Skip to main content
AMB Express logoLink to AMB Express
. 2024 Jul 11;14:80. doi: 10.1186/s13568-024-01719-y

Designing and expression of novel recombinant fusion protein for efficient antigen screening of SARS-CoV-2

G Vinaya Chandu Vidyasagar 1,3,#, P V Janardhan Reddy 1,#, M Md Ghouse 1, T C Venkateswarulu 3, P B Kavi Kishor 1,4, Prashanth Suravajhala 2,, Rathnagiri Polavarapu 1,
PMCID: PMC11239635  PMID: 38990364

Abstract

Corona virus disease 2019 (COVID-19) pandemic caused by severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), claimed millions globally. After the report of the first incidence of the virus, variants emerged with each posing a unique threat than its predecessors. Though many advanced diagnostic assays like real-time PCR are available for screening of SARS-CoV-2, their applications are being hindered because of accessibility and cost. With the advent of rapid assays for antigenic screening of SARS-CoV-2 made diagnostics far easy as the assays are rapid, cost-effective and can be used at point-of-care settings. In the present study, a fusion construct was made utilising highly immunogenic B cell epitopes from the three important structural proteins of SARS-CoV-2. The protein was expressed; purified capture mAbs generated and rapid antigen assay was developed. Eight hundred and forty nasopharyngeal swab samples were screened for the evaluation of the developed assay which showed 37.14% positivity, 96.51% and 100% sensitivity and specificity respectively. The assay developed was supposed to identify SARS-CoV-2 wild-type as well as variants of concern and variants of importance in real-time conditions.

Keywords: COVID-19, SARS-CoV-2, Variants, Rapid antigen assay, Variants of concern, Variants of importance

Introduction

COVID-19 pandemic caused by the SARS-CoV-2 affected 772 million populations and claimed around 7 million lives worldwide (WHO, 2023). Presently only symptomatic therapy is available for COVID-19 despite the accessibility of various vaccines. SARS-CoV-2 still co-exists with the human population, thus emphasising the importance of new diagnostic methodologies for effective and accurate diagnosis of the COVID-19 (Yadegari et al. 2023). SARS-CoV-2 is an enveloped virus with single stranded 29.9 kb RNA genome with four structural proteins namely surface glycoproteins or spike (S), nucleocapsid (N), envelope (E) and membrane (M) (Wu et al. 2020). Of these, S is more prone to mutations (Farhud and Mojahed 2022) while N is the least prone to mutations (Naqvi et al. 2020; Che et al. 2004). Utilisation of diagnostic assays played a major role in control management of COVID-19. Though the gold standard real-time RT-PCR has proved its ability in effective screening of the SARS-CoV-2, it is having its own limitations like long turnaround time because of sample load, cost effectiveness, needs skilled personnel and centralised specialised laboratory facilities (Dong et al. 2023). The advent of rapid diagnostic assays made it easy for faster diagnosis of COVID-19 at a lower cost, in low-income countries as well as screening of mass population in very short intervals of time with minimal technical expertise (Baldanti et al. 2022).

With the evolution of new mutants and variants of concern (VoC) like Delta, Omicron along with its sub variants and the new JN.1, the COVID-19 disease is still a threat to human kind. While the screening of the mutants and VoCs is difficult with the existing point-of-care rapid antigen assays with majority of targeting N protein (Fujisawa et al. 2023; He et al. 2004) several mutant forms of spike protein evade the immune response (Chen et al. 2020; Harvey et al. 2021). Reports also identified a mutation in the N region that decreases the sensitivity up to 1000-fold (Bourassa et al. 2021; Jian et al. 2022). The present study focuses on the development of rapid antigen assays for screening SARS-CoV-2 which are more sensitive and can even diagnose mutants if any.

Materials and methods

Design of the construct

To design the recombinant construct, the gene sequences of the surface glycoprotein (S), membrane (M) and nucleocapsid (N) were taken from the SARS-CoV-2 genome reference sequence Wuhan-Hu-1 (Accession Number MN908947) from the National Centre for Biotechnology Information (NCBI) database. The fragments were selected in such a way that they will not fall in the region of mutation or not in VoCs like Delta, Omicron (B.1.1.529) or variants of interest (VoI) like Omicron (XBB. 1.5; XBB.1.16; B.A. 2.86) (Farhud and Mojahed 2022; Cosar et al. 2022). The B cell epitopes of the three genes were identified using IEDB (Jespersen et al. 2017) and from the theoretical studies reported by Grifoni et al. (2020). The sequences deduced were joined with flexible linker GGGGS which allows interaction between domains (Chen et al. 2013) to get a functional fusion protein after adding the start and stop codons at both 5′ and 3′ ends respectively. The constructed fusion protein sequence was reverse translated to get the nucleotide sequence. The constructed protein’s secondary structure was determined by the Prabi server at SOPMA (Obaidullah et al. 2021). The amino acid composition, physicochemical properties of the constructed protein, including molecular weight, isoelectric point, net charge at pH7, half-life in the mammalian reticulocytes, and instability index, were estimated using Protparam (Gasteiger et al. 2005). The 3D structure of the chimeric protein was generated using the I-Tasser server (Zheng et al. 2021; Yang and Zhang 2015) and viewed on VMD Molecular Graphis Viewer (Humphrey et al. 1996). Antigenicity of the fusion protein was evaluated using VaxiJen (Nosrati et al. 2019).

Transformation and expression

The recombinant fusion gene was synthesized commercially in pET28a (+) vector (Gene Universal, USA) for expression. The recombinant fusion plasmid was transformed into E. coli BL21 cells using calcium chloride chemical method (Sambrook and Russell 2001) on Luria-Bertani (LB) agar plates with kanamycin as selection marker. The colonies formed were checked for the presence of plasmid using alkaline-lysis method and further by polymerase chain reaction (PCR) using primers for T7 promoter and T7 terminator. The positive fusion clones were expressed using 1 mM IPTG and the recombinant fusion protein was separated on the affinity column using Ni-NTA resin (in-house Genomix) under denaturing conditions. The quality of the expressed fusion protein was checked on 12% SDS-PAGE gels, while the concentration of the purified recombinant protein was determined using nanodrop spectrophotometer (Thermo Scientific).

Development of rapid antigen assay

The recombinant fusion protein was used for the development of monoclonal antibodies which were synthesized commercially (Dx Sys Inc., USA). The polyclonal antibodies were raised in mice (in-house) and IgG antibody was purified on protein A column and was tagged with colloidal nano gold (in-house Genomix). The test line (T) on the nitrocellulose membrane (MDI, India) was coated with 1 mg/ml of the monoclonal antibodies while the control line (C) was coated with 1 mg/ml of goat anti-mouse antibodies (in-house). The conjugate pad consists of colloidal gold conjugated polyclonal mouse antibodies (Fig. 1). The test strip is to be supplied with a proprietary lysis buffer for the usage of the assay.

Fig. 1.

Fig. 1

Image showing the layout of the rapid antigen test cassette. The strip in the cassette housing comprises of a sample pad and a conjugate pad with colloidal gold conjugated mouse polyclonal antibodies followed by the nitrocellulose membrane coated with mAbs against fusion antigen at T and goat anti-mouse antibodies at C position. The membrane is overlayed by the absorbent pad

If SARS-CoV-2 antigen is present in the sample, it binds to the colloidal nano gold conjugated mouse polyclonal antibodies on the conjugate pad. By capillary action, the complex moves towards the absorbent pad. The SARS-CoV-2 antigen in the complex binds to the mAbs on the test line, thus gives the purple line at T. If no antigen is present in the sample, no line appears at T while the unbound colloidal gold conjugated.

polyclonal antibodies bind with goat anti-mouse antibodies on the control line, thus gives the purple line at C.

Sample collection and usage

A total of 840 parallel nasopharyngeal or oropharyngeal swab samples were collected from the subjects attending a tertiary care hospital with suspicion of COVID-19 infection along with a sample in VTM for real-time RT-PCR with informed consent (Vidyasagar et al. 2023). The swabs were inserted immediately in the lysis buffer vial and mixed well and loaded onto the sample well of the test cassette and waited till the colour line appeared either on T and/or C lines. No results were read after 20 min of adding the sample.

Performance evaluation of the developed assay

The developed assay was evaluated against the standard real time RT-PCR for screening of SARS-CoV-2 as per manufacturer’s instructions (Huwel, India). Sensitivity and specificity were calculated for the assays performed on samples collected and screened as per earlier studies (Vidyasagar et al. 2023).

Limit of detection (LOD) determination

The analytical performance of the developed rapid antigen assay was assessed by testing the LOD with different concentrations of recombinant SARS-CoV-2 recombinant fusion protein diluted in phosphate buffered saline (pH 7.4) as described (Fischl et al. 2024; Weishampel et al. 2022). The LOD was confirmed as the lowest concentration of recombinant protein that was detected ≥ 95% of the time and all the rapid assays were read with in 20 min.

Results

Recombinant fusion construct

The recombinant fusion construct is of 1014 bp which includes five epitopes from S protein, 2 from M protein and 3 from N protein (Table 1) from which the complete fusion gene and protein sequence was designed (Fig. 2). The Protparam analysis of the synthetic fusion protein revealed 337 amino acids with a molecular weight of 35.16 kDa and a theoretical isoelectric point of 8.64. The estimated half-life of the fusion protein in human reticulocytes is calculated as 30 h. With the instability index calculated at 44.78, the protein is unstable. The predicted aliphatic index of the fusion protein is 72.88 and the calculated Grand Average of Hydropathicity (GRAVY) is -0.381. The SOPMA result for the fusion protein revealed 16.91% alpha helix (57 AAs), 25.52% extended strand (86 AAs), 10.68% beta turns (36 AAs) and 46.88% random coil (158 AAs). Overall protective antigen prediction is predicted as 0.5491, indicating that the fusion protein is a probable antigen. The I-Tasser generated 3D image is shown in the Fig. 3.

Table 1.

Table showing the epitope sequences from different structural proteins of SARS-CoV-2 used in the construction of fusion protein

Protein Epitope sequence Start End
Spike (S) DAVDCALDPLSETKCTLKSFTVEKGIYQTSN 287 317
VCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVI 524 598
GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGS 601 640
FSQILPDPSKPSKRSFIE 802 819
FGAGAALQIPFAMQMAYRFNGI 888 909
Membrane (M) MADSNGTITVEELKKLLEQWNLVI 1 24
PLLESELVIGAVILRGHLRI 132 151
Nucleocapsid (N) RPQGLPNNTASWFTALTQHGK 41 61
NNNAATVLQLPQGTTLPKGF 152 171
NKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADM 354 400

Fig. 2.

Fig. 2

Nucleotide and amino acid sequences of fusion gene of SARS-CoV-2. (A) Nucleotide sequence of the recombinant fusion gene with selected reverse translated sequences from Spike, membrane and nucleocapsid genes of SARS-CoV-2 which are joined the linker sequence. (B) Aminoacid sequence of the fusion protein with selected epitopes from spike, membrane and nucleocapsid proteins of SARS-CoV-2 which are joined by the flexible linker sequence GGGGS. Start and stop codons were added at 5’ and 3’ ends respectively

Fig. 3.

Fig. 3

3D structure of the fusion protein. The selected epitopes of spike (yellow), membrane (green) and nucleocapsid (purple) in the recombinant fusion protein. Arrows represent the flexible GGGGS linkers for joining the selected epitopes to form a functional protein

Confirmation of recombinant fusion clone

The PCR performed using T7 universal primers to confirm the presence of the recombinant fusion gene in the pET28a(+) plasmid revealed a 1256 bp fragment (Fig. 4) on 1% agarose-TAE gel.

Fig. 4.

Fig. 4

Agarose gel showing the amplification of the fusion gene. PCR performed using T7 promoter and T7 terminator universal primers shows the 1256 bp amplified fusion plasmid cloned in pET28a(+) vector (lanes 1–4) run against the 100 bp ladder (lane M) (NEB)

Expression and purification of the fusion protein

The desired 35 kDa recombinant fusion protein expression was evaluated on 12% SDS-PAGE (Fig. 5) with N terminal 6x His-tag. The concentration of the purified recombinant protein determined using nanodrop spectrophotometer was 1 mg/ml.

Fig. 5.

Fig. 5

SDS-PAGE gel showing the purified recombinant fusion protein.  Lane 1 showing the pre-induction of the protein where no expression is seen; Lanes 2–3 showing the induction of recombinant fusion protein induced with 1mM IPTG; Lanes 4–7 showing the 35 kDa eluted purified fusion protein. Lane M showing the pre-stained broad range protein marker (Puregene)

Development of antigen rapid assay

From the 840 samples collected, a total of 315 samples were found positive for SARS-CoV-2 by real time RT-PCR while 525 samples were found negative. The same samples were used for antigen screening by the in-house developed rapid assay which resulted in 312 positives and 528 negatives with an overall positivity of 37.14%. The reading of the results was carried out as shown in Fig. 6. The representative images were shown in the Fig. 7.

Fig. 6.

Fig. 6

Image showing the reading patterns of the rapid antigen assay.  If purple line appears only at C position, the sample is negative for SARS-CoV-2. If purple lines appear both at C and T positions, the sample is positive for SARS-CoV-2 irrespective of the thickness of line at T. If no purple line appears at C with /without line at T position, the test is invalid and needs repetition with a new test device or sample

Fig. 7.

Fig. 7

Results of rapid antigen assay using nasopharyngeal swab samples. If purple line appears at C position, then the samples are negative for SARS-CoV-2 (shown on left side of the image) and if purple line appears both at C & T positions, then the samples are positive for the presence of SARS-CoV-2 (shown on right side of the image)

Performance of the developed antigen assay

The antigen rapid assay developed was found to be at par with the real-time RT-PCR evaluated. The assay showed a sensitivity of 96.51%, a specificity of 100% and accuracy of 98.69% at 95% CI (Table 2).

Table 2.

Table showing the performance evaluation of the antigen rapid test against the real time RT-PCR for screening SARS-CoV-2

Rapid antigen assay Real time RT-PCR
Positive n Negative n Total
Positive True positive 304 False positive 0 304
Negative False negative 11 True negative 525 536
Total 315 525 840

Analytical sensitivity

The detection ability of the recombinant fusion protein was tested using the quantified purified fusion protein. The LOD for the recombinant protein was determined to be 0.327 ng/ml.

Discussion

To the authors’ knowledge, this is the first-time structural information on multiple viral proteins has been used to generate a native immunogen, whose mAbs capture viral proteins. Rapid antigen assays are very important for tracking the spread of an infectious disease during a pandemic. Though the rapid assays for SARS-CoV-2 offer benefits over real-time RT-PCR assays but lag behind in terms of sensitivity (Funabashi et al. 2021). Most of the rapid antigen assays were designed using N protein as it is preferred because of its relative abundance (Juniastuti et al., 2023) and is relatively stable even in variants (Mohammad et al. 2021) while very few assays are developed using the S protein as target for screening of SARS-CoV-2. As per 2022 data, among the 44 FDA-EUA antigen-detecting lateral flow assays, 42 are directed against the N antigen whereas only two target both N antigen and receptor binding domain (RBD) of the S protein (Ang et al. 2022). In one of the studies, the antigen assay developed using N protein has been able to detect all samples with high and medium-viral titers, while it could detect 64.7% (95% CI: 47.8 − 78.6%) samples in the low-virus titer cohort, but the assay is negative for PCR negatives (Funabashi et al. 2021). Even ELISA assays developed using mAbs against N protein revealed a sensitivity and specificity of 70.72% (95% CI: 66.01–75.12) and 100% (95% CI: 97.57–100), respectively, regardless of Ct values and SARS-CoV-2 variants (Yadegari et al. 2023). Another study showed a clinical sensitivity and specificity of 85.2% (95% CI, 74.3–92.0%) and 98.1% (95% CI, 93.3–99.7%) respectively against real-time PCR (Fischl et al. 2024).

Tests using commercial rapid antigen assays revealed a sensitivity ranging from 60.55 to 87.23% with high specificity ranging between 83.33 and 100% in all tests in samples with Ct value < 20 against the real-time PCR assay in case of Delta variants (Samsunder et al. 2023a). Similarly, while screening samples infected with Omicron sub-lineage BA.4 and BA.5, sensitivities of 73.38–74.03% and specificities of 99.22–97.41% respectively were reported using two commercial kits. Sensitivity was reported > 90% when the Ct value was < 20 (Samsunder et al. 2023b). In one of the studies where the sensitivities of rapid antigen assays were evaluated against the mutant variants, it was found that most commercially available rapid antigen tests (RATs) had similar sensitivity in detecting Omicron and Delta variants. When the antigen concentration was used as a comparator and the Ct value was used as a comparator, most rapid assays had a lower sensitivity for Omicron than Delta (Rao et al. 2023). A nanoparticle based lateral flow assay employing N protein in comparison to the RT-PCR, showed a sensitivity of 94.73% (Ding et al. 2023).

In one of the studies on performance evaluation of six commercial kits, each test showed no difference in the detection sensitivities between the wild-type virus and the variants thus suggesting that the lateral flow antigen test can be used for the detection of SARS-CoV-2 like the wild-type and the previous variants (Morinaga et al. 2023). However, some studies report regarding the reduced sensitivity of antigen tests for screening the Omicron variant in comparison with the previous variants or the wild-type virus (Osterman et al. 2022; Wagenhauser et al. 2023). As per WHO recommendations, the acceptable criteria for comparison of a rapid assay with the reference method i.e., RT-PCR needs 80% sensitivity and 97% specificity (Dinnes et al. 2022; WHO 2021), while the in-house developed assay in the present study meets these standards with 99.05% sensitivity and 100% specificity. Further, with the periodic surges of COVID-19 globally and the continuous spread of infections emphasise the importance of rapid diagnostics. In addition, there is an inherent need to make a data repository of signature motifs from these aforementioned assays which can then be established using immunoprecipitation analysis with biotinylated transcripts. These in turn could be potential targets for designing the aptamers which would ideally be specific and then test their efficacy for aptamer bound lateral flow assay towards theranostic validation.

Hence, there is the need for reliable antigen based rapid detection assays which are invaluable for the timely detection of SARS-CoV-2 infection with subsequent contact tracing and rapid isolation. However, there are some limitations to the present study, as the study population includes only symptomatic individuals. In addition, the screening of the new variant JN.1 was not done, but the developed assay may detect that too. Overall, the present study’s findings showed that the in-house developed COVID-19 rapid antigen test can exhibit excellent diagnostic performance and analytical sensitivity in detecting variants, including Omicron as the epitopes selected for S and N are derived from the regions where there are the least chances of mutations.

In response to COVID-19 infection, diagnostic real-time RT-PCR tests are adopted as a gold-standard method for detecting viral nucleic acids and identifying COVID-19 patients as the method is more sensitive than rapid antigen assays. However, the real-time RT-PCR is time-consuming, and requires equipment that cannot be used under POC settings. Antigen-based rapid assays play an invaluable role in the rapid identification of highly infectious cases, which can generally provide rapid results without the need for complex instrumentation and technical expertise.

Acknowledgements

All the technical and scientific staff of Genomix CARL for their support in this study.

Author contributions

RP, PVJR designed the experiments. GVCVS, MMG carried out the experiments. PVJR carried out the bioinformatics analysis. TCV, KK and PS analysed the data. GVCVS, PVJR, KK, PS and RP prepared the manuscript and refined it. All authors have read and approved the manuscript.

Funding

This research is not funded by any National or International funding agency.

Data availability

Data related to this manuscript are available with GVCVS and RP.

Declarations

Competing interests

The authors declare that they have no competing interests.

Ethics statement

All procedures performed in studies involving human participants were in accordance with the ethical standards of the institutional ethics committee at Kurnool Medical College, Kurnool.

Footnotes

Publisher’s Note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

G. Vinaya Chandu Vidyasagar and P. V. Janardhan Reddy contributed equally to this work.

Contributor Information

Prashanth Suravajhala, Email: prash@bioclues.org.

Rathnagiri Polavarapu, Email: giri@genomixbiotech.com.

References

  1. Ang GY, Chan KG, Yean CY, Yu CY. Lateral Flow immunoassays for SARS-CoV-2. Diagnostics. 2022;12:2854. doi: 10.3390/diagnostics12112854. [DOI] [PMC free article] [PubMed] [Google Scholar]
  2. Baldanti F, Ganguly NK, Wang G, Möckel M, O’Neill LA, Renz H, Ferreira CEDS, Tateda K, Pol BVD. Choice of SARS-CoV-2 diagnostic test: challenges and key considerations for the future. Crit Rev Clin Lab Sci. 2022;59:445–459. doi: 10.1080/10408363.2022.2045250. [DOI] [PMC free article] [PubMed] [Google Scholar]
  3. Bourassa L, Perchetti GA, Phung Q, Lin MJ, Mills MG, Roychoudhury P, Harmon KG, Reed JC, Greninger AL. A SARS-CoV-2 nucleocapsid variant that affects Antigen Test performance. J Clin Virol. 2021;141:104900. doi: 10.1016/j.jcv.2021.104900. [DOI] [PMC free article] [PubMed] [Google Scholar]
  4. Che XY, Hao W, Wang Y, Di B, Yin K, Xu YC, Feng CS, Wan ZY, Cheng VCC, Yuen KY. Nucleocapsid protein as early diagnostic marker for SARS. Emerg Infect Dis. 2004;10:1947–1949. doi: 10.3201/eid1011.040516. [DOI] [PMC free article] [PubMed] [Google Scholar]
  5. Chen X, Zaro JL, Shen W-C. Fusion protein linkers: property, design and functionality. Adv Drug Deliv Rev. 2013;65:1357–1369. doi: 10.1016/j.addr.2012.09.039. [DOI] [PMC free article] [PubMed] [Google Scholar]
  6. Chen J, Huang R, Nie Y, Wen X, Wu Y. Human monoclonal antibodies: on the menu of targeted therapeutics against COVID-19. Virol Sin. 2020;35:713–724. doi: 10.1007/s12250-020-00327-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  7. Cosar B, Karagulleoglu ZY, Unal S, Ince AT, Uncuoglu DB, Tuncer G, Kilinc BR, Ozkan YE, Ozkoc HC, Demir IN, Eker A, Karagoz F, Simsek SY, Yasar B, Pala M, Demir A, Atak IN, Mendi AH, Bengi VU, Seval GC, Altuntas EG, Kilic P, Dora DD. SARS-CoV-2 mutations and their viral variants. Cytokine Growth Factor Rev. 2022;63:10–22. doi: 10.1016/j.cytogfr.2021.06.001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  8. Ding H, Zhang W, Wang S-a, Li C, Li W, Liu J, Yu F, Tao Y, Cheng S, Xie H, Chen Y. A semi-quantitative upconversion nanoparticle-based immunochromatographic assay for SARS-CoV-2 antigen detection. Front Microbiol. 2023;14:1289682. doi: 10.3389/fmicb.2023.1289682. [DOI] [PMC free article] [PubMed] [Google Scholar]
  9. Dinnes J, Deeks JJ, Berhane S, Taylor M, Adriano A, Davenport C, Dittrich S, Emperador D, Takwoingi Y, Cunningham J, Beese S, Dretzke J, di Ruffano LF, Harris IM, Price MJ, Taylor-Phillips S, Hooft L, Leeflang MM, Spijker R, Van den Bruel A, Cochrane COVID-19 Diagnostic Test Accuracy Group Rapid, point-of-care antigen and molecular-based tests for diagnosis of SARS-CoV-2 infection. Cochrane Database Syst Rev. 2022;7:CD013705. doi: 10.1002/14651858. [DOI] [PMC free article] [PubMed] [Google Scholar]
  10. Dong T, Wang M, Liu J, Ma P, Pang S, Liu W, Liu A. Diagnostics and analysis of SARS-CoV-2: current status, recent advances, challenges and perspectives. Chem Sci. 2023;14:6149–6206. doi: 10.1039/D2SC06665C. [DOI] [PMC free article] [PubMed] [Google Scholar]
  11. Farhud DD, Mojahed N. SARS-COV-2 notable mutations and variants: a review article. Iran J Public Health. 2022;51:1494–1501. doi: 10.18502/ijph.v51i7.10083. [DOI] [PMC free article] [PubMed] [Google Scholar]
  12. Fischl MJ, Young J, Kardos K, Roehler M, Miller T, Wooten M, Holmes N, Gula N, Baglivo M, Steen J, Zelenz N, Joyee AG, Munster V, Weishampel Z, Yinda CK, Rouse KG, Gvozden C, Wever D, Yanez G, Anderson M, Yu S, Bearie B, Young S, Berry JD. Development and clinical performance of InteliSwab® COVID-19 rapid test: evaluation of antigen test for the diagnosis of SARS-CoV-2 and analytical sensitivity to detect variants of concern including omicron and subvariants. Viruses. 2024;16:61. doi: 10.3390/v16010061. [DOI] [PMC free article] [PubMed] [Google Scholar]
  13. Fujisawa M, Adachi Y, Onodera T, Shiwa-Sudo N, Iwata-Yoshikawa N, Nagata N, Suzuki T, Takeoka S, Takahashia Y. High-throughput isolation of SARS-CoV-2 nucleocapsid antibodies for improved antigen detection. Biochem Biophys Res Commun. 2023;673:114–120. doi: 10.1016/j.bbrc.2023.06.067. [DOI] [PMC free article] [PubMed] [Google Scholar]
  14. Funabashi R, Miyakawa K, Yamaoka Y, Yoshimura S, Yamane S, Jeremiah SS, Shimizu K, Ozawa H, Kawakami C, Usuku S, Tanaka N, Yamazaki E, Kimura H, Hasegawa H, Ryo A. Development of highly sensitive and rapid antigen detection assay for diagnosis of COVID-19 utilizing optical waveguide immunosensor. J Mol Cell Biol. 2021;13:763–766. doi: 10.1093/jmcb/mjab037. [DOI] [PMC free article] [PubMed] [Google Scholar]
  15. Gasteiger E, Hoogland C, Gattiker A, Duvaud S, Wilkins MR, Appel RD, Bairoch A. Protein identification and analysis tools on the ExPASy server. In: Walker JM, editor. The Proteomics protocols Handbook. Springer protocols handbooks. Totowa, NJ: Humana; 2005. pp. 571–607. [Google Scholar]
  16. Grifoni A, Sidney J, Zhang Y, Scheuermann RH, Peters B, Sette A. A sequence homology and bioinformatic approach can predict candidate targets for immune responses to SARS-CoV-2. Cell Host Microbe. 2020;27:671–680. doi: 10.1016/j.chom.2020.03.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  17. Harvey WT, Carabelli AM, Jackson B, Gupta RK, Thomson EC, Harrison EM, Ludden C, Reeve R, Rambaut A, COVID-19 Genomics UK (COG-UK) Consortium. Peacock SJ, Robertson DL. SARS-CoV-2 variants, spike mutations and immune escape. Nat Rev Microbiol. 2021;19:409–424. doi: 10.1038/s41579-021-00573-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
  18. He Y, Zhou Y, Wu H, Kou Z, Liu S, Jiang S. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus. J Clin Microbiol. 2004;42:5309–5314. doi: 10.1128/JCM.42.11.5309-5314.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  19. Humphrey W, Dalke A, Schulten K. VMD - visual Molecular Dynamics. J Molec Graphics. 1996;14:33–38. doi: 10.1016/0263-7855(96)00018-5. [DOI] [PubMed] [Google Scholar]
  20. Jespersen MC, Peters B, Nielsen M, Marcatili P. BepiPred-2.0: improving sequence-based B-cell epitope prediction using conformational epitopes. Nucleic Acids Res. 2017;45:W24–29. doi: 10.1093/nar/gkx346. [DOI] [PMC free article] [PubMed] [Google Scholar]
  21. Jian MJ, Chung HY, Chang CK, Lin JC, Yeh KM, Chen CW, Lin D-Y, Chang FY, Hung KS, Perng CL, Shanga HS. SARS-CoV-2 variants with T135I nucleocapsid mutations may affect antigen test performance. Int J Infect Dis. 2022;114:112–114. doi: 10.1016/j.ijid.2021.11.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  22. Juniastuti, Furqoni AH, Amin M, Restifan YD, Putri SMD, Ferandra VA, Lusida MI. The evaluation results of proposed antigen rapid diagnostic tests for COVID-19: some possible factors might influence. Infection. 2023;51:1285–1291. doi: 10.1007/s15010-022-01975-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
  23. Mohammad T, Choudhury A, Habib I, Asrani P, Mathur Y, Umair M, Anjum F, Shafie A, Yadav DK, Hassan MI. Genomic variations in the structural proteins of SARS-CoV-2 and their deleterious impact on pathogenesis: a comparative genomics approach. Front Cell Infect Microbiol. 2021;11:765039. doi: 10.3389/fcimb.2021.765039. [DOI] [PMC free article] [PubMed] [Google Scholar]
  24. Morinaga Y, Yamada H, Yoshida Y, Kawasuji H, Yamamoto Y. Analytical sensitivity of six lateral flow antigen test kits for variant strains of SARS-CoV-2. J Infect Chemother. 2023;29:131–135. doi: 10.1016/j.jiac.2022.10.004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  25. Naqvi AAT, Fatima K, Mohammad T, Fatima U, Singh IK, Singh A, Atif SA, Hariprasad G, Gulam Hasan M, Md Hassan I. Insights into SARS-CoV-2 genome, structure, evolution, pathogenesis and therapies: structural genomics approach. Biochem Biophys Acta– Mol Basis Dis. 2020;1866:165878. doi: 10.1016/j.bbadis.2020.165878. [DOI] [PMC free article] [PubMed] [Google Scholar]
  26. Nosrati M, Hajizade A, Nazarian S, Amani J, Namvar Vansofla A, Tarverdizadeh Y. Designing a multi-epitope vaccine for cross-protection against Shigella spp: an immunoinformatics and structural vaccinology study. Mol Immunol. 2019;116:106–116. doi: 10.1016/j.molimm.2019.09.018. [DOI] [PubMed] [Google Scholar]
  27. Obaidullah AJ, Alanazi MM, Alsaif NA, Albassam H, Almehizia AA, Alqahtani AM, Mahmud S, Sami SA, Emran TB. Immunoinformatics-guided design of a multi-epitope vaccine based on the structural proteins of severe acute respiratory syndrome coronavirus 2. RSC Adv. 2021;11:18103–18121. doi: 10.1039/d1ra02885e. [DOI] [PMC free article] [PubMed] [Google Scholar]
  28. Osterman A, Badell I, Basara E, Stern M, Kriesel F, Eletreby M, Oztan GN, Huber M, Autenrieth H, Knabe R, Spath PM, Muenchhoff M, Graf A, Krebs S, Blum H, Durner J, Czibere L, Dachert C, Kaderali L, Baldauf HM, Keppler OT. Impaired detection of Omicron by SARS-CoV-2 rapid antigen tests. Med Microbiol Immunol. 2022;211:105–117. doi: 10.1007/s00430-022-00730-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
  29. Rao A, Westbrook A, Bassit L, Parsons R, Fitts E, Greenleaf M, McLendon K, Sullivan JA, O’Sick W, Baugh T, Bowers HB, Frank F, Wang E, Le M, Frediani J, Roychoudhury P, Greninger AL, Jerris R, Pollock NR, Ortlund EA, Roback JD, Lam WA, Piantadosi A. Sensitivity of rapid antigen tests against SARS-CoV-2 omicron and delta variants and delta variants and delta variants. J Clin Microbiol. 2023;61:e0013823. doi: 10.1128/jcm.00138-23. [DOI] [PMC free article] [PubMed] [Google Scholar]
  30. Sambrook J, Russell DW (2001) Molecular Cloning: A Laboratory Manual. 3rd Edition; Cold Spring Harbor Laboratory Press, New York
  31. Samsunder N, Lustig G, Ngubane S, Maseko TG, Rambaran S, Ngcapu S, Magini SN, Lewis L, Cawood C, Kharsany ABM, Karim QA, Karim SA, Naidoo K, Sivro A. Field evaluations of four SARSCoV-2 rapid antigen tests during SARSCoV-2 Delta variant wave in South Africa. Diagn Prognostic Res. 2023;7:14. doi: 10.1186/s41512-023-00151-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
  32. Samsunder N, Lustig G, de Vos M, Ngcapu S, Giandhari J, Tshiabuila D, San EJ, Lewis L, Kharsany ABM, Cawood C, de Oliveira T, Karim QA, Karim SA, Escadafal C, Naidoo K, Sivro A. Performance of rapid antigen tests in identifying Omicron BA.4 and BA.5 infections in South Africa. J Clin Virol. 2023;165:105498. doi: 10.1016/j.jcv.2023.105498. [DOI] [PMC free article] [PubMed] [Google Scholar]
  33. Vidyasagar GVC, Reddy PVJ, Kumar S, Polipalli SK, Jaiswal RM, Venkateswarulu TC, Kavi Kishor PB, Prashanth S, Rathnagiri P (2023) Perspectives on rapid antigen tests for downstream validation and development of theranostics. In: Guest PC. (eds) Application of omic techniques to identify new biomarkers and drug targets for COVID-19. Adv Exp Med Biol vol. 1412. Springer, Cham. pp: 285–310 10.1007/978-3-031-28012-2_16 [DOI] [PubMed]
  34. Wagenhauser I, Knies K, Hofmann D, Rauschenberger V, Eisenmann M, Gabel A, Flemming S, Andres O, Petri N, Topp MS, Papsdorf M, McDonogh M, Verma-Führing R, Scherzad A, Zeller D, Böhm H, Gesierich A, Seitz AK, Kiderlen M, Gawlik M, Taurines R, Wurmb T, Ernestus RI, Forster J, Weismann D, Weibrich B, Dolken L, Liese J, Kaderali L, Kurzai O, Vogel U, Krone M. Virus variant specific clinical performance assessment of SARS-CoV-2 rapid antigen tests in point-of-care use from November 2020 to January 2022. Clin Microbiol Infect. 2023;29:225–232. doi: 10.1016/j.cmi.2022.08.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  35. Weishampel ZA, Young J, Fischl M, Fischer RJ, Donkor IO, Riopelle JC, Schulz JE, Port JR, Saturday TA, van Doremalen N, et al. OraSure InteliSwab™ rapid antigen test performance with the SARS-CoV-2 variants of concern—alpha, beta, gamma, delta, and omicron. Viruses. 2022;14:543. doi: 10.3390/v14030543. [DOI] [PMC free article] [PubMed] [Google Scholar]
  36. World Health Organization (2021) Antigen-Detection in the Diagnosis of SARS-CoV-2 Infection: Interim Guidance; World Health Organization: Geneva, Switzerland, https://apps.who.int/iris/handle/10665/345948. Accessed on 14 January, 2024
  37. World Health Organization. WHO COVID-19 dashboard (2023) https://data.who.int/dashboards/covid19/cases?n=c. Accessed on 14 January 2024
  38. Wu F, Zhao S, Yu B, Chen YM, Wang W, Song ZG, Hu Y, Tao ZW, Tian JH, Pei YY, Yuan ML, Zhang YL, Dai FH, Liu Y, Wang QM, Zheng JJ, Xu L, Holmes EC, Zhang YZ. A new coronavirus associated with human respiratory disease in China. Nature. 2020;579:265–269. doi: 10.1038/s41586-020-2008-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
  39. Yadegari H, Mohammadia M, Maghsooda F, Ghorbania A, Bahadoria T, Golsaz-Shirazia F, Zarnani AH, Salimi V, Jeddi-Tehrani M, Amiri MM, Shokri F. Diagnostic performance of a novel antigen-capture ELISA for the detection of SARS-CoV-2. Anal Biochem. 2023;666:115079. doi: 10.1016/j.ab.2023.115079. [DOI] [PMC free article] [PubMed] [Google Scholar]
  40. Yang J, Zhang Y. I-TASSER server: new development for protein structure and function predictions. Nucleic Acids Res. 2015;43:W174–181. doi: 10.1093/nar/gkv342. [DOI] [PMC free article] [PubMed] [Google Scholar]
  41. Zheng W, Zhang C, Li Y, Pearce R, Bell EW, Zhang Y. Folding non-homologous proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. Cell Rep Methods. 2021;1:100014. doi: 10.1016/j.crmeth.2021.100014. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Data Availability Statement

Data related to this manuscript are available with GVCVS and RP.


Articles from AMB Express are provided here courtesy of Springer-Verlag

RESOURCES