Abstract
Misprocessing of amyloid precursor protein (APP) is one of the major causes of Alzheimer’s disease. APP comprises a large extracellular region, a single transmembrane helix and a short cytoplasmic tail containing an NPxY motif (normally referred to as the YENPTY motif). Talins are synaptic scaffold proteins that connect the cytoskeletal machinery to the plasma membrane via binding NPxY motifs in the cytoplasmic tail of integrins. Here, we report the crystal structure of an APP/talin1 complex identifying a new way to couple the cytoskeletal machinery to synaptic sites through APP. Proximity ligation assay (PLA) confirmed the close proximity of talin1 and APP in primary neurons, and talin1 depletion had a dramatic effect on APP processing in cells. Structural modelling reveals APP might form an extracellular meshwork that mechanically couples the cytoskeletons of the pre- and post-synaptic compartments. We propose APP processing represents a mechanical signalling pathway whereby under tension, the cleavage sites in APP have varying accessibility to cleavage by secretases. This leads us to propose a new hypothesis for Alzheimer’s, where misregulated APP dynamics result in loss of the mechanical integrity of the synapse, corruption and loss of mechanical binary data, and excessive generation of toxic plaque-forming Aβ42 peptide.
Keywords: Alzheimer’s disease, TLN1, meshCODE, amyloid precursor protein, dementia, FERMT2
1. Introduction
Alzheimer’s disease (AD) is a leading cause of dementia, accounting for 60–80% of total dementia cases [1]. The worldwide cost of AD has been estimated to be approximately US$604 billion per year [2]. AD is characterized by the presence of amyloid plaques and tau tangles [1], which are taken into account in the National Institute of Aging and Alzheimer’s guidelines for patients with AD pathophysiology [3,4], including measures such as Braak neurofibrillary tangle stage [5–7], Thal phases of amyloid deposition [8] and the Consortium to Establish a Registry for Alzheimer Disease (CERAD) score of neuritic amyloid plaques [9]. The development of amyloid plaques occurs as a result of defects in the processing of amyloid precursor protein (APP) [10]. APP is expressed in most tissues but is most highly expressed in the brain [11]. Surprisingly, despite the extensive research effort to understand APP biology, the cellular roles of APP remain unclear, in part due to the shift in focus to the toxic species that forms the amyloid plaques in AD, amyloid-β (Aβ42), a 42-residue cleavage product of APP [12,13]. While APP’s roles are not yet fully understood, several functions have been identified including cell–cell adhesion, neurite outgrowth and synaptogenesis, cell migration, cell signalling and apoptosis [14].
1.1. Synaptic adhesion and mechanical signalling
Synapses represent the perfect system for the discrete transfer of information between two cells. To enable precision in this information transfer, the synaptic boutons are connected by a complex network of scaffolding molecules. This scaffolding is anchored in two ways, by cell–cell adhesions, and through connections between the cell and the surrounding meshwork of proteins called the extracellular matrix (ECM) [15,16]. Many synaptic cell adhesion molecules exist that connect the two synaptic boutons to the ECM. These adhesion complexes are coupled to the intracellular cytoskeletal machinery through adapter proteins and large signalling complexes assemble on these linkages. In synapses, these cell–cell and cell–matrix couplings are incredibly complex, involving many proteins that ensure a perfectly tuned connection for efficient neuronal signalling [17,18].
1.2. The MeshCODE theory and the role of talin in mechanical signalling
One major family of ECM receptors are the integrins [19], which are essential for the formation of synapses [20–23]. Large mechanical signalling machinery, known as integrin adhesion complexes, assemble on the short cytoplasmic tail of integrins. Stable adhesions require cytoskeletal connectivity and provide a mechanosensitive coupling that instructs the cell how to behave in the context of the local environment. The central adapter that connects integrins to the actin cytoskeleton is the protein talin, which contains 13 helical bundles that behave as force-dependent binary switch domains [24,25]. Each switch can be converted between folded ‘0’ and unfolded ‘1’ states by small changes in contractility that can be generated by the cell’s motor proteins. The presence of binary switches in the synaptic scaffolds led to the idea that information can be written into the switch patterns of the scaffolds, representing a meshwork code, described in the MeshCODE theory [26,27]. In this theory, these switch patterns represent a binary code the cell uses to spatially organize the enzymatic processes in the synapse to coordinate synaptic activity [28,29]. Currently, the role of talin in synaptic regulation and memory is not well studied, however, the role of talin in mechanical memory in other systems has been demonstrated experimentally [30,31].
1.3. APP and integrin adhesion complexes
APP co-localizes with integrins and loss of APP has been shown to result in decreased β1 and β3-integrin expression [32–34]. APP has also been shown to colocalize with talin [35] and talin2 has been implicated in AD previously [36]. Furthermore, mechanotransduction downstream of integrins has also been linked to AD [37]. More recently, genome-wide association studies (GWAS) cast focal adhesion (FA) proteins in a central role in AD pathology [38,39], and knockdown of FA proteins significantly perturbs APP processing [40]. Kindlin2 (FERMT2), a key co-regulator of integrin activity with talin, was shown to be a major modulator of APP metabolism [40].
APP is an integral membrane protein that contains a large extracellular region comprised of an N-terminal E1 domain, a Kunitz-type protease inhibitor (KPI) domain, an E2 domain, connected to a single transmembrane helix (TMH) (figure 1). The linker length between the E2 and TMH is invariant in length in all isoforms, approximately 34 nm (figure 1b). Intracellularly, APP is comprised of a short cytoplasmic tail, sometimes referred to as the APP intracellular domain (AICD), which contains a completely conserved NPxY motif [41], more commonly referred to as the YENPTY motif. APP is shown drawn to scale in figure 1d,e, we show isoform APP770 as it contains all the APP domains, however APP695, the alternatively spliced, neuronal-specific isoform, lacks the KPI domain [42,43].
The presence of an NPxY motif in APP, coupled with the published data on the role of integrin adhesion complexes in APP processing [38,39] prompted us to analyse whether talin and APP might interact. In our previous work on the role of talin in the synapse, we undertook an in-depth structural analysis of the talin protein and its interactions, drawing these molecules ‘to scale’ [29]. Here, we carried out a similar structural analysis of APP and its interactions. We harnessed the published structural data on APP in the Protein Database and coupled it to the structural models in the AlphaFold database [44,45]. This analysis, coupled with the crystal structure of the APP NPxY motif bound to talin, leads us to propose a new role for APP as a mechanocoupler, connecting the cytoskeletal force-generation machinery of the two sides of the synapse. This leads to a novel hypothesis for a mechanical basis of APP processing, and a new theory for memory loss in AD, caused by the loss of binary information written into the shapes of the talin molecules scaffolding each synapse as the mechanical homeostasis of the synapse is lost. As such, the scientific framework outlined, provides a new direction for AD research and treatment.
2. Results
2.1. The NPxY motif in the cytoplasmic tail of APP binds to talin
The presence of an NPxY motif in the cytoplasmic tail of APP indicated that it would bind to FERM (four-point-one, ezrin, radixin, moesin) domain-containing proteins. Sequence alignment of the NPxY motif of APP with those from β1A, β1D and β3 integrin confirmed the sequence homology that also extends to the membrane-proximal part of the cytoplasmic tail (figure 1f).
Talin is a large and complex protein comprised of 18 domains (figure 2a,b) with the F3 subdomain of the talin head binding to the NPxY motif of the β-integrin subunit [46,47]. To test whether the APP NPxY motif might also interact with talin F3 we used nuclear magnetic resonance (NMR) where 15N-labelled talin F3 was titrated with synthetic peptides of the APP cytoplasmic tail (residues 732–770), either wildtype or a mutated version where the NPTY residues were replaced with four alanine residues, hereafter called APP (4A) peptide. Addition of wildtype APP peptide resulted in chemical shift changes in the spectra of F3 of both talin1 (figure 2c; electronic supplementary material, figure S1) and talin2 (figure 2d; electronic supplementary material, figure S2), which mapped onto the β-integrin binding site (figure 2i) confirming that the APP peptide binds in the NPxY-binding pocket on talin F3, as expected. Minimal chemical shift changes were observed on addition of the APP(4A) peptide confirming that the interaction is NPxY-dependent (figure 2e,f).
We next measured the binding affinity of APP to talin using a fluorescence polarization assay. In this assay, the APP and APP (4A) peptides are fluorescently tagged by covalently coupling a fluorescein-maleimide to a non-native terminal cysteine and titrated with both talin1 and talin2 F2F3 domains. This confirmed that (i) both talin isoforms bind to APP and (ii) the interaction is specific but weak (figure 2g,h) as expected since talin also binds weakly to the NPxY motif of the β-integrin cytoplasmic tail in solution (with Kd in the range of 100–1000 µM) ([46–48]). However, the interaction between talin and integrin is enhanced more than 1000-fold by the presence of negatively charged phospholipids [49] due to the tripartite interaction between talin, integrin and negatively charged phospholipid headgroups. Similarly, it is likely that the interactions between the positively charged residues on the talin head domain and negatively charged phospholipids also enhance the interaction of APP and talin.
2.2. The crystal structure of talin1 F2F3 bound to the APP cytoplasmic domain
Early structural insights into the talin–integrin interaction came from crystal structures of a chimeric fusion of the talin F2F3 domains and the β3-integrin tail [48]. Using the design strategy of the β3 (739–749)-talin (209–400) chimera [48], we generated an APP (754–764)-talin (209–400) chimera, hereafter called the APP-talin chimera (electronic supplementary material Fig.3A). The APP-talin chimera crystals were birefringent flat plates (electronic supplementary material Fig.3B) belonging to space group P212121, which diffracted to 2.7 Å. The structure of the APP-talin chimera was solved by molecular replacement using the F2F3 domains (PDB ID: 1MIX [48]) as a search model with a single copy in the asymmetric unit. In contrast to the β3-integrin-talin chimera, which adopted a homodimeric arrangement in the asymmetric unit mediated by reciprocal F3-NPxY interactions of the two fusion proteins, the APP-talin chimera showed a ‘daisy chain’ style arrangement where each APP tail interacted with the F3 domain of a symmetry-related molecule (electronic supplementary material, Fig.3C). The NPTY was well resolved in the density (electronic supplementary material, Fig.3D) and closer inspection confirmed that the NPxY motif of the APP was binding canonically in the NPxY motif binding site on talin F3 (figure 2i,j). The chemical shift changes upon addition of APP peptide in the NMR data precisely map onto the APP-interacting surface on F3 (figure 2i).
2.3. Structural modelling of APP as a synaptic cell adhesion molecule
The identification of a direct coupling between APP and the cytoskeleton, mediated through interaction with talin, supported an adhesion role for APP. Therefore, we next sought to explore the role of APP as a synaptic cell adhesion molecule. To do this, we combined the known atomic structures of APP domains [50–52] with the AlphaFold model of the full-length APP to visualize the unstructured elements. As is visible in figure 1, much of APP is unstructured, with intrinsically disordered regions connecting the folded globular domains. Both extracellular domains 1 and 2 (E1 and E2) have been shown to homodimerize, and crystal structures of the E1 homodimer (figure 3b; PDB ID: 4JFN [50] and PDB ID: 3KTM [52]), and E2 homodimer (figure 3c; PDB ID: 3NYL [51]) have been solved. We used these known dimerization structures to superimpose four full-length APP structural models so as to orientate them based on the structural constraints of dimerization. This combination of structural data with structural modelling immediately indicated a structural basis for how cis- (electronic supplementary material, figure 4A,B) and trans-APP-mediated (electronic supplementary material, figure 4C,D) couplings would work together to enable APP to serve as a synaptic adhesion molecule connecting the pre- and post-synaptic membranes (figure 3d).
What is striking about this arrangement is that it represents an extracellular protein meshwork, composed of APP, connecting the adjoining cells across the synaptic cleft. This arrangement resembles a hybrid of an ECM meshwork and a cell–cell junction, but one that is built by the two cells’ surface receptors. In essence, APP forms a hybrid cell–cell/cell–ECM coupling between cells. We note that the tetrameric APP arrangement shown in figure 3 also indicates a mechanism for the formation of higher order species through the flailing, undimerised E1 domains so further oligomerization of APP will likely occur forming a substantial meshwork between cells.
2.4. Talin is in close proximity to APP in synapses
Next, we sought to investigate the APP/talin interaction in cellular models. First, by performing synaptosomal fractionations from primary neuronal cultures, we confirmed the presence of talin in both the pre- and post-synaptic compartments (figure 3e). Next, we developed a proximity ligation assay (PLA) able to detect potential APP/talin complexes using antibodies that recognize APP and talin. To do so, we used a HEK293 cell line stably over-expressing APP695WT (HEK293-APP695WT) and we observed a strong PLA signal (figure 3f). Of note, no PLA spot was observed when performing the same protocol but without the talin antibody (electronic supplementary material, figure 5). Moreover, to validate the specificity of PLA signal, HEK293-APP695WT were transfected with siRNA allowing the silencing of APP or talin. Both siRNA transfections resulted in a robust decrease in the number of PLA dots supporting the specificity of the PLA APP/talin signal (figure 3g). Next, PLA was performed on primary neuronal cultures to address the localization of PLA APP/talin signal in neuronal context. For this purpose, PLA experiments were performed in association with standard immunofluorescence (IF) staining to visualize the synaptic marker, Homer. This proximity between PLA APP/talin and Homer staining supports the potential interaction of APP and talin at the synapse (figure 3h).
2.5. Structural modelling of APP as a synaptic adhesion molecule connecting the talin cytoskeletal connection to the synaptic junction
In integrins, NPxY motifs represent the foundations on which the cytoskeletal mechanosensory machinery assembles. Talin and kindlin bind to these anchor points and connect them to the actin and microtubule cytoskeletons. As shown in figures 3 and 4, electronic supplementary material, videos 1 and 2, four APP molecules that are dimerized in cis and trans clearly connect the two membranes together, precisely positioning two NPxY motifs in each of the pre- and post-synaptic compartments. In these figures for simplicity, we do not draw, or model, integrin or kindlin, even though it is likely that both are involved in the mechanocoupling of APP to the cells’ force-generation machinery via talin (figure 4).
Our analysis indicates a novel role for APP as a mechanocoupler, providing a physical means of synchronization of the pre- and post-synaptic force-generation machineries. In this arrangement, APP would be playing a central role in maintaining mechanical homeostasis, since forces generated across the synapse would be experienced by the APP mechanocoupling. This also indicates a mechanical basis for how and why APP can be differentially processed (and misprocessed) by being cleaved at subtly different positions. APP would be under varying amounts of tension and as such differential processing of APP would provide a mechanism for the cells to sense and respond accordingly to maintain mechanical homeostasis.
2.6. Talin1 depletion dramatically alters APP processing in cells
Since synaptic dysfunction and loss is one of the very early hallmarks of AD correlating with the earliest cognitive decline, we investigated the potential impact of talin1 expression level on APP processing. The processing of APP is complex and involves sequential enzymatic cleavage through enzymes referred to as secretases, which are located in both the interior and exterior compartments of the neuron [53]. In addition, the identification of familial, AD-linked mutations in the genes for APP and presenilin (PSEN1 and PSEN2) associated with dysregulation of Aβ peptide production suggests that APP processing is at the heart of the disease process. In this context, intense research has focused on exploring which proteins impact APP metabolism, and many proteins have been shown to alter the dynamic process of APP processing. We previously used a genome-wide, high-content siRNA screening approach to measure the effect of depletion of each protein in the human proteome on APP metabolism [40]. Talin1 and kindlin2 were among the top 5% of hits showing the strongest variations on APP metabolism (figure 5a). This approach uses a rapid detection and quantification of intracellular APP fragments in HEK293 cells stably over-expressing a mCherry-APP695WT-YFP (figure 5b). Talin1 silencing was associated with a significant increase in both mCherry and YFP fluorescence levels. Of note, the effects were similar to those observed after kindlin2 silencing [40].
Next, we investigated the impact of talin1 silencing on APP processing in HEK293-APP695WT in absence of mCherry and YFP tags using conventional approaches to quantify the main byproducts of APP. Upon talin1 silencing, we observed a strong increase in mature APP levels and the accumulation of all the APP-derived substrates for α-, β- and γ-secretases (CTFα and CTFβ intracellular C-terminal fragments of APP produced, respectively, by α- and β-secretases, as well as Aβ secretions) (figure 5c–e). Overall, our results support the involvement of talin expression level in the regulation of APP processing.
3. Discussion
Here, we present evidence of a direct coupling between APP and talin, identifying a new mechanism for connecting the mechanosensitive force-generating machinery to the synaptic junction. In a correctly functioning connection, we propose that this coupling would serve as a force feedback mechanism that works to mechanically synchronize the two sides of the synapse ensuring mechanical homeostasis (figure 6). The coupling between APP and the mechanical switches in talin offers several new testable hypotheses regarding the mechanical functioning of synapses and memory storage and how defects in this mechanocoupling can lead to AD. We present this discussion section as a series of six testable hypotheses that emerge from this new discovery.
3.1. Hypothesis 1: APP forms an extracellular meshwork that mechanically couples the two sides of the synapse
Drawing APP molecules to scale and integrating all the known structural elements provides a striking new view of APP’s role as a synaptic adhesion molecule that oligomerizes to form an extracellular meshwork that directly couples the mechanosensitive machinery on both sides of the synapse (figure 6). Our previous structural analysis of talin and vinculin in the synaptic scaffolds demonstrated the power of visualizing the dimensions of synaptic proteins to scale [29]. AlphaFold structural models are very useful in this regard as they include the disordered regions of proteins that are often overlooked, thus enabling us to precisely model these complexes and the dimensions of the cytoskeletal linkages (figure 4).
The mechanosensitive machinery of the cell is coupled to the plasma membrane through talin binding to the NPxY motif of integrins. The crystal structure of the NPxY motif of APP bound to talin identifies the APP cytoplasmic tail as a second attachment site for talin to engage, with the potential to forge similar cytoskeletal connections at the synaptic junction (figure 6). APP has previously been shown to bind to kindlin2 [38,39] and extracellularly to β1- and α3-integrins [54,55]. Both talin and kindlin2 are FERM domain-containing proteins and both bind to NPxY motifs on the integrin tail. Furthermore, talin also binds to kindlin2 [56]. So, there is substantial evidence of the role of APP in cell adhesion functions, but also of a role for cell adhesion proteins in the regulation of APP processing [38,39]. We propose that the tight interplay between cell adhesion and APP oligomerization defines APP as a mechanocoupler, linking the cytoskeletal machineries on both sides of the synapse (figure 6). Many FA proteins are genetic risk factors for APP processing. However, while talin is not in the GWAS for AD risk factors, many talin binding partners and FA regulatory components are [38,39]. It is likely that talin is less tolerant to variants as a result of its central role in mechanical computation in all cells.
3.2. Hypothesis 2: APP processing is a mechanical signalling pathway that synchronizes the synapse to ensure mechanical homeostasis
The formation of an APP-mediated mechanical coupling between the two sides of the synapse immediately indicates that APP processing will be affected by tension on APP, literally pulling/pushing the APP extracellular regions relative to the membrane-anchored secretases. In this way, we propose that APP’s role in neuronal function is to orchestrate a mechanically regulated signalling pathway, whereby altered tension on the synapse leads to differential APP processing and cellular signals on both sides of the synapse that re-establish mechanical homeostasis. Disruption of the tension on APP would provide a mechanism for the relative position shift that is key to APP misprocessing and toxic species formation.
The concept of mechanical regulation of proteolytic processing of signalling proteins is established in the case of Notch signalling [57]. Notch serves as a mechanical signalling system, where protein cleavage is the signalling output [58]. The Notch ligands are typically membrane proteins on adjacent cells. In the case of APP, the ligands are other APP molecules on the adjacent cell at the synaptic junction. It is likely that APP and its homologues APLP1 and APLP2 represent a family of cell surface mechanical receptors. APP processing would therefore provide an essential signalling function in maintaining the mechanical integrity of the synapse. Thus, APP processing would ensure each synapse represents a perfect, isolated mechanical system which is essential if mechanical signals are to be transmitted with high fidelity as required for a mechanical basis of memory as proposed by the MeshCODE theory [26].
We show that talin depletion dramatically alters APP processing in cells (figure 5) supporting the role of mechanical signals in APP processing. Previous experimental evidence in support of talin’s role in APP processing includes the following findings: (i) APP immunoreactivity is co-localized with talin immunoreactivity in primary rat neuronal cultures, including hippocampal, cortical and cerebellar tissues [35]; (ii) talin2 has been implicated in AD [36]; and (iii) talin has been linked to APP both in mouse models of AD [59] and in platelets of patients with AD [60].
3.3. Hypothesis 3: a mechanical basis of AD—altered mechanical cues lead to misprocessing of APP which leads to the devastating consequences of AD
Visualizing APP processing to scale (figure 6) led to our hypothesis that the mechanical couplings through the cytoskeletal-talin-APP connection are regulating the spatial positioning of the APP substrate relative to the secretase APP-processing machinery. This provides a way to mechanically synchronize the two boutons during development and healthy neuronal function, but excess or misprocessing would be deleterious. During synaptogenesis and synapse maintenance, this coupling of mechanics and intracellular signalling would synchronize the two connecting cells and allow the precise mechanical couplings to form.
What is striking is how modest the changes are in processing between healthy and toxic states, a 40-residue fragment is relatively benign, but a 42-residue fragment is toxic. This subtle, two-amino acid change in where γ-secretase cuts has huge ramifications for the system. As the β- and γ-secretases are positioned in the membrane, their active sites are relatively fixed and spatially restricted. We therefore propose a mechanical aspect to APP processing whereby tension on APP alters the position of the APP relative to the active site of the secretases leading to alternate processing. Altered mechanical inputs due to altered APP tension would be the cause of the two amino acid shift (7 Å) misprocessing.
3.4. Hypothesis 4: loss of memory in AD is a result of corruption of the binary coding within the synapses leading to loss of information
The importance of APP in the development of AD is well established, and misregulated APP processing, leading to neuro-toxic fragments, is widely studied. However, the precise mechanisms behind the memory loss in AD are not fully understood, although the death of synapses is clearly a factor [61]. Our analysis indicates that APP is critical for ensuring mechanical homeostasis, as its processing ensures the two connected neurons at a synapse are mechanically synchronized and able to transmit mechanical signals with high fidelity. This identifies a basis for a direct coupling of APP to the cell’s mechanical computation machinery. We previously proposed the MeshCODE theory of a mechanical basis of memory. This theory is based on the realization that talin is comprised of binary switch domains that are operated by small changes in mechanical force. The 13 binary switches in talin present a way for information to be written into the synaptic scaffolds [26]. If, across the entire synapse and the whole neural network, these structural states are forming a binary coding that encodes information in the form of memories, then mechanical dyshomeostasis leading to the MeshCODE being corrupted would be a consequence of perturbed APP processing (figure 7).
This leads us to propose that the memory loss in AD comes as the information written in each synapse is lost and they start to desynchronize. AD leads not just to decoupling the synapse at the synapse level, but also relative to the circuit that synapse is part of. Amyloid plaques can appear up to 20 years before detectable cognitive defects [61], which might indicate that there is considerable redundancy in memory storage structures in the brain. For a while, the redundancy in memory storage would be able to compensate for this corruption of parts of the disk until the loss of information becomes overwhelming.
3.5. Hypothesis 5: the spread of AD pathology is due to the collapse of mechanical homeostasis that propagates through the networks
What is striking about AD pathology is that it spreads from foci, and then propagates through the circuits across the brain. One question is why/how does it spread? Formation of Aβ42 or spread of tau seeds has been presented as possible answers to this question. Here, we propose the alternative explanation that the spreading is a result of the slow collapse of the mechanical synchronization of the brain.
When forces act on the synapse in healthy neurons, the APP-processing mechanical feedback systems described here will work to re-establish mechanical homeostasis. However, if the feedback system itself is defective then loss of homeostasis will be persistent and will impact on both connected neurons. If the patient is already primed towards AD (either by mutations in the secretases, or in the FA proteins that stabilize the synaptic junction along with APP), then any perturbation in mechanics will trigger improper APP processing at other synapses in the neurons. In this way, it would be the loss of mechanical homeostasis and the shockwave-like spread of it from the initial foci(s) that would be why AD spreads across the brain. This idea is supported by the existence of AD-causing presenilin mutations that counter-intuitively limit the cleavage of APP and hence reduce APP processing [62,63]. However, these mutations still give rise to AD, fitting with the idea that this is due to defective force feedback signalling, with the result being that they also accelerate mechanical dyshomeostasis. Functional spreading of AD, whereby as neurons become compromised they then compromise the integrity of neurons in adjoining areas has been reported [64] and the spread of mechanical dyshomeostasis identified here provides an explanation for this phenomenon.
3.6. Hypothesis 6: it might be possible to repurpose drugs that stabilize focal adhesions to slow down the spread of AD
Hypothesis 5 indicates that if an individual is not predisposed to AD, then the robust APP-processing mechanical signalling pathway is able to maintain and re-establish mechanical homeostasis following each mechanical perturbation. However, disruption of this intimate coupling of the synapse, either through excess tension, mutations that destabilize this coupling, or other means would alter the availability of cleavage sites in APP leading to altered processing.
What is striking is that many of the GWAS risk factors identified for AD are in FA proteins or cytoskeletal regulators of FAs [38,40], indicating that a loss of adhesion integrity or stability contributes to AD progression. Similarly, APP knockdown has been reported to impact on FA stability [33] further supporting the idea that the stability and integrity of these adhesion complexes are critical for healthy brain function. The identified risk factors in GWAS include Src, Rac, Rho, kindlin2 and paxillin, which are all known to modulate FA dynamics [38] and regulate FA stability. These mutations that impact on the mechanical attachments of the cytoskeleton to the synapse are genetically linked to AD, making it reasonable to assume that perturbations in the mechanics of the synaptic junctions are drivers of AD. It might be imagined that such destabilized FA1 connections lead to defective mechanics and as a result, aberrant APP processing and reduced capacity for correction and re-establishment of homeostasis. Furthermore, on a systems level, if the cytoskeletal connections to the synapse are defective, then this would accelerate the spread of the dyshomeostasis, as the impaired connections would result in aberrant APP processing at each synaptic connection as they fail to recover mechanical homeostasis.
This leads to Hypothesis 6, that therapeutic interventions that stabilize FAs in other cell types might represent a new approach to slowing the spread of AD. If destabilization of FA dynamics in the synapse can be shown to be a driver of accelerated AD progression, it follows that stabilization of FAs through pharmaceutical means might present a novel therapeutic opportunity for slowing the spread of AD and thus delaying the onset of symptoms. Thus, we propose that it might be possible to repurpose already available, Food and Drug Administration (FDA)-approved drugs and pharmaceutical agents that stabilize FAs for use in AD to slow down the spread of AD through the brain. There are many such drugs already in existence that target effectors of FA dynamics. For example, (i) focal adhesion kinase (FAK) inhibitors—FAK activity is shown to lead to adhesion turnover, so suppressing FAK would be one option, (ii) Rho activators—increase activation to increase actomyosin contractility which has been shown to stabilize FAs, (iii) integrin activators—many compounds and antibody strategies exist for enhancing integrin activation, in doing so these stabilize FAs. (iv) microtubule disruptors—in cultured cells, microtubule targeting of FAs can lead to the turnover of FAs, therefore, reducing microtubule-dependent FA turnover would stabilize FAs.
4. Summary
Here, we present six novel hypotheses for the role of APP in healthy neuronal activity and its misprocessing and memory loss in AD.
4.1. Hypotheses
Hypothesis 1: APP forms an extracellular meshwork that mechanically couples the two sides of the synapse.
Hypothesis 2: APP processing is a mechanical signalling pathway that synchronizes the synapse to ensure mechanical homeostasis.
Hypothesis 3: A mechanical basis of AD—altered mechanical cues lead to misprocessing of APP which leads to the devastating consequences of AD.
Hypothesis 4: Loss of memory is a result of corruption of the binary coding within the synapse.
Hypothesis 5: The spread of AD is due to the collapse of mechanical homeostasis that propagates through the networks.
Hypothesis 6: It might be possible to repurpose drugs that help stabilize focal adhesions to slow down the spread of AD.
Finally, we note two additional points: (i) APP expression is not exclusive to neurons and is found in all cells; and (ii) in evolutionary terms, APP-like proteins preceded synapses by millions of years (as did talin). As such, the coupling of APP processing to the mechanical computation machinery we identify here may be playing a more global role in maintaining mechanical synchronization of cells and possibly represents a force feedback signalling mechanism in all animal cells.
4.2. Limitations of this study
Here, we present evidence of a direct link between talin and APP which points to a completely new view of AD and the role of APP as a signalling pathway. In biochemical assays in solution the interaction is relatively weak, however, it is specific and can be perturbed by targeted mutations. With the multivalency and contributions from the membrane and numerous other factors, the linkage will be much tighter in cells, as it is for the talin–integrin connection. It might also be that talin–kindlin–integrin–APP represents the stable complex.
5. Material and methods
5.1. DNA constructs
Talin1 F3, talin1 F2F3, talin2 F3 and talin2 F2F3 constructs were as described previously [46]. The chimera was designed based upon the strategy and crystallized structure of integrin β3-talin (PDB ID: 1MK7) [48] in which the intracellular domain of APP (QNGYENPTYKF) was fused to the N-terminus of talin1 F2F3. The APP-talin chimeric construct fused APP residues 754–764 with talin residues 209–400 to generate an APP(754–764)-talin(209–400) chimera. This sequence was ordered from GeneArt as a codon-optimized synthetic gene (APP-F2F3) in the pet151 expression vector.
5.2. Protein expression and purification
Talin1 F3, talin1 F2F3, talin2 F3, talin2 F2F3 and APP-F2F3 chimera constructs were expressed in BL21(DE3) E. coli cells. Cells were harvested and stored at −80°C in lysis buffer (50 mM Tris pH 8.0, 250 mM NaCl). Proteins were purified using previously described methods [67]. Succinctly, the cells were lysed by sonication and the soluble fraction was loaded onto a 5 ml HisTrap HP column (Cytiva), then eluted across a 15-column volume (CV) linear imidazole gradient. Protein was dialysed overnight in 20 mM sodium phosphate pH 6.5, 50 mM NaCl with TEV protease (AcTEV; Thermo Fisher) added to remove the His-tag. All proteins except talin2 F3 were further purified by cation-exchange chromatography using a 5 ml HiTrap SP HP column (Cytiva) and eluted across a 15 CV linear NaCl gradient. Talin2 F3 was further purified by anion-exchange using a 5 ml HiTrap Q column. Proteins were dialysed against PBS pH 7.4, concentrated, flash frozen in LN2 and stored at −80°C.
5.3. Fluorescence polarization assay
Peptides containing a non-native N-terminal cysteine were synthesized by GLBiochem (Shanghai): APP (732–770) C-HHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN, APP (732–770)−4A C-HHGVVEVDAAVTPEERHLSKMQQNGYEAAAAKFFEQMQN. Integrin Beta1A (752–798) CKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK and KANK1-(30–60) 4A PYFVETPYGFQAAAAFVKYVDDIQKGNTIKKLNIQKRRKC peptides were as described previously [68]. Peptides were labelled with a maleimide-fluorescein dye (Thermo Fisher) following the manufacturer’s protocol.
Assays were performed in PBS pH 7.4, 0.01% v/v Tween−20, in triplicate with 500 nM peptide and a two-fold serial dilution of protein. Fluorescence polarization was measured using a CLARIOstar plate reader (BMG LABTECH) at 25°C (excitation: 482 ± 8 nm; emission: 530 ± 20 nm). Data were analysed using GraphPad Prism 8 software and Kd values were generated using a single-site total binding model.
5.4. Nuclear magnetic resonance binding studies
For NMR binding studies, cells were grown in 15N-labelled 2M9 minimal media (850 ml Milli-Q water, 100 ml 10x M9 salts, 1 ml 0.1 M CaCl2, 1 ml of 1 M MgSO4, 10 ml BME vitamin solution (Sigma-Aldrich), 4 g glucose, 1 g 15N-labelled ammonium chloride per litre and 100 µg ml−1 ampicillin). 15N-labelled protein samples were prepared at 150 µM final concentration in 20 mM phosphate buffer pH 6.5, 50 mM NaCl, 2 mM dithiothreitol (DTT), 5% (v/v) D2O and titrated with APP(732–770) peptide. NMR spectra were collected at 298 K on a Bruker Avance III 600 MHz NMR spectrometer equipped with Cryoprobe. All data were processed using TopSpin and analysed with CCPN Analysis [69].
5.5. Crystallization, X-ray crystallography and structural determination
The APP-talin1 (F2F3) chimera was crystallized using hanging-drop vapour diffusion. Sparse-matrix crystallization trials were set up using a Mosquito LCP (TTP LabTech) with 100 nl protein at 10 mg ml−1 mixed with 100 nl mother liquor and stored at 20°C. Microcrystals formed in 0.1 M tris pH 8.5, 20% v/v ethanol, which were manually optimized for pH, ethanol and protein concentration in 2 µl hanging drops with a 1:1 protein to mother liquor ratio. Crystals formed at 6 mg ml−1 protein in 0.1 M tris pH 8.5, 10% v/v ethanol at 18°C and were harvested by transferring the crystal to fresh crystallization solution supplemented with 40% v/v glycerol and cryocooled in LN2.
The crystals belong to the space group P212121 with a single copy of the APP-talin1 (F2F3) chimera in the asymmetric unit (AU). X-ray diffraction data were collected at 100 K on the I04 beamline at Diamond Light Source (Didcot, UK). The data were moderately anisotropic and were processed using Xia2/DIALS [70–73]. The structure was solved by molecular replacement with PHASER [74] using the talin(F2F3) domains as a search model (PDB ID: 1MIX [48]). After initial placement, there was an obvious difference in density at the N-terminus corresponding to the APP. The model was completed through iterative rounds of model building in COOT [75] and reciprocal space refinement using PHENIX [76,77].
The final model comprises residues 209–400 of talin1 (F2F3), with residues K322 and N323 missing from the loop in F3 that connects β1 and β2. The mainchain density for the APP (754–764) is well defined and the side chains for N759–F764 (including the NPxY motif) could be unambiguously placed. The model was refined to an Rwork/Rfree of 21.1/26.7 and has good geometry as determined by MolProbity [78], with 95% of residues in the preferred region of the Ramachandran plot, 5% in the additionally allowed region and a single outlier. Details of the crystal parameters, data collection, processing and refinement statistics are shown in electronic supplementary material, table S1. The coordinates and structure factors were deposited in the PDB with accession code 8S4Y.
5.6. Structural modelling
The predicted AlphaFold 2.0 structural models of APP770 (UniProt ID: P05067-1), APP751 (UniProt ID: P05067-4), APP695 (UniProt: P05067-8) were obtained from the AlphaFold Protein Structure Database [44,45]. The atomic structures used in this study were;
3NYL: crystal structure of the E2 dimer of APP [51]
3KTM: crystal structure of the heparin-induced E1 dimer of APP [52]
4JFN: crystal structure of the N-terminal, growth factor-like domain of the amyloid precursor protein bound to copper [50]
6R9T: CryoEM structure of full-length talin1 [79]
To visualize the APP structures in the context of a plasma membrane, we used a previously modelled 1,2-dioleoyl-sn-glycero-3-phosphocholine lipid membrane PDB file [80].
5.7. Primary neuronal cultures
Culture media and supplements were from Thermo Fisher, unless otherwise stated. Cortical neurons were dissected from E14–E15 mice. Briefly, cortices were isolated from E14–E15 mice in ice-cold dissection medium (Hank’s balanced salt solution supplemented with 10 mM HEPES, 1 mM sodium pyruvate, 10 mM glucose, and penicillin/streptomycin) and trypsinized at 37°C for 30 min (Trypsin solution, T4549, Sigma). DNase I was added to the trypsin-incubated tissue suspension to break down DNA and to avoid clumping of tissue during the subsequent trituration (DN25, Sigma). Trypsin was inactivated by the addition of isolation medium (Neurobasal medium supplemented with 10% heat-inactivated fetal bovine serum, 1% GlutaMAX, 20 mM Hepes and Gentamycin). The cell suspension was passed through a 100 µm then 70 µm cell strainer followed by two centrifugations (0.3g for 10 min). Cells were resuspended in culture medium composed of MACS Neuro Medium (130-093-570) supplemented with 0.25% GlutaMAX, 2% MACS NeuroBrew-21 (130-093-566) and Gentamycin and counted.
5.8. Synaptosome extraction
To verify the presence of proteins at the synaptic level, we did a subcellular fractionation as previously described [39]. Briefly, cortical neurons were resuspended in 0.32 M sucrose and 10 mM HEPES, pH 7.4 and centrifuged at 1000g for 10 min to remove nuclei and debris. The supernatant was centrifuged at 12 000g for 20 min to remove the cytosolic fraction. The pellet was resuspended in 4 mM HEPES, 1 mM ethylenediaminetetraacetic acid (EDTA), pH 7.4 and was centrifuged two times at 12 000g for 20 min. The new pellet was resuspended in 20 mM HEPES, 100 mM NaCl, 0.5% Triton X-100, pH 7.2 for 1 h at 4°C and centrifuged at 12 000g for 20 min. The collected supernatant corresponds to the non-PSD fraction (triton-soluble). The remaining pellet was resuspended in 20 mM HEPES, 0.15 mM NaCl, 1% triton X-100, 1% deoxycholic acid, 1% SDS, pH 7.5 for 1 h at 4°C and centrifuged at 10 000g for 15 min to obtain a supernatant containing the PSD fraction (triton-insoluble). The different fractions were then analysed by WB.
5.9. Cell culture and transfection
Human embryonic kidney (HEK) 293 cells were cultured in 1:1 mixture of Dulbecco’s Modified Eagle Medium and Ham’s F12 nutrient mixture (DMEM-F12, 21331020, Thermo Fisher Scientific) supplemented with 10% heat-inactivated fetal bovine serum (10270106, Gibco), 2 mM L-glutamine (25030149, Thermo Fisher) and 50 IU ml−1 penicillin/streptomycin (15140122, Thermo Fisher) at 37°C in a humidified atmosphere with 5% CO2. Prior to transfection, cells were plated at a density of approximately 70%. For siRNA transfection, we used Dharmacon siRNA, non-targeting (D0018100105) and siTalin1 (L-012949-00-0005) and Lipofectamine RNAiMAX (13778150, Thermo Fisher Scientific) was used as transfection reagent according to the manufacturer’s instructions. Cell line was tested negative for mycoplasma contamination using PCR test (Venor GeM OneStep, Minerva Biolabs).
5.10. Immunofluorescence
Cells were fixed in 4% paraformaldehyde (PFA) for 15 min, washed three times with PBS, and permeabilized for 5 min with 0.3% triton X-100. HEK293-APP cells were incubated with 5% normal donkey serum for 1 h at RT before overnight incubation with the following primary antibodies: Talin1 clone 97H6 (1/400; NBP2-50320), anti-amyloid precursor protein C-terminal (1/500; A8717). The cells were then washed three times with PBS and incubated with the following secondary antibodies raised in donkey (AlexaFluor-conjugated AffiniPure Fragment 488 or 647, Jackson ImmunoResearch) and 1/10 000 Hoechst 33 342. Alternatively, for HEK293-APP cells and mouse embryo neurons, talin1 clone 97H6 (1/400; NBP2-50320), anti-amyloid precursor protein C-terminal (1/500; A8717), Homer1 (1/400; 160004) antibodies were used for the proximity-ligation assay (PLA) according to the manufacturer’s instructions (Duolink, Olink Bioscience).
5.11. Proximity ligation assay
Cells were fixed in 4% paraformaldehyde (PFA) for 15 min, washed three times with PBS, and permeabilized for 5 min with 0.3% triton X-100. The PLA was performed according to the manufacturer’s instructions (Duolink, Olink Bioscience). Cells were incubated with the Duolink blocking buffer for 1 h at 37°C before overnight incubation with the following primary antibodies: Talin1 clone 97H6 (1/400; NBP2-50320), anti-amyloid precursor protein C-terminal (1/500; A8717). For mouse embryo neurons, Homer1 (1/400; 160004) antibody was also added. For the counterstaining, neurons were incubated with the following secondary antibodies raised in donkey (AlexaFluor-conjugated AffiniPure Fragment 405, 488 or 647, Jackson ImmunoResearch) and HEK293-APP were incubated with 1/10 000 Hoechst 33 342.
5.12. WB and aβ quantification
Solutions and buffers were from Thermo Fisher, unless mentioned otherwise. Protein lysates were harvested in minimum volume of 100 µl well−1 in 24-well plates, in ice-cold lysis buffer as described previously [40] and quantified by means of Pierce BCA protein assay kit (23225). Lysates were mixed with one times lithium dodecyl sulphate (LDS) sample buffer (NP0008) and one-time reducing agent (NP0009), sonicated and boiled at 95°C for 5 min; 7 μg of total protein per well were loaded onto precast 4−12% Bis-tris protein gels, and electrophoresis was achieved by applying 150 V for 90 min using an Invitrogen XCell SureLock electrophoresis system with the NuPAGE MOPS SDS running buffer (1×; NP000102). Proteins were transferred to a nitrocellulose membrane of 0.2 μM pore size (Bio-Rad) using the trans-blot turbo transfer system (Bio-Rad). Membranes were rinsed three times for 5 min in TNT (0.01 M Tris pH 8.0, 0.15 M NaCl, 0.05% Tween-20) and incubated with the following primary antibodies in SuperBlock T20 blocking buffer (Thermo Scientific) at 4°C overnight: mouse anti-talin1 (NBP2−50320; 1/1000 Novus Biologicals), rabbit anti-APP (A8717; 1/5000; Sigma) and mouse anti-β-actin (A1978; 1/10 000; Sigma). Membranes were rinsed three times for 5 min with TNT and then incubated with horseradish peroxidase (HRP)-conjugated secondary antibodies (HRP-anti-mouse and HRP-anti-rabbit; 1:10 000; Jackson ImmunoResearch) diluted in 5% milk for 2 h at room temperature. Blots were developed using the Amersham ECL Western Blotting Detection Kit (WBLUC0500; Millipore). β-actin was used as a loading control.
Acknowledgements
We thank Guillaume Jacquemet, Yasumi Otani and Katy Goult for critical reading of the manuscript.
Footnotes
Contributor Information
Charles Ellis, Email: C.E.Ellis@soton.ac.uk.
Natasha L. Ward, Email: nlw23@kent.ac.uk.
Matthew Rice, Email: mr597@kent.ac.uk.
Neil J. Ball, Email: Neil.Ball@liverpool.ac.uk.
Pauline Walle, Email: pauline.walle@pasteur-lille.fr.
Chloé Najdek, Email: chloe.najdek@pasteur-lille.fr.
Devrim Kilinc, Email: devrim.kilinc@pasteur-lille.fr.
Jean-Charles Lambert, Email: jean-charles.lambert@pasteur-lille.fr.
Julien Chapuis, Email: julien.chapuis@pasteur-lille.fr.
Benjamin T. Goult, Email: b.t.goult@liverpool.ac.uk.
Ethics
Animal housing and experimentation were performed according to procedures approved by the local Animal Ethical Committee following European standards for the care and use of laboratory animals (agreement APAFIS #32824-2021120518521661, Lille, France).
Data accessibility
New crystal structure. The coordinates and structure factors were deposited in the PDB with accession code 8S4Y.
Supplementary material is available online [81].
Declaration of AI use
We have not used AI-assisted technologies in creating this article.
Authors’ contributions
C.E.: conceptualization, investigation, writing—original draft, writing—review and editing; N.L.W.: investigation, methodology, writing—original draft, writing—review and editing; M.R.: investigation, methodology, writing—review and editing; N.J.B.: investigation, methodology, writing—original draft, writing—review and editing; P.W.: investigation, methodology, writing—review and editing; C.N.: investigation, methodology, writing—review and editing; D.K.: investigation, methodology, writing—review and editing; J.-C.L.: supervision, writing—review and editing; J.C.: investigation, methodology, supervision, writing—review and editing; B.T.G.: conceptualization, formal analysis, funding acquisition, project administration, resources, supervision, validation, writing—original draft, writing—review and editing.
All authors gave final approval for publication and agreed to be held accountable for the work performed therein.
Conflict of interest declaration
We declare we have no competing interests.
Funding
C.E. and N.L.W were supported by PhD studentships from the Biological Sciences Research Council (BBSRC) SoCoBio-DTP (BB/T008768/1). B.T.G. was supported by Cancer Research UK Program Grant (CRUK-A21671). C.N. was supported by France Alzheimer Program Grant (Genetic of Synaptic Dysfunction, 6362, 2023).
References
- 1. DeTure MA, Dickson DW. 2019. The neuropathological diagnosis of Alzheimer’s disease. Mol. Neurodegener. 14, 32. ( 10.1186/s13024-019-0333-5) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2. Langa KM. 2015. Is the risk of Alzheimer’s disease and dementia declining? Alzheimers. Res. Ther. 7, 34. ( 10.1186/s13195-015-0118-1) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3. McKhann GM, et al. 2011. The diagnosis of dementia due to Alzheimer’s disease: recommendations from the National Institute on aging-Alzheimer’s association workgroups on diagnostic guidelines for Alzheimer’s disease. Alzheimers. Dement. 7, 263–269. ( 10.1016/j.jalz.2011.03.005) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4. Montine TJ, et al. 2016. Multisite assessment of NIA-AA guidelines for the neuropathologic evaluation of Alzheimer’s disease. Alzheimers. Dement. 12, 164–169. ( 10.1016/j.jalz.2015.07.492) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5. Braak H, Alafuzoff I, Arzberger T, Kretzschmar H, Del Tredici K. 2006. Staging of Alzheimer disease-associated neurofibrillary pathology using paraffin sections and immunocytochemistry. Acta Neuropathol. 112, 389–404. ( 10.1007/s00401-006-0127-z) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6. Braak H, Braak E. 1991. Neuropathological stageing of Alzheimer-related changes. Acta Neuropathol. 82, 239–259. ( 10.1007/BF00308809) [DOI] [PubMed] [Google Scholar]
- 7. Braak H, Braak E. 1997. Frequency of stages of Alzheimer-related lesions in different age categories. Neurobiol. Aging 18, 351–357. ( 10.1016/s0197-4580(97)00056-0) [DOI] [PubMed] [Google Scholar]
- 8. Thal DR, Rüb U, Orantes M, Braak H. 2002. Phases of a beta-deposition in the human brain and its relevance for the development of AD. Neurology (ECronicon). 58, 1791–1800. ( 10.1212/wnl.58.12.1791) [DOI] [PubMed] [Google Scholar]
- 9. Mirra SS, et al. 1991. The consortium to establish a registry for Alzheimer’s disease (CERAD). part II. standardization of the neuropathologic assessment of Alzheimer’s disease. Neurology 41, 479–486. ( 10.1212/wnl.41.4.479) [DOI] [PubMed] [Google Scholar]
- 10. Selkoe DJ. 1998. The cell biology of beta-amyloid precursor protein and presenilin in Alzheimer’s disease. Trends Cell Biol. 8, 447–453. ( 10.1016/s0962-8924(98)01363-4) [DOI] [PubMed] [Google Scholar]
- 11. Karlsson M, et al. 2021. A single-cell type transcriptomics map of human tissues. Sci. Adv. 7, eabh2169. ( 10.1126/sciadv.abh2169) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12. Findeis MA. 2007. The role of amyloid β peptide 42 in Alzheimer’s disease. Pharmacol. Ther. 116, 266–286. ( 10.1016/j.pharmthera.2007.06.006) [DOI] [PubMed] [Google Scholar]
- 13. Sengupta U, Nilson AN, Kayed R. 2016. The role of amyloid-β oligomers in toxicity, propagation, and immunotherapy. EBioMedicine 6, 42–49. ( 10.1016/j.ebiom.2016.03.035) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14. Zheng H, Koo EH. 2006. The amyloid precursor protein: beyond amyloid. Mol. Neurodegener. 1, 5. ( 10.1186/1750-1326-1-5) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15. Levy AD, Omar MH, Koleske AJ. 2014. Extracellular matrix control of dendritic spine and synapse structure and plasticity in adulthood. Front. Neuroanat. 8, 116. ( 10.3389/fnana.2014.00116) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16. Wlodarczyk J, Mukhina I, Kaczmarek L, Dityatev A. 2011. Extracellular matrix molecules, their receptors, and secreted proteases in synaptic plasticity. Dev. Neurobiol. 71, 1040–1053. ( 10.1002/dneu.20958) [DOI] [PubMed] [Google Scholar]
- 17. Dalva MB, McClelland AC, Kayser MS. 2007. Cell adhesion molecules: signalling functions at the synapse. Nat. Rev. Neurosci. 8, 206–220. ( 10.1038/nrn2075) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18. Missler M, Südhof TC, Biederer T. 2012. Synaptic cell adhesion. Cold Spring Harb. Perspect. Biol. 4, a005694. ( 10.1101/cshperspect.a005694) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19. Hynes RO. 1992. Integrins: versatility, modulation, and signaling in cell adhesion. Cell 69, 11–25. ( 10.1016/0092-8674(92)90115-s) [DOI] [PubMed] [Google Scholar]
- 20. Huang Z, Shimazu K, Woo NH, Zang K, Müller U, Lu B, Reichardt LF. 2006. Distinct roles of the beta 1-class integrins at the developing and the mature hippocampal excitatory synapse. J. Neurosci. 26, 11208–11219. ( 10.1523/JNEUROSCI.3526-06.2006) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21. Kerrisk ME, Greer CA, Koleske AJ. 2013. Integrin α3 is required for late postnatal stability of dendrite arbors, dendritic spines and synapses, and mouse behavior. J. Neurosci. 33, 6742–6752. ( 10.1523/JNEUROSCI.0528-13.2013) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22. Ning L, Tian L, Smirnov S, Vihinen H, Llano O, Vick K, Davis RL, Rivera C, Gahmberg CG. 2013. Interactions between ICAM-5 and β1 integrins regulate neuronal synapse formation. J. Cell. Sci. 126, 77–89. ( 10.1242/jcs.106674) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23. Webb DJ, Zhang H, Majumdar D, Horwitz AF. 2007. α5 Integrin signaling regulates the formation of spines and synapses in hippocampal neurons. J. Biol. Chem. 282, 6929–6935. ( 10.1074/jbc.M610981200) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24. Goult BT, et al. 2013. RIAM and vinculin binding to talin are mutually exclusive and regulate adhesion assembly and turnover. J. Biol. Chem. 288, 8238–8249. ( 10.1074/jbc.M112.438119) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25. Yao M, Goult BT, Klapholz B, Hu X, Toseland CP, Guo Y, Cong P, Sheetz MP, Yan J. 2016. The mechanical response of talin. Nat. Commun. 7, 11966. ( 10.1038/ncomms11966) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26. Goult BT. 2021. The mechanical basis of memory - the MeshCODE theory. Front. Mol. Neurosci. 14, 592951. ( 10.3389/fnmol.2021.592951) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27. Goult BT, Brown NH, Schwartz MA. 2021. Talin in mechanotransduction and mechanomemory at a glance. J. Cell. Sci. 134, jcs258749. ( 10.1242/jcs.258749) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28. Ball NJ, Barnett SFH, Goult BT. 2024. Mechanically operated signalling scaffolds. Biochem. Soc. Trans. 52, 517–527. ( 10.1042/BST20221194) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29. Barnett SFH, Goult BT. 2022. The MeshCODE to scale-visualising synaptic binary information. Front. Cell. Neurosci. 16, 1014629. ( 10.3389/fncel.2022.1014629) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30. Dahal N, Sharma S, Phan B, Eis A, Popa I. 2022. Mechanical regulation of talin through binding and history-dependent unfolding. Sci. Adv. 8, eabl7719. ( 10.1126/sciadv.abl7719) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31. Marhuenda E, et al. 2023. Cardiomyocyte mechanical memory is regulated through the talin interactome and dlc1 dependent regulation of rhoa. Cell Biology. ( 10.1101/2023.07.19.549635) [DOI]
- 32. Pfundstein G, Nikonenko AG, Sytnyk V. 2022. Amyloid precursor protein (APP) and amyloid β (Aβ) interact with cell adhesion molecules: implications in Alzheimer’s disease and normal physiology. Front. Cell Dev. Biol. 10, 969547. ( 10.3389/fcell.2022.969547) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33. Ristori E, Cicaloni V, Salvini L, Tinti L, Tinti C, Simons M, Corti F, Donnini S, Ziche M. 2020. Amyloid-β precursor protein APP down-regulation alters actin cytoskeleton-interacting proteins in endothelial cells. Cells 9, 2506. ( 10.3390/cells9112506) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 34. Yamazaki T, Koo EH, Selkoe DJ. 1997. Cell surface amyloid beta-protein precursor colocalizes with beta 1 integrins at substrate contact sites in neural cells. J. Neurosci. 17, 1004–1010. ( 10.1523/JNEUROSCI.17-03-01004.1997) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 35. Storey E, Beyreuther K, Masters CL. 1996. Alzheimer’s disease amyloid precursor protein on the surface of cortical neurons in primary culture co-localizes with adhesion patch components. Brain Res. 735, 217–231. ( 10.1016/0006-8993(96)00608-7) [DOI] [PubMed] [Google Scholar]
- 36. Gusareva ES, et al. 2018. Male-specific epistasis between WWC1 and TLN2 genes is associated with Alzheimer’s disease. Neurobiol. Aging 72, 188.( 10.1016/j.neurobiolaging.2018.08.001) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37. Donnaloja F, Limonta E, Mancosu C, Morandi F, Boeri L, Albani D, Raimondi MT. 2023. Unravelling the mechanotransduction pathways in Alzheimer’s disease. J. Biol. Eng. 17, 22. ( 10.1186/s13036-023-00336-w) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38. Dourlen P, Kilinc D, Malmanche N, Chapuis J, Lambert JC. 2019. The new genetic landscape of Alzheimer’s disease: from amyloid cascade to genetically driven synaptic failure hypothesis? Acta Neuropathol. 138, 221–236. ( 10.1007/s00401-019-02004-0) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39. Eysert F, et al. 2021. Alzheimer’s genetic risk factor FERMT2 (Kindlin-2) controls axonal growth and synaptic plasticity in an APP-dependent manner. Mol. Psychiatry 26, 5592–5607. ( 10.1038/s41380-020-00926-w) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40. Chapuis J, et al. 2017. Genome-wide, high-content siRNA screening identifies the Alzheimer’s genetic risk factor FERMT2 as a major modulator of APP metabolism. Acta Neuropathol. 133, 955–966. ( 10.1007/s00401-016-1652-z) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41. Chen WJ, Goldstein JL, Brown MS. 1990. NPXY, a sequence often found in cytoplasmic tails, is required for coated pit-mediated internalization of the low density lipoprotein receptor. J. Biol. Chem. 265, 3116–3123. [PubMed] [Google Scholar]
- 42. Kang J, Müller-Hill B. 1990. Differential splicing of Alzheimer’s disease amyloid A4 precursor RNA in rat tissues: PreA4(695) mRNA is predominantly produced in rat and human brain. Biochem. Biophys. Res. Commun. 166, 1192–1200. ( 10.1016/0006-291x(90)90992-v) [DOI] [PubMed] [Google Scholar]
- 43. Rohan de Silva HA, Jen A, Wickenden C, Jen LS, Wilkinson SL, Patel AJ. 1997. Cell-specific expression of β-amyloid precursor protein isoform mRNAs and proteins in neurons and astrocytes. Mol. Brain Res. 47, 147–156. ( 10.1016/S0169-328X(97)00045-4) [DOI] [PubMed] [Google Scholar]
- 44. Jumper J, et al. 2021. Highly accurate protein structure prediction with AlphaFold. Nature 596, 583–589. ( 10.1038/s41586-021-03819-2) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45. Varadi M, et al. 2022. AlphaFold protein structure database: massively expanding the structural coverage of protein-sequence space with high-accuracy models. Nucleic Acids Res. 50, D439–D444. ( 10.1093/nar/gkab1061) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46. Anthis NJ, et al. 2009. The structure of an integrin/talin complex reveals the basis of inside-out signal transduction. EMBO J. 28, 3623–3632. ( 10.1038/emboj.2009.287) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 47. Calderwood DA, Yan B, de Pereda JM, Alvarez BG, Fujioka Y, Liddington RC, Ginsberg MH. 2002. The phosphotyrosine binding-like domain of talin activates integrins. J. Biol. Chem. 277, 21749–21758. ( 10.1074/jbc.M111996200) [DOI] [PubMed] [Google Scholar]
- 48. García-Alvarez B, de Pereda JM, Calderwood DA, Ulmer TS, Critchley D, Campbell ID, Ginsberg MH, Liddington RC. 2003. Structural determinants of integrin recognition by talin. Mol. Cell 11, 49–58. ( 10.1016/s1097-2765(02)00823-7) [DOI] [PubMed] [Google Scholar]
- 49. Moore DT, Nygren P, Jo H, Boesze-Battaglia K, Bennett JS, DeGrado WF. 2012. Affinity of talin-1 for the β3-integrin cytosolic domain is modulated by its phospholipid bilayer environment. Proc. Natl Acad. Sci. USA 109, 793–798. ( 10.1073/pnas.1117220108) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50. Baumkötter F, et al. 2014. Amyloid precursor protein dimerization and synaptogenic function depend on copper binding to the growth factor-like domain. J. Neurosci. 34, 11159–11172. ( 10.1523/JNEUROSCI.0180-14.2014) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 51. Wang Y, Ha Y. 2004. The X-ray structure of an antiparallel dimer of the human amyloid precursor protein E2 domain. Mol. Cell 15, 343–353. ( 10.1016/j.molcel.2004.06.037) [DOI] [PubMed] [Google Scholar]
- 52. Dahms SO, Hoefgen S, Roeser D, Schlott B, Gührs KH, Than ME. 2010. Structure and biochemical analysis of the heparin-induced E1 dimer of the amyloid precursor protein. Proc. Natl Acad. Sci. USA 107, 5381–5386. ( 10.1073/pnas.0911326107) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53. Wang X, Zhou X, Li G, Zhang Y, Wu Y, Song W. 2017. Modifications and trafficking of APP in the pathogenesis of Alzheimer’s disease. Front. Mol. Neurosci. 10, 294. ( 10.3389/fnmol.2017.00294) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54. Hoe HS, et al. 2009. Interaction of reelin with amyloid precursor protein promotes neurite outgrowth. J. Neurosci. 29, 7459–7473. ( 10.1523/JNEUROSCI.4872-08.2009) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 55. Young-Pearse TL, Chen AC, Chang R, Marquez C, Selkoe DJ. 2008. Secreted APP regulates the function of full-length APP in neurite outgrowth through interaction with integrin beta1. Neural Dev. 3, 15. ( 10.1186/1749-8104-3-15) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 56. Aretz J, Aziz M, Strohmeyer N, Sattler M, Fässler R. 2023. Talin and kindlin use integrin tail allostery and direct binding to activate integrins. Nat. Struct. Mol. Biol. 30, 1913–1924. ( 10.1038/s41594-023-01139-9) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 57. Bray SJ. 2006. Notch signalling: a simple pathway becomes complex. Nat. Rev. Mol. Cell Biol. 7, 678–689. ( 10.1038/nrm2009) [DOI] [PubMed] [Google Scholar]
- 58. Guénette S, Strecker P, Kins S. 2017. APP protein family signaling at the synapse: insights from intracellular APP-binding proteins. Front. Mol. Neurosci. 10, 87. ( 10.3389/fnmol.2017.00087) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 59. Lachén-Montes M, et al. 2016. An early dysregulation of FAK and MEK/ERK signaling pathways precedes the β-amyloid deposition in the olfactory bulb of APP/PS1 mouse model of Alzheimer’s disease. J. Proteomics 148, 149–158. ( 10.1016/j.jprot.2016.07.032) [DOI] [PubMed] [Google Scholar]
- 60. González-Sánchez M, Díaz T, Pascual C, Antequera D, Herrero-San Martín A, Llamas-Velasco S, Villarejo-Galende A, Bartolome F, Carro E. 2018. Platelet proteomic analysis revealed differential pattern of cytoskeletal- and immune-related proteins at early stages of Alzheimer’s disease. Mol. Neurobiol. 55, 8815–8825. ( 10.1007/s12035-018-1039-3) [DOI] [PubMed] [Google Scholar]
- 61. Selkoe DJ, Hardy J. 2016. The amyloid hypothesis of Alzheimer’s disease at 25 years. EMBO Mol. Med. 8, 595–608. ( 10.15252/emmm.201606210) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 62. Bagaria J, Bagyinszky E, An SSA. 2022. Genetics, functions, and clinical impact of presenilin-1 (PSEN1) gene. Int. J. Mol. Sci. 23, 10970. ( 10.3390/ijms231810970) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 63. Sun L, Zhou R, Yang G, Shi Y. 2017. Analysis of 138 pathogenic mutations in presenilin-1 on the in vitro production of Aβ42 and Aβ40 peptides by γ-secretase. Proc. Natl Acad. Sci. USA 114, E476–E485. ( 10.1073/pnas.1618657114) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 64. Khan UA, Liu L, Provenzano FA, Berman DE, Profaci CP, Sloan R, Mayeux R, Duff KE, Small SA. 2014. Molecular drivers and cortical spread of lateral entorhinal cortex dysfunction in preclinical Alzheimer’s disease. Nat. Neurosci. 17, 304–311. ( 10.1038/nn.3606) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 65. Arregui CO, Carbonetto S, McKerracher L. 1994. Characterization of neural cell adhesion sites: point contacts are the sites of interaction between integrins and the cytoskeleton in PC12 cells. J. Neurosci. 14, 6967–6977. ( 10.1523/JNEUROSCI.14-11-06967.1994) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 66. Nichol RH, Hagen KM, Lumbard DC, Dent EW, Gómez TM. 2016. Guidance of axons by local coupling of retrograde flow to point contact adhesions. J. Neurosci. 36, 2267–2282. ( 10.1523/JNEUROSCI.2645-15.2016) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 67. Khan RB, Varela L, Cowell AR, Goult BT. 2021. Biochemical characterization of the integrin interactome. Methods Mol. Biol. 2217, 115–147. ( 10.1007/978-1-0716-0962-0_9) [DOI] [PubMed] [Google Scholar]
- 68. Bouchet BP, et al. 2016. Talin-KANK1 interaction controls the recruitment of cortical microtubule stabilizing complexes to focal adhesions. eLife 5, e18124. ( 10.7554/eLife.18124) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 69. Skinner SP, Goult BT, Fogh RH, Boucher W, Stevens TJ, Laue ED, Vuister GW. 2015. Structure calculation, refinement and validation using CcpNmr analysis. Acta Crystallogr. D Biol. Crystallogr. 71, 154–161. ( 10.1107/S1399004714026662) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 70. Beilsten-Edmands J, Winter G, Gildea R, Parkhurst J, Waterman D, Evans G. 2020. Scaling diffraction data in the DIALS software package: algorithms and new approaches for multi-crystal scaling. Acta Cryst. D Struct. Biol. 76, 385–399. ( 10.1107/S2059798320003198) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 71. Winn MD, et al. 2011. Overview of the CCP4 suite and current developments. Acta Crystallogr. D Biol. Crystallogr. 67, 235–242. ( 10.1107/S0907444910045749) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 72. Winter G. 2010. xia2 : an expert system for macromolecular crystallography data reduction . J. Appl. Crystallogr. 43, 186–190. ( 10.1107/S0021889809045701) [DOI] [Google Scholar]
- 73. Winter G, et al. 2018. DIALS: implementation and evaluation of a new integration package. Acta Crystallogr. D. Struct. Biol. 74, 85–97. ( 10.1107/S2059798317017235) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 74. McCoy AJ, Grosse-Kunstleve RW, Adams PD, Winn MD, Storoni LC, Read RJ. 2007. Phaser crystallographic software. J. Appl. Crystallogr. 40, 658–674. ( 10.1107/S0021889807021206) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 75. Emsley P, Lohkamp B, Scott WG, Cowtan K. 2010. Features and development of coot. Acta Crystallogr. D Biol. Crystallogr. 66, 486–501. ( 10.1107/S0907444910007493) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 76. Afonine PV, et al. 2012. Towards automated crystallographic structure refinement with phenix.refine. Acta Crystallogr. D Biol. Crystallogr. 68, 352–367. ( 10.1107/S0907444912001308) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 77. Liebschner D, et al. 2019. Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix. Acta Crystallogr. D. Struct. Biol. 75, 861–877. ( 10.1107/S2059798319011471) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 78. Williams CJ, et al. 2018. MolProbity: more and better reference data for improved all-atom structure validation. Protein Sci. 27, 293–315. ( 10.1002/pro.3330) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 79. Dedden D, Schumacher S, Kelley CF, Zacharias M, Biertümpfel C, Fässler R, Mizuno N. 2019. The architecture of Talin1 reveals an autoinhibition mechanism. Cell 179, 120–131. ( 10.1016/j.cell.2019.08.034) [DOI] [PMC free article] [PubMed] [Google Scholar]
- 80. Kukol A. 2009. Lipid models for united-atom molecular dynamics simulations of proteins. J. Chem. Theory Comput. 5, 615–626. ( 10.1021/ct8003468) [DOI] [PubMed] [Google Scholar]
- 81. Ellis C, et al. 2024. Supplementary material from: The structure of an amyloid precursor protein/talin complex indicates a mechanical basis of Alzheimer’s disease. Figshare ( 10.6084/m9.figshare.c.7539167) [DOI] [PubMed]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Data Availability Statement
New crystal structure. The coordinates and structure factors were deposited in the PDB with accession code 8S4Y.
Supplementary material is available online [81].