cm, Citoglas, China), (b) a copper metallized polyester film (8.0 cm × 2.0 cm) that was sticked on the longer side of the glass slide and (c) an adiabatic Polydimethylsiloxane (PDMS) layer (7.3 cm × 2.6 cm × 0.5 cm) to reduce heat loss. To fix the neck of flies, we made eleven rectangular-shaped gaps (0.02 cm × 0.1 cm) by a UV laser marker (HGL-LSU3/5EI, Huagong Laser, Wuhan, China) on the copper metallized polyester film. To immobilize flies, we made eleven trapezoidal holes (0.25 cm × 0.35 cm × 0.4 cm × 0.35 cm) on the PDMS layer relative to each gap on the copper metallized polyester film.
(2) The heating element was an aluminum alloy resistance wire (12 Ω) sealed inside a polyimide film (10 cm × 4.5 cm × 0.02 cm, QINGBANG) connected with the control circuit.
(3) The temperature sensor was an analog temperature sensor (LM35D, ZHONGBEST). After fixing in PDMS (5.5 cm × 2.0 cm × 0.85 cm) cuboid, this cuboid was loaded on a glass slide (7.5 cm × 2.0 × 0.1 cm) and sticked on the heating element.
(4) An application was developed in LabVIEW to provide a readable user interface for temperature monitoring. A PC with Windows 10 operating system was used in this experiment. The information for control circuit and temperature control application had been uploaded to figshare (https://figshare.com/articles/software/Drosophila_local_temperature_control_device/13451204).
Eliminating EECs in adult midgut by TCD
UAS-hid, prosv1-Gal4, tub-Gal80ts, UAS-GFP (prosts > GFP+hid) mated female flies were reared at 18 °C. 5 days AE, prosts > GFP+hid females were used to eliminate EECs. The TCD was placed in a cold room at 18 °C. After fixing the flies in the fly-placing pad, an adiabatic PDMS layer was placed over the flies. The flies and fly-placing pad were placed on the heating element for 12 h, after which the flies were transferred to new vials at 18 °C with standard fly food for further experiments. The temperature setting in the application was 30 °C. The heads of the flies were outside the heating region, so the TCD only kept the abdomens of the flies at 30 °C. We named the flies in which adult EEC elimination was processed in the TCD prosTCD > GFP+hid flies.
Gut microbiota sequencing
20 midguts of mated female flies of the indicated genotypes and ages were dissected in 1x PBS solution, and DNA was extracted using TIANamp Genomic DNA Kit (TIANGEN Biotech, Cat# DP304-02). 16 s rRNA sequencing and analysis was performed by Majorbio. The number of sequences obtained from all 6 samples was 359,363. The number of bases was 137,171,954 bp. The average length of the sequences was 381.708617748 bp. The species taxonomy was determined using operational taxonomic units (OTU). The species differences between the gut microbiota in esgP>attp empty 3d AE and esgP>scuteRNAi 3d AE flies were performed using the Wilcoxon rank sum test method at the phylum level based on OTU. The results were plotted as a histogram. The gut-microbiota sequencing data generated in this study have been deposited in the Figshare [10.6084/m9.figshare.25458226.v1].
NPF feeding and injection
C-terminal amidated NPF peptide (SNSRPPRKNDVNTMADAYKFLQDLDTYYGDRARVRF-NH2) was synthesized by DgPeptides co., ltd. The synthetic NPF peptide was diluted to 10 μM in 1xPBS and stored at −80 °C. 100 nM NPF peptide solution was loaded from the capillaries into micropipettes produced by Micropipette Pullers (Sutter instrument, Cat# P-1000) and then injected into the thoraces between the first and second legs of female flies cooled on ice using a pneumatic PicoPump (World Precision Instruments, Cat# SYS-PV820). A Zeiss Stemi 508 stereomicroscope with M stand was used to visualize the micropipettes and the thoraces of the flies. Approximately 40nL NPF solution was injected into a fly. Injected flies were transferred to vials containing standard fly food for further experiments.
Yeast extract, yeast paste feeding and single amino acid screen
3 days AE mated female flies reared at 25 °C were used for those feeding experiments. Oxoid™ Yeast Extract Powder (Cat# LP0021T) was purchased from Thermo Scientific. For yeast extract feeding experiments, flies were fed a 5% sucrose solution containing 5% yeast extract for 48 h. Yeast paste was a mixture of distilled water and yeast in a 1:1 weight ratio. For yeast paste feeding experiments, flies were fed yeast paste for 48 h. L-alanine (Cat# A7627), L-argine (Cat# A5131), L-asparagine (Cat# A0884), L-aspartate (Cat# A8949), L-cysteine (Cat# C1276), L-glutamate (Cat# G1251), L-glutamine (Cat# G3126), L-glycine (Cat# G7126), L-histidine (Cat# H8000), L-isoleucine (Cat# I2752), L-leucine (Cat# L8912), L-methionine (Cat# M9625), L-phenylalanine (Cat# P2126), L-proline (Cat# P0380), L-serine (Cat# S4500), L-threonine (Cat# T8625), L-tryptophan (Cat# T0254), L-tyrosine (Cat# T3754), L-valine (Cat# V0500), L-lysine (Cat# L5626) were purchased from Sigma-Aldrich. For single amino acid screening experiments, 5% sucrose solution containing 1% single amino acid was used to feed flies for 48 h.
RT-qPCR
Total RNA was extracted from dissected midguts (50 guts per sample) or brains (150 brains per sample) using RNAprep Pure Tissue Kit (TIANGEN Biotech, Cat# DP431). cDNA was synthesized using GoScript™ Reverse Transcription kit (Promega, Cat# A2790). 0.5 mg total RNA was used for reverse transcription, and the cDNA was diluted 10 times with water and further used in real time PCR. Real time quantitative PCR was performed in at least triplicate for each sample using GoTaq® qPCR System (Promega, Cat# A6001). Expression values were calculated using the ΔΔCt method and relative expression was normalized to RpL23. The expression in control sample was further normalized to 1.
Primer sequences are indicated in Supplementary Table 2.
Calcium imaging
Calcium live imaging was performed as previously described76,166. For calcium imaging, UAS-GCaMP6f, UAS-tdTomato was expressed under the control of tap1.3-B-Gal4. Mated female flies were used in all the experiments.
Prepare live imaging buffer (LIB)
8 ml Schneider medium (Thermo Fisher, Cat# 21720001) was supplemented with 2 ml fetal bovine serum (Thermo Fisher, Cat# 10091148) and 50 μl insulin solution (Biosharp, Cat# BS901-25mg, dissolved in Hcl, 40 µg/μl). pH was adjusted to 7.0.
Prepare live imaging gel (LIG)
0.5 g of gelatin (Sigma-Aldrich, Cat# G2500) was added to 5 mL of LIB and then heated at 50 oC to melt the gel. Both LIB and LIG were divided into 500 mL aliquots and stored at 4 oC for up to 1 week. Aliquots of LIG were heated to 37 oC prior to experiments.
Prepare midguts for live imaging
Two pieces of cover glass with a size of 10 × 22 mm were attached to a lumox® dish 50 (Sarstedt, Cat# 15090935) using LIG, with a gap of ~1 cm between them. Intact guts were dissected in LIB and transferred to a 22 × 22 mm cover glass. Excess LIB was carefully removed with filter paper. A volume of 80 µl LIG at 37 °C was dropped into the 1 cm gap, then the 22 × 22 mm cover glass was quickly placed on the top of the 10 × 22 mm cover glasses to cover the guts with LIG without air bubbles. After the LIG was cooled down and stabilized, the cover glasses were finally sealed with Halocarbon oil 27 (Sigma-Aldrich, Cat# H8773) to prevent evaporation.
Setting up time-lapse experiments on confocal microscopy
GCaMP6f calcium signals and tdTomato signals were captured using a Zeiss LSM 800 confocal microscope. Zeiss Definite Focus 2 was used to avoid focus drift. Time lapse images were acquired using ZEN 2.1 with Time Lapse Module. A single-layer image of 512 × 512 pixels (319.45 µm × 319.45 µm) was acquired every second for 10 min at room temperature (25 °C) with a pixel time of 1.03 µs and fixed laser power, pinhole and other settings for all time-lapse experiments. GCaMP6f emission was recorded at 400-533 nm and tdTomato emission was recorded at 579–700 nm. GCaMP6f and tdTomato fluorescence quantification of each cell was performed manually using ImageJ for each frame. Oscillation frequency was determined by counting individual peaks of the GcaMP6f/tdTomato fluorescence emission ratio observed during 10 min recordings. Heat maps were generated using Matlab. Videos were exported uncompressed from ZEN 2. Genotypes, feeding conditions, scale bars and relative time were added in ZEN 2.
Statistics
Statistical significance was determined using the two-sided unpaired t-test in GraphPad Prism 8 (GraphPad software) and expressed as P values. All statistics results are presented as mean ± SD. Results of mRNA expression obtained by qPCR are presented as mean ± SD of at least 3 independent biological samples. All statistics graphs were generated using GraphPad Prism 8. No sample size estimation or inclusion/exclusion of data or subjects was performed in this study.
Reporting summary
Further information on research design is available in the Nature Portfolio Reporting Summary linked to this article.
Supplementary information
Description of Additional Supplementary Files
Source data
Acknowledgements
We thank B. Ohlstein, G. Struhl, W. Song, X. Huang, F. Guo, YF. Pan, ZH. Liu, LL. Zhang, BDSC, VDRC, DGRC, and Tsinghua Fly Center for fly strains; YM. Lu, W. Song and DSHB for antibodies. HY. Chen, ZH. Wang and JQ. Ni for plasmids. B. Ohlstein, ZH. Liu, LY. Zhang, YF. Pan, QP. Wang, F. Guo, ZF. Gong, Y. Chen and YM. Lu for critical comments and insightful suggestions. This work was supported by grants from the National Natural Science Foundation of China to Z.G. (31970817, 31771625, 32271074) and to ZZ.Z. (31871469, 32170509).
Author contributions
JJ.G., ZZ.Z. and Z.G. conceptualized, designed experiments. JJ.G. performed genetics, screens, immunohistochemistry, measurement of metabolic indexes, feeding assay, calcium imaging, statistical analyses and figure design. S.Z. identified the conditions to eliminate EECs during the pupal stage. JJ.G., P.D., ZG.W. and Z.G. designed the temperature control device. B.L. and ZZ. Z. designed and identified the EEC specific driver. ZZ.Z and Z.G. supplied resource and funding. ZZ.Z. and Z.G. supervised the project. JJ.G., ZZ.Z. and Z.G. wrote the manuscript.
Peer review
Peer review information
Nature Communications thanks the anonymous reviewers for their contribution to the peer review of this work. A peer review file is available.
Data availability
All data generated or analyzed during this study are available as a Source data file. Source data are provided with this paper. The gut-microbiota sequencing data generated in this study have been deposited in the Figshare database without accession code [10.6084/m9.figshare.25458226.v1]. Additional data are available upon request to Dr. Zheng Guo (guozheng@hust.edu.cn). Source data are provided with this paper.
Competing interests
The authors declare no competing interests.
Footnotes
Publisher’s note Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Contributor Information
Zongzhao Zhai, Email: zongzhao.zhai@foxmail.com.
Zheng Guo, Email: guozheng@hust.edu.cn.
Supplementary information
The online version contains supplementary material available at 10.1038/s41467-024-47465-4.
References
- 1.Soultoukis GA, Partridge L. Dietary protein, metabolism, and aging. Annu. Rev. Biochem. 2016;85:5–34. doi: 10.1146/annurev-biochem-060815-014422. [DOI] [PubMed] [Google Scholar]
- 2.Muller O, Krawinkel M. Malnutrition and health in developing countries. CMAJ. 2005;173:279–286. doi: 10.1503/cmaj.050342. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Broer S, Broer A. Amino acid homeostasis and signalling in mammalian cells and organisms. Biochem. J. 2017;474:1935–1963. doi: 10.1042/BCJ20160822. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Kanarek N, Petrova B, Sabatini DM. Dietary modifications for enhanced cancer therapy. Nature. 2020;579:507–517. doi: 10.1038/s41586-020-2124-0. [DOI] [PubMed] [Google Scholar]
- 5.Nelson G, et al. An amino-acid taste receptor. Nature. 2002;416:199–202. doi: 10.1038/nature726. [DOI] [PubMed] [Google Scholar]
- 6.Liu GY, Sabatini DM. mTOR at the nexus of nutrition, growth, ageing and disease. Nat. Rev. Mol. Cell Biol. 2020;21:183–203. doi: 10.1038/s41580-019-0199-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7.Gallinetti J, Harputlugil E, Mitchell JR. Amino acid sensing in dietary-restriction-mediated longevity: roles of signal-transducing kinases GCN2 and TOR. Biochem. J. 2013;449:1–10. doi: 10.1042/BJ20121098. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Miguel-Aliaga I. Nerveless and gutsy: intestinal nutrient sensing from invertebrates to humans. Semin. cell Dev. Biol. 2012;23:614–620. doi: 10.1016/j.semcdb.2012.01.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Gribble FM, Reimann F. Function and mechanisms of enteroendocrine cells and gut hormones in metabolism. Nat. Rev. Endocrinol. 2019;15:226–237. doi: 10.1038/s41574-019-0168-8. [DOI] [PubMed] [Google Scholar]
- 10.Duca FA, Waise TMZ, Peppler WT, Lam TKT. The metabolic impact of small intestinal nutrient sensing. Nat. Commun. 2021;12:903. doi: 10.1038/s41467-021-21235-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Burman, A. & Kaji, I. Luminal chemosensory cells in the small intestine. Nutrients13, 3712 (2021). [DOI] [PMC free article] [PubMed]
- 12.Moran AW, Daly K, Al-Rammahi MA, Shirazi-Beechey SP. Nutrient sensing of gut luminal environment. Proc. Nutr. Soc. 2021;80:29–36. doi: 10.1017/S0029665120007120. [DOI] [PubMed] [Google Scholar]
- 13.Blanco, A. M., Calo, J. & Soengas, J. L. The gut-brain axis in vertebrates: implications for food intake regulation. J. Exp. Biol.224, jeb231571 (2021). [DOI] [PubMed]
- 14.Latorre R, Sternini C, De Giorgio R, Greenwood-Van Meerveld B. Enteroendocrine cells: a review of their role in brain-gut communication. Neurogastroenterol. Motil.: Off. J. Eur. Gastrointest. Motil. Soc. 2016;28:620–630. doi: 10.1111/nmo.12754. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Begg DP, Woods SC. The endocrinology of food intake. Nat. Rev. Endocrinol. 2013;9:584–597. doi: 10.1038/nrendo.2013.136. [DOI] [PubMed] [Google Scholar]
- 16.Augustine V, Gokce SK, Oka Y. Peripheral and central nutrient sensing underlying appetite regulation. Trends Neurosci. 2018;41:526–539. doi: 10.1016/j.tins.2018.05.003. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Batterham RL, et al. Critical role for peptide YY in protein-mediated satiation and body-weight regulation. Cell Metab. 2006;4:223–233. doi: 10.1016/j.cmet.2006.08.001. [DOI] [PubMed] [Google Scholar]
- 18.Batterham RL, et al. Gut hormone PYY3-36 physiologically inhibits food intake. Nature. 2002;418:650–654. doi: 10.1038/nature00887. [DOI] [PubMed] [Google Scholar]
- 19.Koda S, et al. The role of the vagal nerve in peripheral PYY3-36-induced feeding reduction in rats. Endocrinology. 2005;146:2369–2375. doi: 10.1210/en.2004-1266. [DOI] [PubMed] [Google Scholar]
- 20.Spencer NJ, Hu H. Enteric nervous system: sensory transduction, neural circuits and gastrointestinal motility. Nat. Rev. Gastroenterol. Hepatol. 2020;17:338–351. doi: 10.1038/s41575-020-0271-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Kaelberer MM, Rupprecht LE, Liu WW, Weng P, Bohorquez DV. Neuropod cells: the emerging biology of gut-brain sensory transduction. Annu. Rev. Neurosci. 2020;43:337–353. doi: 10.1146/annurev-neuro-091619-022657. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22.Wang H, Murthy KS, Grider JR. Expression patterns of L-amino acid receptors in the murine STC-1 enteroendocrine cell line. Cell tissue Res. 2019;378:471–483. doi: 10.1007/s00441-019-03074-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23.Kim SK, Tsao DD, Suh GSB, Miguel-Aliaga I. Discovering signaling mechanisms governing metabolism and metabolic diseases with Drosophila. Cell Metab. 2021;33:1279–1292. doi: 10.1016/j.cmet.2021.05.018. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Piper MD, et al. A holidic medium for Drosophila melanogaster. Nat. methods. 2014;11:100–105. doi: 10.1038/nmeth.2731. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Piper MDW, et al. Matching dietary amino acid balance to the in silico-translated exome optimizes growth and reproduction without cost to lifespan. Cell Metab. 2017;25:610–621. doi: 10.1016/j.cmet.2017.02.005. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26.Toshima N, Schleyer M. Neuronal processing of amino acids in Drosophila: from taste sensing to behavioural regulation. Curr. Opin. insect Sci. 2019;36:39–44. doi: 10.1016/j.cois.2019.07.007. [DOI] [PubMed] [Google Scholar]
- 27.Park J, Carlson JR. Physiological responses of the Drosophila labellum to amino acids. J. Neurogenet. 2018;32:27–36. doi: 10.1080/01677063.2017.1406934. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Aryal, B., Dhakal, S., Shrestha, B. & Lee, Y. Molecular and neuronal mechanisms for amino acid taste perception in the Drosophila labellum. Curr. Biol.32, 1376–1386 (2022). [DOI] [PubMed]
- 29.Ganguly A, et al. A molecular and cellular context-dependent role for Ir76b in detection of amino acid taste. Cell Rep. 2017;18:737–750. doi: 10.1016/j.celrep.2016.12.071. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Croset V, Schleyer M, Arguello JR, Gerber B, Benton R. A molecular and neuronal basis for amino acid sensing in the Drosophila larva. Sci. Rep. 2016;6:34871. doi: 10.1038/srep34871. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.Steck, K. et al. Internal amino acid state modulates yeast taste neurons to support protein homeostasis in Drosophila. eLife7, e31625 (2018). [DOI] [PMC free article] [PubMed]
- 32.Wolfson RL, Sabatini DM. The dawn of the age of amino acid sensors for the mTORC1 pathway. Cell Metab. 2017;26:301–309. doi: 10.1016/j.cmet.2017.07.001. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Kim B, et al. Response of the microbiome-gut-brain axis in Drosophila to amino acid deficit. Nature. 2021;593:570–574. doi: 10.1038/s41586-021-03522-2. [DOI] [PubMed] [Google Scholar]
- 34.Bjordal M, Arquier N, Kniazeff J, Pin JP, Leopold P. Sensing of amino acids in a dopaminergic circuitry promotes rejection of an incomplete diet in Drosophila. Cell. 2014;156:510–521. doi: 10.1016/j.cell.2013.12.024. [DOI] [PubMed] [Google Scholar]
- 35.Gu X, et al. Sestrin mediates detection of and adaptation to low-leucine diets in Drosophila. Nature. 2022;608:209–216. doi: 10.1038/s41586-022-04960-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 36.Colombani J, et al. A nutrient sensor mechanism controls Drosophila growth. Cell. 2003;114:739–749. doi: 10.1016/S0092-8674(03)00713-X. [DOI] [PubMed] [Google Scholar]
- 37.Sousa-Nunes R, Yee LL, Gould AP. Fat cells reactivate quiescent neuroblasts via TOR and glial insulin relays in Drosophila. Nature. 2011;471:508–512. doi: 10.1038/nature09867. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38.Sun J, et al. Drosophila FIT is a protein-specific satiety hormone essential for feeding control. Nat. Commun. 2017;8:14161. doi: 10.1038/ncomms14161. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.Zhang Y, et al. Amelioration of hepatic steatosis by dietary essential amino acid-induced ubiquitination. Mol. cell. 2022;82:1528–1542.e1510. doi: 10.1016/j.molcel.2022.01.021. [DOI] [PubMed] [Google Scholar]
- 40.Kosakamoto H, et al. Sensing of the non-essential amino acid tyrosine governs the response to protein restriction in Drosophila. Nat. Metab. 2022;4:944–959. doi: 10.1038/s42255-022-00608-7. [DOI] [PubMed] [Google Scholar]
- 41.Lu J, et al. Sestrin is a key regulator of stem cell function and lifespan in response to dietary amino acids. Nat. Aging. 2020;1:60–72. doi: 10.1038/s43587-020-00001-7. [DOI] [PubMed] [Google Scholar]
- 42.Yang Z, et al. A post-ingestive amino acid sensor promotes food consumption in Drosophila. Cell Res. 2018;28:1013–1025. doi: 10.1038/s41422-018-0084-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Jeong-Ho Park, J. Y. K. Heterogeneous expression of drosophila gustatory receptors in enteroendocrine cells. PLoS ONE6, e29022 (2011). [DOI] [PMC free article] [PubMed]
- 44.Lin HH, et al. A nutrient-specific gut hormone arbitrates between courtship and feeding. Nature. 2022;602:632–638. doi: 10.1038/s41586-022-04408-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Park JH, et al. A subset of enteroendocrine cells is activated by amino acids in the Drosophila midgut. FEBS Lett. 2016;590:493–500. doi: 10.1002/1873-3468.12073. [DOI] [PubMed] [Google Scholar]
- 46.Hartenstein V, Takashima S, Hartenstein P, Asanad S, Asanad K. bHLH proneural genes as cell fate determinants of entero-endocrine cells, an evolutionarily conserved lineage sharing a common root with sensory neurons. Dev. Biol. 2017;431:36–47. doi: 10.1016/j.ydbio.2017.07.013. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 47.Guo, Z. & Ohlstein, B. Stem cell regulation. Bidirectional Notch signaling regulates Drosophila intestinal stem cell multipotency. Science350, aab0988 (2015). [DOI] [PMC free article] [PubMed]
- 48.Bardin AJ, Perdigoto CN, Southall TD, Brand AH, Schweisguth F. Transcriptional control of stem cell maintenance in the Drosophila intestine. Development. 2010;137:705–714. doi: 10.1242/dev.039404. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 49.Chen J, et al. Transient Scute activation via a self-stimulatory loop directs enteroendocrine cell pair specification from self-renewing intestinal stem cells. Nat. Cell Biol. 2018;20:152–161. doi: 10.1038/s41556-017-0020-0. [DOI] [PubMed] [Google Scholar]
- 50.Guo X, Zhang Y, Huang H, Xi R. A hierarchical transcription factor cascade regulates enteroendocrine cell diversity and plasticity in Drosophila. Nat. Commun. 2022;13:6525. doi: 10.1038/s41467-022-34270-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 51.Jenny M, et al. Neurogenin3 is differentially required for endocrine cell fate specification in the intestinal and gastric epithelium. EMBO J. 2002;21:6338–6347. doi: 10.1093/emboj/cdf649. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 52.Yuan L, et al. The Drosophila neurogenin Tap functionally interacts with the Wnt-PCP pathway to regulate neuronal extension and guidance. Development. 2016;143:2760–2766. doi: 10.1242/dev.134155. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53.Hartenstein V, Takashima S, Adams KL. Conserved genetic pathways controlling the development of the diffuse endocrine system in vertebrates and Drosophila. Gen. Comp. Endocrinol. 2010;166:462–469. doi: 10.1016/j.ygcen.2009.12.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54.Guo X, et al. The cellular diversity and transcription factor code of Drosophila enteroendocrine cells. Cell Rep. 2019;29:4172–4185 e4175. doi: 10.1016/j.celrep.2019.11.048. [DOI] [PubMed] [Google Scholar]
- 55.Hung RJ, et al. A cell atlas of the adult Drosophila midgut. Proc. Natl Acad. Sci. USA. 2020;117:1514–1523. doi: 10.1073/pnas.1916820117. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 56.Veenstra JA, Agricola HJ, Sellami A. Regulatory peptides in fruit fly midgut. Cell tissue Res. 2008;334:499–516. doi: 10.1007/s00441-008-0708-3. [DOI] [PubMed] [Google Scholar]
- 57.Holzer P, Reichmann F, Farzi A. Neuropeptide Y, peptide YY and pancreatic polypeptide in the gut-brain axis. Neuropeptides. 2012;46:261–274. doi: 10.1016/j.npep.2012.08.005. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 58.Holsopple, J. M., Cook, K. R. & Popodi, E. M. Enteroendocrine cell expression of split-GAL4 drivers bearing regulatory sequences associated with panneuronally expressed genes in Drosophila melanogaster. microPublication Biol.202210.17912/micropub.biology.000628 (2022). [DOI] [PMC free article] [PubMed]
- 59.Holsopple, J. M., Cook, K. R. & Popodi, E. M. Identification of novel split-GAL4 drivers for the characterization of enteroendocrine cells in the Drosophila melanogaster midgut. G312, jkac102 (2022). [DOI] [PMC free article] [PubMed]
- 60.Song W, Veenstra JA, Perrimon N. Control of lipid metabolism by tachykinin in Drosophila. Cell Rep. 2014;9:40–47. doi: 10.1016/j.celrep.2014.08.060. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 61.Amcheslavsky A, et al. Enteroendocrine cells support intestinal stem-cell-mediated homeostasis in Drosophila. Cell Rep. 2014;9:32–39. doi: 10.1016/j.celrep.2014.08.052. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 62.Ameku T, et al. Midgut-derived neuropeptide F controls germline stem cell proliferation in a mating-dependent manner. PLoS Biol. 2018;16:e2005004. doi: 10.1371/journal.pbio.2005004. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 63.Hadjieconomou D, et al. Enteric neurons increase maternal food intake during reproduction. Nature. 2020;587:455–459. doi: 10.1038/s41586-020-2866-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 64.Kamareddine L, Robins WP, Berkey CD, Mekalanos JJ, Watnick PI. The Drosophila immune deficiency pathway modulates enteroendocrine function and host metabolism. Cell Metab. 2018;28:449–462.e445. doi: 10.1016/j.cmet.2018.05.026. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 65.Song W, et al. Midgut-derived activin regulates glucagon-like action in the fat body and glycemic control. Cell Metab. 2017;25:386–399. doi: 10.1016/j.cmet.2017.01.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 66.Yoshinari Y, et al. The sugar-responsive enteroendocrine neuropeptide F regulates lipid metabolism through glucagon-like and insulin-like hormones in Drosophila melanogaster. Nat. Commun. 2021;12:4818. doi: 10.1038/s41467-021-25146-w. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 67.Song W, Veenstra JA, Perrimon N. Control of Lipid Metabolism by Tachykinin in Drosophila. Cell Rep. 2020;30:2461. doi: 10.1016/j.celrep.2020.02.011. [DOI] [PubMed] [Google Scholar]
- 68.Kubrak O, et al. The gut hormone Allatostatin C/Somatostatin regulates food intake and metabolic homeostasis under nutrient stress. Nat. Commun. 2022;13:692. doi: 10.1038/s41467-022-28268-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 69.Malita, A. et al. A gut-derived hormone suppresses sugar appetite and regulates food choice in Drosophila. Nature metabolism4, 1532–1550 (2022). [DOI] [PMC free article] [PubMed]
- 70.Lemaitre B, Miguel-Aliaga I. The digestive tract of Drosophila melanogaster. Annu Rev. Genet. 2013;47:377–404. doi: 10.1146/annurev-genet-111212-133343. [DOI] [PubMed] [Google Scholar]
- 71.McGuire SE, Mao Z, Davis RL. Spatiotemporal gene expression targeting with the TARGET and gene-switch systems in Drosophila. Sci. STKE. 2004;2004:pl6. doi: 10.1126/stke.2202004pl6. [DOI] [PubMed] [Google Scholar]
- 72.Ja WW, et al. Prandiology of Drosophila and the CAFE assay. Proc. Natl Acad. Sci. USA. 2007;104:8253–8256. doi: 10.1073/pnas.0702726104. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 73.Shell, B. C. et al. Measurement of solid food intake in via consumption-excretion of a dye tracer. Sci. Rep.8, 11536 (2018). [DOI] [PMC free article] [PubMed]
- 74.Grether ME, Abrams JM, Agapite J, White K, Steller H. The head involution defective gene of Drosophila melanogaster functions in programmed cell death. Genes Dev. 1995;9:1694–1708. doi: 10.1101/gad.9.14.1694. [DOI] [PubMed] [Google Scholar]
- 75.Balakireva M, Stocker RF, Gendre N, Ferveur JF. Voila, a new Drosophila courtship variant that affects the nervous system: behavioral, neural, and genetic characterization. J. Neurosci.: Off. J. Soc. Neurosci. 1998;18:4335–4343. doi: 10.1523/JNEUROSCI.18-11-04335.1998. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 76.Tang R, et al. Intravital imaging strategy FlyVAB reveals the dependence of Drosophila enteroblast differentiation on the local physiology. Commun. Biol. 2021;4:1223. doi: 10.1038/s42003-021-02757-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 77.Harrison, N. J. et al. Regenerative neurogenic response from glia requires insulin-driven neuron-glia communication. eLife10, e58756 (2021). [DOI] [PMC free article] [PubMed]
- 78.Wang, B. et al. Liquid metal microscale deposition enabled high resolution and density epidermal microheater for localized ectopic expression in Drosophila. Adv. Mater. Technol.7, 2100903 (2021).
- 79.Osadchiy V, Martin CR, Mayer EA. The gut-brain axis and the microbiome: mechanisms and clinical implications. Clin. Gastroenterol. hepatology: Off. Clin. Pract. J. Am. Gastroenterological Assoc. 2019;17:322–332. doi: 10.1016/j.cgh.2018.10.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 80.Cani PD, et al. Gut microbiota fermentation of prebiotics increases satietogenic and incretin gut peptide production with consequences for appetite sensation and glucose response after a meal. Am. J. Clin. Nutr. 2009;90:1236–1243. doi: 10.3945/ajcn.2009.28095. [DOI] [PubMed] [Google Scholar]
- 81.Chimerel C, et al. Bacterial metabolite indole modulates incretin secretion from intestinal enteroendocrine L cells. Cell Rep. 2014;9:1202–1208. doi: 10.1016/j.celrep.2014.10.032. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 82.Buchon N, et al. Morphological and molecular characterization of adult midgut compartmentalization in Drosophila. Cell Rep. 2013;3:1725–1738. doi: 10.1016/j.celrep.2013.04.001. [DOI] [PubMed] [Google Scholar]
- 83.Rao S, Lang C, Levitan ES, Deitcher DL. Visualization of neuropeptide expression, transport, and exocytosis in Drosophila melanogaster. J. Neurobiol. 2001;49:159–172. doi: 10.1002/neu.1072. [DOI] [PubMed] [Google Scholar]
- 84.Sweeney ST, Broadie K, Keane J, Niemann H, O’Kane CJ. Targeted expression of tetanus toxin light chain in Drosophila specifically eliminates synaptic transmission and causes behavioral defects. Neuron. 1995;14:341–351. doi: 10.1016/0896-6273(95)90290-2. [DOI] [PubMed] [Google Scholar]
- 85.Xu T, Binz T, Niemann H, Neher E. Multiple kinetic components of exocytosis distinguished by neurotoxin sensitivity. Nat. Neurosci. 1998;1:192–200. doi: 10.1038/642. [DOI] [PubMed] [Google Scholar]
- 86.Hamada FN, et al. An internal thermal sensor controlling temperature preference in Drosophila. Nature. 2008;454:217–220. doi: 10.1038/nature07001. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 87.Beehler-Evans R, Micchelli CA. Generation of enteroendocrine cell diversity in midgut stem cell lineages. Development. 2015;142:654–664. doi: 10.1242/dev.114959. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 88.Qi W, et al. A quantitative feeding assay in adult Drosophila reveals rapid modulation of food ingestion by its nutritional value. Mol. brain. 2015;8:87. doi: 10.1186/s13041-015-0179-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 89.Deng B, et al. Chemoconnectomics: mapping chemical transmission in Drosophila. Neuron. 2019;101:876–893.e874. doi: 10.1016/j.neuron.2019.01.045. [DOI] [PubMed] [Google Scholar]
- 90.Kim DH, Shin M, Jung SH, Kim YJ, Jones WD. A fat-derived metabolite regulates a peptidergic feeding circuit in Drosophila. PLoS Biol. 2017;15:e2000532. doi: 10.1371/journal.pbio.2000532. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 91.Chung BY, et al. Drosophila neuropeptide F signaling independently regulates feeding and sleep-wake behavior. Cell Rep. 2017;19:2441–2450. doi: 10.1016/j.celrep.2017.05.085. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 92.Obniski R, Sieber M, Spradling AC. Dietary lipids modulate notch signaling and influence adult intestinal development and metabolism in Drosophila. Dev. cell. 2018;47:98–111.e115. doi: 10.1016/j.devcel.2018.08.013. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 93.Ventura AK, Beauchamp GK, Mennella JA. Infant regulation of intake: the effect of free glutamate content in infant formulas. Am. J. Clin. Nutr. 2012;95:875–881. doi: 10.3945/ajcn.111.024919. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 94.Blachier F, Boutry C, Bos C, Tome D. Metabolism and functions of L-glutamate in the epithelial cells of the small and large intestines. Am. J. Clin. Nutr. 2009;90:814S–821S. doi: 10.3945/ajcn.2009.27462S. [DOI] [PubMed] [Google Scholar]
- 95.Levitan ES. Signaling for vesicle mobilization and synaptic plasticity. Mol. Neurobiol. 2008;37:39–43. doi: 10.1007/s12035-008-8014-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 96.Moghadam PK, Jackson MB. The functional significance of synaptotagmin diversity in neuroendocrine secretion. Front. Endocrinol. 2013;4:124. doi: 10.3389/fendo.2013.00124. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 97.Chen TW, et al. Ultrasensitive fluorescent proteins for imaging neuronal activity. Nature. 2013;499:295–300. doi: 10.1038/nature12354. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 98.Lopez, J. J. et al. Molecular Basis and Regulation of Store-Operated Calcium Entry. In Calcium Signaling. (ed. M. S. Islam) 1131, 445–469 (Springer International Publishing, Cham; 2020). [DOI] [PubMed]
- 99.Chorna T, Hasan G. The genetics of calcium signaling in Drosophila melanogaster. Biochimica et. biophysica acta. 2012;1820:1269–1282. doi: 10.1016/j.bbagen.2011.11.002. [DOI] [PubMed] [Google Scholar]
- 100.Chakraborty S, Hasan G. IP3R, store-operated Ca2+ entry and neuronal Ca2+ homoeostasis in Drosophila. Biochemical Soc. Trans. 2012;40:279–281. doi: 10.1042/BST20110618. [DOI] [PubMed] [Google Scholar]
- 101.Deng H, Gerencser AA, Jasper H. Signal integration by Ca(2+) regulates intestinal stem-cell activity. Nature. 2015;528:212–217. doi: 10.1038/nature16170. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 102.Clapham DE. Calcium signaling. Cell. 2007;131:1047–1058. doi: 10.1016/j.cell.2007.11.028. [DOI] [PubMed] [Google Scholar]
- 103.Banerjee S, et al. Compensation of inositol 1,4,5-trisphosphate receptor function by altering sarco-endoplasmic reticulum calcium ATPase activity in the Drosophila flight circuit. J. Neurosci.: Off. J. Soc. Neurosci. 2006;26:8278–8288. doi: 10.1523/JNEUROSCI.1231-06.2006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 104.Roos J, et al. STIM1, an essential and conserved component of store-operated Ca2+ channel function. J. cell Biol. 2005;169:435–445. doi: 10.1083/jcb.200502019. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 105.Zhang SL, et al. STIM1 is a Ca2+ sensor that activates CRAC channels and migrates from the Ca2+ store to the plasma membrane. Nature. 2005;437:902–905. doi: 10.1038/nature04147. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 106.Chakraborty S, et al. Mutant IP3 receptors attenuate store-operated Ca2+ entry by destabilizing STIM-Orai interactions in Drosophila neurons. J. cell Sci. 2016;129:3903–3910. doi: 10.1242/jcs.191585. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 107.Schwarz EM, Benzer S. Calx, a Na-Ca exchanger gene of Drosophila melanogaster. Proc. Natl Acad. Sci. USA. 1997;94:10249–10254. doi: 10.1073/pnas.94.19.10249. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 108.Krick, N. et al. Separation of presynaptic Ca(v)2 and Ca(v)1 channel function in synaptic vesicle exo- and endocytosis by the membrane anchored Ca(2+) pump PMCA. Proc. Natl Acad. Sci. USA118, e2106621118 (2021). [DOI] [PMC free article] [PubMed]
- 109.Bi J, et al. Seipin promotes adipose tissue fat storage through the ER Ca(2)(+)-ATPase SERCA. Cell Metab. 2014;19:861–871. doi: 10.1016/j.cmet.2014.03.028. [DOI] [PubMed] [Google Scholar]
- 110.He L, Si G, Huang J, Samuel ADT, Perrimon N. Mechanical regulation of stem-cell differentiation by the stretch-activated Piezo channel. Nature. 2018;555:103–106. doi: 10.1038/nature25744. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 111.Wen T, Parrish CA, Xu D, Wu Q, Shen P. Drosophila neuropeptide F and its receptor, NPFR1, define a signaling pathway that acutely modulates alcohol sensitivity. Proc. Natl Acad. Sci. USA. 2005;102:2141–2146. doi: 10.1073/pnas.0406814102. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 112.Guo Z, Driver I, Ohlstein B. Injury-induced BMP signaling negatively regulates Drosophila midgut homeostasis. J. cell Biol. 2013;201:945–961. doi: 10.1083/jcb.201302049. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 113.Jiang H, et al. Cytokine/Jak/Stat signaling mediates regeneration and homeostasis in the Drosophila midgut. Cell. 2009;137:1343–1355. doi: 10.1016/j.cell.2009.05.014. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 114.Pfeiffer BD, et al. Tools for neuroanatomy and neurogenetics in Drosophila. Proc. Natl Acad. Sci. USA. 2008;105:9715–9720. doi: 10.1073/pnas.0803697105. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 115.Kendroud S, et al. Structure and development of the subesophageal zone of the Drosophila brain. II. Sensory compartments. J. Comp. Neurol. 2018;526:33–58. doi: 10.1002/cne.24316. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 116.Nern A, Pfeiffer BD, Rubin GM. Optimized tools for multicolor stochastic labeling reveal diverse stereotyped cell arrangements in the fly visual system. Proc. Natl Acad. Sci. USA. 2015;112:E2967–E2976. doi: 10.1073/pnas.1506763112. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 117.Chen D, et al. Genetic and neuronal mechanisms governing the sex-specific interaction between sleep and sexual behaviors in Drosophila. Nat. Commun. 2017;8:154. doi: 10.1038/s41467-017-00087-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 118.McNabb SL, et al. Disruption of a behavioral sequence by targeted death of peptidergic neurons in Drosophila. Neuron. 1997;19:813–823. doi: 10.1016/S0896-6273(00)80963-0. [DOI] [PubMed] [Google Scholar]
- 119.Masuyama K, Zhang Y, Rao Y, Wang JW. Mapping neural circuits with activity-dependent nuclear import of a transcription factor. J. Neurogenet. 2012;26:89–102. doi: 10.3109/01677063.2011.642910. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 120.Zhang YQ, Rodesch CK, Broadie K. Living synaptic vesicle marker: synaptotagmin-GFP. Genesis. 2002;34:142–145. doi: 10.1002/gene.10144. [DOI] [PubMed] [Google Scholar]
- 121.Nicolai LJ, et al. Genetically encoded dendritic marker sheds light on neuronal connectivity in Drosophila. Proc. Natl Acad. Sci. USA. 2010;107:20553–20558. doi: 10.1073/pnas.1010198107. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 122.Talay M, et al. Transsynaptic mapping of second-order taste neurons in flies by trans-tango. Neuron. 2017;96:783–795.e784. doi: 10.1016/j.neuron.2017.10.011. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 123.Pool AH, et al. Four GABAergic interneurons impose feeding restraint in Drosophila. Neuron. 2014;83:164–177. doi: 10.1016/j.neuron.2014.05.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 124.Flood TF, et al. A single pair of interneurons commands the Drosophila feeding motor program. Nature. 2013;499:83–87. doi: 10.1038/nature12208. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 125.Gershon, M. D. & Margolis, K. G. The gut, its microbiome, and the brain: connections and communications. J. Clin. Investig.131, e143768 (2021). [DOI] [PMC free article] [PubMed]
- 126.Clemmensen C, et al. Gut-Brain Cross-Talk in Metabolic Control. Cell. 2017;168:758–774. doi: 10.1016/j.cell.2017.01.025. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 127.Reimann F, Tolhurst G, Gribble FM. G-protein-coupled receptors in intestinal chemosensation. Cell Metab. 2012;15:421–431. doi: 10.1016/j.cmet.2011.12.019. [DOI] [PubMed] [Google Scholar]
- 128.Mace OJ, Schindler M, Patel S. The regulation of K- and L-cell activity by GLUT2 and the calcium-sensing receptor CasR in rat small intestine. J. Physiol. 2012;590:2917–2936. doi: 10.1113/jphysiol.2011.223800. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 129.Oya M, et al. The G protein-coupled receptor family C group 6 subtype A (GPRC6A) receptor is involved in amino acid-induced glucagon-like peptide-1 secretion from GLUTag cells. J. Biol. Chem. 2013;288:4513–4521. doi: 10.1074/jbc.M112.402677. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 130.Tolhurst G, et al. Glutamine triggers and potentiates glucagon-like peptide-1 secretion by raising cytosolic Ca2+ and cAMP. Endocrinology. 2011;152:405–413. doi: 10.1210/en.2010-0956. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 131.Wang JH, et al. Umami receptor activation increases duodenal bicarbonate secretion via glucagon-like peptide-2 release in rats. J. Pharm. Exp. Ther. 2011;339:464–473. doi: 10.1124/jpet.111.184788. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 132.Titos, I. & Rogulja, D. A gut-secreted peptide controls arousability through modulation of dopaminergic neurons in the brain. bioRxiv: the preprint server for biology, 2020.2008.2031.275552 (2020).
- 133.Brown MR, et al. Identification of a Drosophila brain-gut peptide related to the neuropeptide Y family. Peptides. 1999;20:1035–1042. doi: 10.1016/S0196-9781(99)00097-2. [DOI] [PubMed] [Google Scholar]
- 134.Gropp E, et al. Agouti-related peptide-expressing neurons are mandatory for feeding. Nat. Neurosci. 2005;8:1289–1291. doi: 10.1038/nn1548. [DOI] [PubMed] [Google Scholar]
- 135.Luquet S, Perez FA, Hnasko TS, Palmiter RD. NPY/AgRP neurons are essential for feeding in adult mice but can be ablated in neonates. Science. 2005;310:683–685. doi: 10.1126/science.1115524. [DOI] [PubMed] [Google Scholar]
- 136.DeSalvo MK, Mayer N, Mayer F, Bainton RJ. Physiologic and anatomic characterization of the brain surface glia barrier of Drosophila. Glia. 2011;59:1322–1340. doi: 10.1002/glia.21147. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 137.Scopelliti A, et al. A Neuronal Relay Mediates a Nutrient Responsive Gut/Fat Body Axis Regulating Energy Homeostasis in Adult Drosophila. Cell Metab. 2019;29:269–284.e210. doi: 10.1016/j.cmet.2018.09.021. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 138.Ding, K. et al. Imaging neuropeptide release at synapses with a genetically engineered reporter. eLife8, e46421 (2019). [DOI] [PMC free article] [PubMed]
- 139.Han Y, Ding K. Imaging neuropeptide release at drosophila neuromuscular junction with a genetically engineered neuropeptide release reporter. Methods Mol. Biol. 2022;2417:193–203. doi: 10.1007/978-1-0716-1916-2_15. [DOI] [PubMed] [Google Scholar]
- 140.de Araujo IE, Schatzker M, Small DM. Rethinking food reward. Annu. Rev. Psychol. 2020;71:139–164. doi: 10.1146/annurev-psych-122216-011643. [DOI] [PubMed] [Google Scholar]
- 141.Duvall LB, Ramos-Espiritu L, Barsoum KE, Glickman JF, Vosshall LB. Small-molecule agonists of Ae. aegypti neuropeptide Y receptor block mosquito biting. Cell. 2019;176:687–701.e685. doi: 10.1016/j.cell.2018.12.004. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 142.Furness JB. The enteric nervous system and neurogastroenterology. Nat. Rev. Gastroenterol. Hepatol. 2012;9:286–294. doi: 10.1038/nrgastro.2012.32. [DOI] [PubMed] [Google Scholar]
- 143.Dockray GJ. Enteroendocrine cell signalling via the vagus nerve. Curr. Opin. Pharmacol. 2013;13:954–958. doi: 10.1016/j.coph.2013.09.007. [DOI] [PubMed] [Google Scholar]
- 144.Bai L, et al. Genetic identification of vagal sensory neurons that control feeding. Cell. 2019;179:1129–1143.e1123. doi: 10.1016/j.cell.2019.10.031. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 145.Drokhlyansky E, et al. The human and mouse enteric nervous system at single-cell resolution. Cell. 2020;182:1606–1622.e1623. doi: 10.1016/j.cell.2020.08.003. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 146.Miguel-Aliaga I, Jasper H, Lemaitre B. Anatomy and physiology of the digestive tract of Drosophila melanogaster. Genetics. 2018;210:357–396. doi: 10.1534/genetics.118.300224. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 147.Berthoud HR, Patterson LM. Anatomical relationship between vagal afferent fibers and CCK-immunoreactive entero-endocrine cells in the rat small intestinal mucosa. Acta Anat. (Basel) 1996;156:123–131. doi: 10.1159/000147837. [DOI] [PubMed] [Google Scholar]
- 148.Kaelberer, M. M. et al. A gut-brain neural circuit for nutrient sensory transduction. Science361, eaat5236 (2018). [DOI] [PMC free article] [PubMed]
- 149.Kim DY, et al. A neural circuit mechanism for mechanosensory feedback control of ingestion. Nature. 2020;580:376–380. doi: 10.1038/s41586-020-2167-2. [DOI] [PubMed] [Google Scholar]
- 150.Wang P, Jia Y, Liu T, Jan YN, Zhang W. Visceral mechano-sensing neurons control drosophila feeding by using piezo as a sensor. Neuron. 2020;108:640–650.e644. doi: 10.1016/j.neuron.2020.08.017. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 151.Min, S. et al. Control of feeding by Piezo-mediated gut mechanosensation in Drosophila. eLife10, e63049 (2021). [DOI] [PMC free article] [PubMed]
- 152.Oh Y, et al. Periphery signals generated by Piezo-mediated stomach stretch and Neuromedin-mediated glucose load regulate the Drosophila brain nutrient sensor. Neuron. 2021;109:1979–1995 e1976. doi: 10.1016/j.neuron.2021.04.028. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 153.Jiang H, Grenley MO, Bravo M-J, Blumhagen RZ, Edgar BA. EGFR/Ras/MAPK signaling mediates adult midgut epithelial homeostasis and regeneration in Drosophila. Cell Stem Cell. 2011;8:84–95. doi: 10.1016/j.stem.2010.11.026. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 154.Choi NH, Lucchetta E, Ohlstein B. Nonautonomous regulation of Drosophila midgut stem cell proliferation by the insulin-signaling pathway. Proc. Natl Acad. Sci. USA. 2011;108:18702–18707. doi: 10.1073/pnas.1109348108. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 155.Han C, et al. The doublesex gene regulates dimorphic sexual and aggressive behaviors in Drosophila. Proc. Natl Acad. Sci. USA. 2022;119:e2201513119. doi: 10.1073/pnas.2201513119. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 156.Sun L, Jiang RH, Ye WJ, Rosbash M, Guo F. Recurrent circadian circuitry regulates central brain activity to maintain sleep. Neuron. 2022;110:2139–2154.e2135. doi: 10.1016/j.neuron.2022.04.010. [DOI] [PubMed] [Google Scholar]
- 157.Wu S, et al. Drosulfakinin signaling in fruitless circuitry antagonizes P1 neurons to regulate sexual arousal in Drosophila. Nat. Commun. 2019;10:4770. doi: 10.1038/s41467-019-12758-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 158.Guenin L, et al. Spatio-temporal expression of Prospero is finely tuned to allow the correct development and function of the nervous system in Drosophila melanogaster. Dev. Biol. 2007;304:62–74. doi: 10.1016/j.ydbio.2006.12.016. [DOI] [PubMed] [Google Scholar]
- 159.Kim WJ, Jan LY, Jan YN. A PDF/NPF neuropeptide signaling circuitry of male Drosophila melanogaster controls rival-induced prolonged mating. Neuron. 2013;80:1190–1205. doi: 10.1016/j.neuron.2013.09.034. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 160.Ewer J, et al. Taste and pheromonal inputs govern the regulation of time investment for mating by sexual experience in male Drosophila melanogaster. PLoS Genet. 2023;19:e1010753. doi: 10.1371/journal.pgen.1010753. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 161.Zhai Z, Boquete JP, Lemaitre B. Cell-specific Imd-NF-kappaB responses enable simultaneous antibacterial immunity and intestinal epithelial cell shedding upon bacterial infection. Immunity. 2018;48:897–910.e897. doi: 10.1016/j.immuni.2018.04.010. [DOI] [PubMed] [Google Scholar]
- 162.Ohlstein B, Spradling A. The adult Drosophila posterior midgut is maintained by pluripotent stem cells. Nature. 2006;439:470–474. doi: 10.1038/nature04333. [DOI] [PubMed] [Google Scholar]
- 163.Li, Y. G. et al. Gut AstA mediates sleep deprivation-induced energy wasting in Drosophila. Cell Discov.9, 49 (2023). [DOI] [PMC free article] [PubMed]
- 164.Xu KY, Zheng XZ, Sehgal A. Regulation of feeding and metabolism by neuronal and peripheral clocks in drosophila. Cell Metab. 2008;8:289–300. doi: 10.1016/j.cmet.2008.09.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 165.Ryu JH, et al. Innate immune homeostasis by the homeobox gene Caudal and commensal-gut mutualism in Drosophila. Science. 2008;319:777–782. doi: 10.1126/science.1149357. [DOI] [PubMed] [Google Scholar]
- 166.Wu S, et al. Apical-basal polarity precisely determines intestinal stem cell number by regulating Prospero threshold. Cell Rep. 2023;42:112093. doi: 10.1016/j.celrep.2023.112093. [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Supplementary Materials
Description of Additional Supplementary Files
Data Availability Statement
All data generated or analyzed during this study are available as a Source data file. Source data are provided with this paper. The gut-microbiota sequencing data generated in this study have been deposited in the Figshare database without accession code [10.6084/m9.figshare.25458226.v1]. Additional data are available upon request to Dr. Zheng Guo (guozheng@hust.edu.cn). Source data are provided with this paper.







