Abstract
Animal toxins contain various bioactive peptides and proteins which have evolved to interact in specific ways. As such, they are a good starting point for developing new drugs and vaccines. This paper examines three natural neurotoxins derived from the black mamba (Dendroaspis polylepis), which show significant pharmacological potential: mambalgins, fasciculins and dendrotoxins. All three may be of value in the treatment of pain, cancer and neurodegenerative disease. Mambalgins provide similar pain relief to opioids but without the risk of addiction; they act by selectively blocking acid-sensitive ion channels (ASICs), especially ASIC1a. Thanks to this inhibitory activity they also demonstrate selective activity against glioblastoma, melanoma and leukemia cells as innovative anticancer drugs. Fasciculins are very strong inhibitors of acetylcholinesterase (AChE) and hence offer promise in multi-target drugs and as treatments for treating Alzheimer’s disease. Dendrotoxins such as DTX-K and DTX-I are able to modulate neuronal excitability and synaptic transmission by blocking voltage-gated potassium channels (Kv1.1, Kv1.2, Kv1.6); both have been shown to be effective against cancer cells, and to influence the cardiovascular, immune, and digestive systems. Recent advances in recombinant biotechnology and protein engineering have allowed their safe production with increased therapeutic value. The review examines the translational potential of D. polylepis venom proteins and highlights the need for additional preclinical research on bioactive molecules of toxin origin.
Keywords: black mamba, mambalgin, dendrotoxin, fasciculin, ASIC1a, Kv1 channels, recombinant toxins, neurotoxins, venom-derived therapeutics, anticancer effect
1. Introduction
Paracelsus, regarded as the father of modern toxicology, formulated the principle “Sola dosis facit venenum” (“the dose makes the poison”) as early as the 16th century [1,2]. Thus lies the paradox of toxins, which possess both destructive and healing potential [3]. While toxins may be a tool for defense or prey capture in their natural context, they can also be used for treatment in controlled laboratory and clinical conditions. A notable example is the use of conotoxins from cone snails [4,5], which are naturally used to immobilize prey and have inspired the development of painkillers. Captopril, a widely prescribed antihypertensive pharmaceutical agent, was developed based on peptides that enhance the action of bradykinin, a bioactive peptide found in the venom of the South American viper (Bothrops jararaca) [6,7].
One of the largest and most dangerous venomous snakes in sub-Saharan Africa is the black mamba (Dendroaspis polylepis) [8,9,10]. Its venom is extremely potent and acts rapidly; a single bite can deliver several hundred milligrams, with only a few dozen being enough to kill a human. Proteomic analyses have found the venom to contain forty different proteins and peptides, including mambalgins, fasciculins, and dendrotoxins. However, in addition to their toxic properties, these substances also have potential in research and therapy [11,12].
The discovery of mambalgins, which act on acid-sensitive ASIC ion channels, has opened up new possibilities for pain management. Rather than causing toxic symptoms, mambalgins were found to exhibit analgesic effects comparable to morphine, but without the risk of addiction. This finding represents a captivating illustration of how animal toxins can stimulate the conception of novel classes of pharmaceuticals [13,14]. Fasciculins are small, three-finger toxins that support the accumulation of acetylcholine in synapses by effectively inhibiting acetylcholinesterase activity. They have been used in studies of cholinergic neurotransmission and can be used as new enzyme inhibitors in experimental studies [15,16]. Finally, dendrotoxins belong to the Kunitz-type protease inhibitor family. These toxins primarily block Kv1.x voltage-gated potassium channels, increasing neuronal excitability. Initially studied as a potential cause of intense neuromuscular excitation in victims, dendrotoxins have quickly become invaluable tools in electrophysiology, enabling the mapping of ion channel function [17]. These three different proteins are presented in Table 1.
Modern biotechnology has opened up entirely new possibilities in toxin research. Genetic engineering allows recombinant versions of toxins to be produced indirectly in expression systems by other organisms, enabling their safe production in large quantities without the need for extraction from natural sources. In addition, site-directed mutagenesis can be used to alter natural protein sequences, enhancing their stability or selectivity towards particular molecular targets, and reducing their toxicity. Peptide optimization strategies can also improve pharmacological profiles, and the development of recombinant antitoxins represents a promising alternative to traditional serum therapies [18] and vaccines, avoiding problems related to immunogenicity and limited availability.
Hence, animal toxins such as black mamba venom represent valuable sources of substrates for modern Medicine and Pharmacology. In an era of protein therapy and molecularly targeted drug design, recombinant toxins could become the basis for next-generation drugs ranging from analgesics to neuroprotectives to anticancer agents. The aim of our work is to examine the therapeutic effects and future clinical applications of three proteins selected from Dendroaspis polylepis venom.
Table 1.
Comparison of selected mambalgin, faciculin and denrotoxin. Based on https://www.uniprot.org/ and https://www.rcsb.org/ (accessed on 6 October 2025).
| Toxin | Structure/Type | Protein Size | Mechanism of Action | Molecular Target | Refs. |
|---|---|---|---|---|---|
Mambalgin![]() Mambalgin-1 |
Three-finger toxin (3FTx) family peptide | ~57 amino acids ~7 kDa |
Blocks acid-sensing ion channels (ASICs); produces strong analgesic effects comparable to morphine | ASIC1a and ASIC1b channels, “thumb” domain, electrostatic, hydrophobic interactions, hydrogen bonds | [19] |
| Amino acid sequence: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK | |||||
Fasciculin![]() Fasciculin-1 |
Three-finger toxin (3FTx) family peptide | ~61 amino acids ~7 kDa |
Inhibitor of acetylcholinesterase; prolongs the action of acetylcholine at synapses | AChE enzyme, peripheral anionic site (PAS), hydrogen bonds, hydrophobic, ionic interactions | [15,16] |
| Amino acid sequence: TMCYSHTTTSRAILTNCGENSCYRKSRRHPPKMVLGRGCGCPPGDDYLEVKCCTSPDKCNY | |||||
Dendrotoxin (I/K)![]() Dendrotoxin-K |
Kunitz-type peptide (protease inhibitor-like) | ~57 amino acids ~7 kDa (6.8 kDa) |
Selectively blocks voltage-gated potassium channels (Kv1) | Kv1 potassium channels (Kv1.1, Kv1.2, Kv1.6), electrostatic, hydrophobic interactions | [17] |
| Amino acid sequence: AAKYCKLPLRIGPCKRKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG | |||||
Dendrotoxin-I
|
Kunitz-type peptide (protease inhibitor-like) | ~60 amino acids ~7 kDa (6.8 kDa) |
Selectively blocks voltage-gated potassium channels (Kv1) | Kv1 potassium channels (Kv1.1, Kv1.2, Kv1.6), electrostatic, hydrophobic interactions | [17] |
| Amino acid sequence: QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSGCGGNSNRFKTIEECRRTCIRK | |||||
2. Study Design
The literature was reviewed for studies concerning the medical properties of proteins derived from Dendroaspis polylepis venom, as well as general information about mambalgins, fasciculins and dendrotoxins. The databases PubMed, Google Scholar and Web of Science were searched using the keywords “Dendroaspis polylepis,” “mambalgin,” “fasciculin,” “dendrotoxin,” “anticancer/analgesic/medical properties of venom proteins,” and “recombinant venom toxin.” The initial search period covered the last 25 years, but was expanded to include the 1980s and 1990s when the first studies of black mamba venom proteins were performed. Full-text articles were assessed for eligibility, and some were rejected due to inconsistency with the topic, lack of necessary information, or vagueness regarding inter alia protein origin, study control group information, non-specific mechanism, and for methodology not meeting criteria or language limitations (Figure 1). Additional references were identified by reviewing the reference lists of relevant articles.
Figure 1.
Diagram of the screening procedure.
3. Therapeutic Applications of Animal-Derived Protein Toxins: From Molecular Targets to Clinical Tools
Protein toxins of animal origin represent a distinct class of biologically active compounds that have evolved as specialized tools for predation or defense. These toxins are found in the venoms of various animal species, including inter alia snakes, scorpions and spiders. Many of these toxins display remarkable specificity for molecular targets such as ion channels, membrane receptors and enzymes, which play pivotal roles in physiological processes. Consequently, despite their toxic nature, these compounds have become the focus of intensive pharmacological and clinical research as promising candidates for novel therapeutic agents [20,21,22]. It is important to clarify the distinctions between the terms toxin, venom, and poison, which are often used interchangeably but differ significantly in scientific contexts [23]. A toxin broadly refers to a biologically active molecule, typically a protein or peptide produced by living organisms, that exerts specific, often deleterious effects in another organism at low concentrations [24]. A venom, in contrast, is a complex secretion composed of multiple toxins and other bioactive components. It is synthesized in specialized glands and delivered actively into a target via dedicated apparatus such as fangs, stingers, or spines [25]. Poisons, on the other hand, are toxic substances absorbed passively through ingestion, inhalation, or dermal contact, lacking the active delivery mechanism characteristic of venoms [26].
In animals, it is essential to distinguish between individual toxins (isolated bioactive compounds) and venom, which is a multifaceted mixture of compounds that often act synergistically. This biochemical complexity renders venoms a highly attractive yet challenging source of pharmacologically relevant compounds. Natural toxins are increasingly being used in drug development to inspire the design of both direct preparations and synthetic analogs.
Snake venoms, in particular, have yielded numerous therapeutically relevant proteins such as phospholipase A2, metalloproteinases, serine proteases and neurotoxins targeting nicotinic receptors. One of the most well-known is captopril, which is an ACE inhibitor based on the teprotide peptide from Bothrops jararaca venom. Captopril revolutionized the treatment of hypertension and heart failure [27,28,29,30]. The groundwork for this discovery was laid in 1949, when it was observed that proteases in Brazilian viper venom triggered vasodilation and blood pressure reduction through the formation of the nanopeptide bradykinin [31].
Another promising group of bioactive peptides, capable of modulating sodium, potassium, and calcium ion channels, are scorpion toxins [32,33]. One notable compound is chlorotoxin, isolated from Leiurus quinquestriatus, which binds specifically to glioma cells and is being tested for use in brain tumor imaging and therapy [34]. Scorpion venom has also demonstrated anticancer potential in colorectal and breast cancer cell lines [35], as well as immunomodulatory and antimicrobial activities, suggesting potential as an anti-infective agent [36,37].
Spiders produce a similarly diverse range of venomous peptides. For instance, ω-agatoxin IVA, derived from Agelenopsis aperta, blocks P/Q-type calcium channels and serves as a valuable neurophysiological tool [38]. Phα1β, a peptide from Phoneutria nigriventer, has shown potent analgesic effects, and have been found to demonstrate greater efficacy than morphine [39,40]. In addition, lycotoxins from spider Lycosa carolinensis have also been evaluated for therapeutic use [41,42]. Mollusks, particularly cone snails, produce conotoxins—small peptides with exceptional specificity for ion channels and receptors. A prime example is ziconotide (synthetic ω-conotoxin MVIIA), currently used to manage severe neuropathic pain [43,44] by blocking N-type calcium channels [45,46].
Insects such as bees and wasps also secrete pharmacologically active peptides. Melittin, the major component of bee venom, exhibits cytolytic properties and is under investigation for its anticancer and antimicrobial potential [47,48], and has demonstrated antiproliferative activity in gastric [49], ovarian [50], liver [51], lung [52], and breast cancers [53]. Another bee venom peptide, apamin, selectively blocks potassium channels and has been studied for its neuromodulatory effects [54,55].
Although less frequently highlighted, venom from fish and marine animals may also be involved in experimental studies. A notable example is stonustoxin (SNTX), a heterodimeric protein (~150 kDa) from stonefish (Synanceia), which displays potent cytolytic and vasodilatory properties [56]. Moreover, SNTX-derived fragments have shown anticoagulant effects and immunomodulatory potential [57,58,59].
In summary, animal-derived toxins offer multifaceted biological activity and have considerable potential in numerous medical fields including Cardiology, Neurology, Oncology, Immunology, and Dermatology. Their study has already led to the development of several groundbreaking drugs. Ongoing research will likely uncover additional therapeutic applications, paving the way for more precise and personalized treatment strategies based on these naturally evolved molecules [60].
4. Biotechnology and Recombinant Proteins in Medicine
Recombinant protein biotechnology is an important tool for engineering protein toxins and creating medical applications for them. Traditionally, such proteins were obtained from natural sources such as animal, bacterial and fungal venom, resulting in limited availability and variable composition, as well as difficulties in purification. However, the introduction of recombinant DNA technology has enabled the production of pure, homogeneous proteins in expression systems such as bacteria (e.g., Escherichia coli) [61,62], yeast (e.g., Pichia pastoris) [63,64,65], mammalian cells [66], insect cells [67,68], and even plants [69,70,71,72]. Furthermore, large quantities of highly pure proteins can be obtained and further modified to increase safety and efficacy through the use of gene cloning and expression in heterologous systems [73,74,75], for example botulinum toxin type A (BoNT/A). The use of recombinant variants with a shorter duration of action are expected to improve safer without posing a full-toxicity risk [76,77].
Another promising direction is the design of chimeric therapeutic proteins based on combining toxin fragments with antibodies (‘immunotoxins’), which are being investigated for use in cancer therapy [78,79]. Immunotoxins based on diphtheria toxin, for example, consist of the catalytic domain of the toxin linked to an antibody that recognizes a tumor antigen [80,81,82]. The denileukin diftitox IL-2 (interleukin-2) immunotoxin targets cancer cells with the IL-2 receptor, primarily T-cell lymphomas (CTCL) [83,84]. Moxetumomab pasudotox is a Pseudomonas aeruginosa (PE38) immunotoxin linked to an anti-CD22 antibody, which is used to treat refractory hairy cell leukemia [85].
While most clinical immunotoxins are based on bacterial or plant toxins, some are based on animal or venomous toxins. These include TM-601, a chlorotoxin derived from scorpion venom (Leiurus quinquestriatus) conjugated with iodine-131, which selectively binds to glioma cells [86,87], and contortrostatin from Agkistrodon contortrix, which acts on integrins and inhibits angiogenesis and tumor cell adhesion [88,89].
Another important application is the production of antitoxins and vaccines [90]. This area of research, which has a direct impact on everyday life, employs recombinant toxin fragments to act as safe antigens for eliciting an immune response. Examples include monoclonal antibodies and antibody fragments which can neutralize toxins from inter alia snakes, scorpions and spiders, with greater selectivity and reduced risk of adverse effects. This is an alternative to traditional antisera; for example, recombinant antibodies can be created against cobra neurotoxins [91,92,93]. Genetic engineering allows animal and human antibody sequences to be combined to create safer preparations. Recombinant antibodies against lanceolate adder venom (Bothrops asper) have already been subjected to clinical trials [94,95].
Due to the complexity of venoms, which contain dozens of proteins with various toxic properties, it is advisable to use a cocktail of recombinant antibodies, particularly for the Elapidae family, which can elicit a range of pathophysiological reactions caused by specific components [96]. The use of engineered proteins minimizes the risk of allergic reactions, improves the safety of therapy and provides an alternative to traditional antisera. In addition, recombinant venom peptides, such as dendroxins or mambalgins, produced as recombinant proteins in expression systems represent a potential source of analgesic drugs and tools for neurobiological research.
The development of biotechnological methods and protein engineering enables toxins that were originally a threat to be transformed into innovative therapeutic tools. The ability to introduce structural modifications and control the production process means that recombinant toxins can be produced on a large scale, reproducibly and safely. The perception of these substances has thus shifted from exotic biological curiosities to promising therapeutic tools [97,98,99].
5. Characteristics of Dendroaspis polylepis
Dendroaspis polylepis, commonly known as the black mamba, is considered one of the most dangerous snake species in sub-Saharan Africa due to the extreme potency of its venom. Its natural range extends from Kenya to South Africa, where it inhabits savannahs, shrublands, and riverine forests, typically favoring rocky hillsides. It exhibits both arboreal and terrestrial behaviors, frequently sheltering in termite mounds or hollow trees, and is not currently classified as threatened [100,101,102,103]. The snake itself is not black, with the name referring to the dark bluish-black interior of its mouth, which it displays when threatened; in contrast, other mamba species have paler oral mucosa [101,104]. Its dorsal coloration varies from olive to grayish-brown, with a lighter ventral surface. Juveniles tend to display a greenish-gray hue [100,102,105,106]. The species name Dendroaspis translates as ‘tree snake’, while polylepis refers to its numerous scales [100].
The black mamba is the longest venomous snake in Africa, with adults typically ranging from 2.0 to 2.5 m in length (6.6–8.2 feet), although some specimens exceed 4.3 m (14 feet) [100,102,103,104,106]. It is also among the fastest snakes globally, capable of reaching speeds up to 19 km/h, with anecdotal reports suggesting bursts exceeding 20 km/h [105]. This agility is primarily used for evasion rather than predation. D. polylepis is a diurnal and territorial predator that primarily feeds on rodents and other small mammals, birds and occasionally lizards. It employs a strike-and-release hunting strategy, delivering a rapid envenomation followed by retreat until the prey is immobilized [100]. Despite its reclusive nature, the black mamba can display aggressive behavior if escape is not possible. During defensive encounters, it can raise a significant portion of its body, reportedly up to face level in large specimens, and strike repeatedly with high accuracy [103]. Venom yields per bite range from 100 to 400 mg, whereas the estimated lethal dose for an adult human is approximately 10–15 mg [103]. Clinical manifestations of envenomation typically develop within 60 min and include neurological symptoms (e.g., ptosis, paralysis), respiratory depression, and autonomic dysfunction such as profuse sweating [100]. A narrative review analyzing clinical cases of black mamba envenomation reported that 90% of patients received antivenom therapy, with a survival rate of nearly 99%, underscoring the effectiveness of prompt medical intervention [100]. Furthermore, although native to sub-Saharan Africa, D. polylepis is occasionally encountered outside its natural range, particularly in Europe and North America, as a result of the exotic pet trade [101]. The snake is depicted in Figure 2.
Figure 2.
Dendroaspis polylepis (Photographer—Helena Hubáčková, Safari Park Dvůr Králové).
6. Mambalgins
6.1. Characteristics of Mambalgins
Mambalgins are peptides composed of 57 amino acids that belong to the three-finger toxin (3FTx) superfamily: an evolutionarily conserved group of non-enzymatic, cysteine-rich proteins commonly found in the venoms of Elapidae and Hydrophiinae snakes [107,108,109]. The characteristic structure of 3FTx proteins comprises three β-sheet-rich loops (“fingers”) extending from a compact hydrophobic core stabilized by four to five disulfide bridges [108,109]. Based on structural variations within these loops, the 3FTx family is subdivided into short-chain, long-chain, and non-conventional types [108]. Notable members of this family include α-neurotoxins, cytotoxins, and mambalgins [107,108,109]. The discovery of mambalgins dates back to 2012, when Diochot et al. found the venom of Dendroaspis polylepis to have potent analgesic properties and no observable respiratory depression: a major limitation of opioid analgesics [14]. The research, conducted at the Institut de Pharmacologie Moléculaire et Cellulaire in France, led to the isolation of two homologous peptides, mambalgin-1 and mambalgin-2, which differ by only a few amino acid residues.
Both homologues were shown to inhibit acid-sensing ion channels (ASICs), a family of proton-gated ion channels involved in nociception [14]. More specifically, mambalgins block ASIC1a in the central nervous system and ASIC1b/ASIC2 in peripheral neurons. Analgesic activity was demonstrated in rodents based on tail-flick and paw-withdrawal tests; however, no such effect was noted in ASIC1a-knockout mice, confirming their channel specificity [14]. Mambalgin use is associated with slower development of analgesic tolerance than opioids. Although mambalgins share certain 3FTx fold structural features with classical neurotoxins like α-bungarotoxin or α-cobratoxin, such as the three-loop architecture, β-sheet content, their size, and stabilization by disulfide bonds, they exhibit low sequence homology (<50%) [107,110]. Mambalgins lack cytotoxic effects and do not interact with nicotinic acetylcholine receptors, unlike typical neurotoxins that induce paralysis [110,111,112].
They primarily exert an analgesic effect through a non-opioid mechanism, i.e., by inhibition of ASICs. Structurally, they are similar to unconventional or weak 3FTx, characterized by an extended second loop and shortened first and third loops [14,110]. Three isoforms have been identified: mambalgin-1, -2 and -3. Mambalgin-2 differs from mambalgin-1 by the replacement of a tyrosine residue (Tyr) with a phenylalanine (Phe) at position 4. Mambalgin-3 also possesses Phe at position 4, with an additional replacement of threonine (Thr) with isoleucine (Ile) at position 23 [113,114]. These minor sequence variations may significantly affect their binding affinities and selectivity toward different ASIC subtypes, influencing their analgesic potency and pharmacokinetics.
While other structurally similar peptides targeting ASICs may exist in black mamba venom, they have not yet been fully isolated or characterized [14,112]. Interestingly, despite the structural similarity of mambalgins to other ASIC-blocking peptides such as PcTx1 (from Psalmopoeus cambridgei) or APETx2 (from Anthopleura elegantissima), they share no sequence homology, highlighting the diversity of ASIC-targeting mechanisms across venomous species [14,111,112].
6.2. Acid-Sensing Ion Channels (ASICS)—Structure, Function, and Biological Significance
Acid-sensing ion channels are proton-gated, voltage-insensitive sodium channels that belong to the degenerin/epithelial sodium channel (DEG/ENaC) family. They are mainly expressed in the central and peripheral nervous systems, but they can also be found in other tissues, such as the heart. These ASICs play crucial roles in many physiological and pathological processes, including pain perception, mechanotransduction, synaptic plasticity, and neuroinflammation. Acid-sensing ion channels were first sequenced in 1996, initiating a new era of research into their structure and function [115,116,117,118,119,120,121]. They are encoded by five homologous genes that undergo alternative splicing, giving rise to multiple isoforms, with the primary human ASIC subunits being ASIC1 (ASIC1a, ASIC1b), ASIC2 (ASIC2a, ASIC2b), ASIC3, ASIC4, and ASIC5 [115,121,122,123,124]. The ‘a’ and ‘b’ isoforms of ASIC1 and ASIC2 differ mainly in the N-terminal portion of the protein [116,121]. The most studied subunits in humans are ASIC1a, ASIC1b, ASIC2a, and ASIC3. In humans, homology between ASIC subunits ranges from 17% to 64% [121].
Each ASIC subunit consists of 500–560 amino acids organized into three main domains: an extracellular domain (ECD), two transmembrane helices (TMD1 and TMD2), and short cytoplasmic N- and C-terminal regions [115,117,118,121]. The ECD, which constitutes about 70% of the total protein mass, is responsible for proton sensing and channel activation. It has a complex structure resembling a hand, composed of the palm, thumb, finger, wrist, and β-ball domains: the palm domain, formed by seven antiparallel β-sheets, serves as the structural scaffold, the finger domain, containing several antiparallel β-sheets stabilized by disulfide bridges, participates in proton sensing, the β-ball domain stabilizes the trimer in the closed state and the thumb domain undergoes conformational changes during channel activation. The ECD is also connected to the transmembrane helices by the wrist domain, which transmits conformational changes initiated by protons binding to residues in the thumb and finger domains (tyrosine, tryptophan, proline, glutamic acid and aspartic acid); these signals are transmitted via the wrist domain to TMD1 and TMD2, resulting in channel opening and Na+ influx [115,116,117,118,119,121,122]. The channel remains closed at neutral pH (~7.4) and opens at acidic pH (6.5–5.0). Prolonged exposure to low pH leads to desensitization, preventing excessive activation.
An ion-conducting pore is formed by TMD1 and TMD2. TMD1 stabilizes the channel in the lipid bilayer and interacts with the wrist domain to allow ion passage, while TMD2 lines the pore and regulates gating, forming a hydrophobic barrier in the closed state. The pore loop (P-loop) between TMD1 and TMD2 acts as a selectivity filter. It contains the GxxS motif forming a “GAS strip” (Gly443, Ala444, Ser445 in ASIC1); this serves as a negatively charged environment allowing selective Na+ conductance [19,115,117,118,121,122]. The short cytoplasmic N- and C-terminal regions contain regulatory motifs involved in desensitization and interactions with signalling proteins such as PSD-95 and PICK1. Mutations in the N-terminal region can alter ion selectivity, affecting Na+ permeability [121].
In summary, ASIC function relies on coordinated interactions between its domains: the finger domain detects protons, the thumb undergoes conformational changes upon binding, the wrist transmits the signal to TMD1 and TMD2, the β-ball stabilizes the closed state, and the transmembrane domains form the Na+-selective pore. The cytoplasmic termini modulate desensitization and protein interactions, ensuring proper channel regulation under physiological and pathophysiological conditions [115,116,117,118,119,121,122]. The structure and mechanism of action of these acid- sensing ion channels [125,126,127,128,129,130,131] is shown in Figure 3.
Figure 3.
Mechanism of mambalgin action on ASIC1. Created with © 2025 BioRender. Abbreviations: ASIC1—acid sensing ion channel subunit 1; NMDAR—N-methyl-D-aspartate receptor; VGSC—Voltage-gated sodium channel.
7. Genetic Recombination Techniques for the Mambalgin Protein as a Selective ASIC1a Channel Blocker: From Expression to Anticancer Applications
A recombinant form of mambalgin-1 was produced using the PVX (potato virus X) vector [132]. Protein production was achieved in the model plant Nicotiana benthamiana [133,134]. The plant codon-optimized PVX-Mambalgin-1 construct was introduced into Agrobacterium tumefaciens GV3101 [135] and used to agroinfiltrate N. benthamiana leaves [136,137]. Protein expression was confirmed by Western blot and SDS-PAGE, and recombinant protein concentration was quantified using a His-Tag ELISA kit. MTT assays found mambalgin-1 to be cytotoxic against SH-SY5Y neuronal cancer cells but not MCF7 breast cancer cells [138,139]; indeed, proton-gated ASIC1a channels are present in SH-SY5Y neuronal cells but absent in MCF7 cells [132]. The findings demonstrate that the PVX system is an efficient, scalable platform for producing therapeutic peptides, and that plant-based bioreactors are suitable for recombinant protein production, and suggest that modified animal toxins, such as mambalgin-1, could serve as novel anticancer agents.
Recombinant mambalgin-2 [140] has been found to inhibit the proliferation of melanoma cells via ASIC ion channels, specifically the ASIC1a/α-ENaC/γ-ENaC heterocomplex. Acidification of the tumor microenvironment promotes proliferation, migration, and invasiveness of metastatic melanoma cells, with high channel expression associated with poor prognosis [141,142]. The mambalgin-2 protein was produced by cloning into an E. coli expression system [143]. Its selective action on ASICs decreased pro-oncogenic factors, including CD44, Frizzled 4, and SNAI phosphorylation, inducing apoptosis in metastatic melanoma cells while sparing Het-1A keratinocytes (EC50 ~37 nM vs. ~1000 nM). A mutant mambalgin variant (Leu32Ala), expressed in E. coli [144], showed reduced activity against melanoma cells, confirming ASIC1a as the primary target. These findings suggest that recombinant mambalgin-2 represents a promising therapeutic strategy or adjunct to conventional melanoma treatment. These findings underscore the value of genetic engineering for producing large quantities of pure protein for pharmacological research.
Another study investigated the effect of recombinant mambalgin-2 on glioma cells [112]. The peptide selectively blocks the ASIC1a channel, which is highly expressed in U251 MG and A172 glioma cells but absent in normal astrocytes. Given that glioma proliferation and invasion are promoted by an acidic tumor microenvironment, ASIC1a blockade provides a targeted therapeutic strategy. Mambalgin-2 inhibited glioma cell growth and induced apoptosis, as evidenced by reduced cyclin D1 phosphorylation and CDK activity; in addition, the recombinant protein, produced in E. coli [140,145,146,147], retained its structural and functional integrity [148]. Functional assays in Xenopus laevis oocytes [149] and U251 MG cells demonstrated inhibition of amiloride-sensitive currents with greater specificity than amiloride. Mutant variants with substitutions at Leu32 and Leu34 showed no effect on proliferation, confirming ASIC1a as the molecular target. These findings indicate that selective targeting of ASIC1a with recombinant mambalgin-2 may offer a promising strategy for glioma therapy. Further studies across additional cell lines could inform the development of protein-based therapeutics.
In addition, Bychkov et al. [150] report that mambalgin-2 blockage of the functional ASIC1a channels in the K562 leukemia cell line, which are activated at reduced pH, leads to significant cell cycle arrest in the G0/G1 phase and inhibition of cell proliferation. Molecular studies showed that mambalgin-2 treatment to be associated with reduced expression of cyclins D1 and E1 and their partner kinases CDK2 and CDK4 and increased cyclin inhibitor p21 level. These results confirm that mambalgins may be used not only as potential analgesics but also as innovative anticancer molecules with clinical significance for hemato-oncology patients.
Sudarikova et al. [151] also report that mambalgin-2 exhibited antitumor potential against lung cancer cells in vitro. The peptide selectively bound to ASIC1/α-ENaC/γ-ENaC heterotrimers, resulting in decreased MAPK/ERK and AKT proliferative pathway activity. Consequently, a significant reduction in the in vitro proliferation and migration of A549, metastatic Lewis P29 cells and WI-38 cancer cells was observed, as well as inhibition of tumor growth in a mouse lung adenocarcinoma model. No growth restriction was also observed for normal fibroblasts. These results indicate that mambalgins represent an interesting group of candidates for the development of targeted therapies in lung cancer oncology.
8. Fasciculin
8.1. Characteristics of Fasciculins
Fasciculins are small, highly toxic proteins belonging to the three-finger toxin (3FTx) family. They represent one of the major components of black mamba venom alongside dendrotoxins (~60%) and other three-finger neurotoxins (~30%), including alpha-neurotoxins and mambalgins [152]. Fasciculins inhibit acetylcholinesterase, leading to excessive accumulation of acetylcholine at neuromuscular junctions, which induces involuntary muscle contractions (fasciculations) thus paralyzing the prey. The name fasciculin derives from the Latin fasciculus (bundle) and the typical protein suffix-in, reflecting their ability to provoke tremors in small bundles of muscle fibers [153,154]. To date, four distinct forms of fasciculin have been identified in mamba venoms: Fasciculin-1 (FAS1), Fasciculin-2 (FAS2, formerly F7 toxin), Fasciculin-3 (FAS3, formerly Toxin C), and Fasciculin-4 (FAS4), with Fasciculin-3 being predominant in black mamba venom. Fasciculin-1 and -2 are composed of 61 amino acids and differ by one to three residues, with molecular weights of 6.765 kDa and 6.735 kDa, respectively [15,16]. Their globular structure is maintained by four disulfide bridges (Cys3–Cys22, Cys17–Cys39, Cys41–Cys52, Cys53–Cys59), which stabilize the three-finger motif [155,156,157,158]. The protein exhibits a dipolar character, with negatively charged residues concentrated at the C-terminal region and positive charges in the central core [158].
Fasciculins were first isolated in 1983 and their structure was determined by crystallography (PDB 1FAS) at 1.8 Å resolution [153,159]. Unlike classical enzyme inhibitors, they do not directly access the active site of acetylcholinesterase, but rather bind at a peripheral site. Clinically, envenomation by D. polylepis is associated with neurological symptoms deriving from the combined action of fasciculins and the other venom components; these include fasciculations, chest tightness, paresthesia, tachypnea and dysarthria [160]. Phylogenetically, fasciculins are structurally related to other α-neurotoxins, such as erabutoxin b, and cardiotoxins, including cardiotoxin VII4, highlighting the conserved nature of the three-finger motif among neurotoxic peptides. Their unique structural and functional properties make fasciculins a valuable model for studying protein–enzyme interactions. They may also form the basis of potential pharmacological applications in Alzheimer’s disease and other conditions associated with cholinergic deficiency; they may be suitable candidates for the design of AChE inhibitor drugs and in research on neuromuscular transmission and synaptic physiology [155,156,157,160].
8.2. Mechanism of Fasciculin Action
Fasciculin exerts its neurotoxic properties by inhibiting acetylcholinesterase (AChE), which is responsible for the breakdown of acetylcholine at neuromuscular synapses. Thus, results in the accumulation of acetylcholine in the synapses, causing muscle stiffness, paralysis, and ultimately respiratory failure and death. However, as Elapidae snake neurotoxins cannot cross the blood–brain barrier, these effects are restricted to the peripheral nerves. Fasciculins are among the most potent inhibitors in mammals and fish, but their activity is reduced in insects (e.g., Musca domestica), reptiles (e.g., cobra), and birds: the acetylcholinesterases of these species lack two conserved peripheral anionic residues which significantly reduces binding affinity. Fasciculin has been tested in vitro on human erythrocytes, rat muscle, guinea pig intestine and uterus, as well as on Electrophorus electricus in vivo [16].
The sensitivity of different AChEs to fasciculins varies depending on the tissue and protein concentration (from 10 to 30% inhibition at low concentrations ≤ 0.5 nM to 90–110% inhibition at toxic concentrations). This effect is reversible by atropine [161]. Fasciculin does not directly block the catalytic center of AChE but interacts with its surface by binding to the so-called Peripheral Anionic Site (PAS) in a 1:1 stoichiometry, creating hydrophobic and electrostatic interactions between fasciculin loops and PAS residues. This site is defined by amino acids such as Trp286 and two tyrosines, Tyr72 and Tyr124 [162]. Binding to the PAS is believed to be directed, as indicated by its displacement of the probe propidium, indicating higher affinity. After binding, it prevents access of acetylcholine to the catalytic site, this significantly slowing its degradation without physically blocking the active site [163,164].
Fasciculin has a three-loop structure. Arginine at position 11 (Loop I) is a potential anchor point. Loop II contains five positively charged residues; these are partially compensated by anionic residues in Loop III, which stabilize the complex through electrostatic and steric interactions with AChE. Unlike other toxins, charge compensation occurs between different loops rather than within the same loop. These structural and docking studies have paved the way for experimental verification and toxin/antitoxin engineering [165]. Marchot indicate that fasciculin binding to the PAS of AChE, located at the entrance to the narrow catalytic trench on the surface; the bound enzyme can be visualized as a horseshoe, encompassed by the fasciculin three-finger fold. Penetrating the PAS region, it engages in electrostatic and hydrophobic interactions with amino acid residues, mechanically and electrostatically blocking access to the catalytic trench, preventing acetylcholine from reaching the active site (Ser200-His440-Glu327) [166,167].
Fasciculin slows substrate hydrolysis by restricting diffusion into the trench rather than directly blocking the catalytic triad. Researchers indicate the residues involved in these interactions [160,168]. One is Trp279 (Torpedo AChE numbering), whose chemical modification nearly completely negates fasciculin activity. Another is Trp86, where fasciculin may exert allosteric effects; fasciculin has also been found to be an activator for some substrates in Trp86 → Ala mutants. Mutagenesis analyses also indicate that Trp286, Tyr72, and Tyr124 strongly impact binding, with alterations significantly weakening toxin affinity [169].
When complexed, AChE and fasciculin share a ~2000 Å2 contact area [170]; the complex demonstrates high complementarity and a low dissociation constant [171]. The dipole moments of both molecules align, and fasciculin seals the narrow gorge leading to the active site; Loop I points down the outer surface of the gorge, Loop II penetrates the trench, stacking Met33 (fasciculin) against Trp279 (AChE) and Loop III rests in contact with the C-terminal residue [172]. The carboxyl groups of fasciculin do not participate in binding [173]. This configuration, governed by charged residues rather than intermolecular bonds, determines the specificity of fasciculin. Fasciculin 2 mainly acts by altering the active-site conformation in the ternary complex, which can slow proton transfer during enzyme acylation. Therapeutic strategies targeting AChE are assessed according to the allosteric inhibitory role of PAS [174].
Binding has been found to decrease the association (k12) and dissociation (k21) rate constants of fasciculin by more than three orders of magnitude (from 8 × 108 → 1 × 105 M−1 s−1 for k12, and 750 → 0.4 s−1 for k21), indicating steric blockade of substrate entry and acylation site exit [163]. Spatial multimedia models by Tai et al. indicate fasciculin binding at the AChE active trench entrance, constricting access and mechanically restricting substrate entry, with this configuration being stabilized by polar and hydrophobic residue interactions. There are two pathways for terminating the catalytic reaction (Thr75) and an alternative (Tyr449) [175].
An in silico and experimental study was performed with the aim of increasing the affinity and specificity of fasciculin for Torpedo californica AChE [176]. Of the 13 mutated residues generated by ORBIT (the protein redesign program), five retained the necessary polar contacts. Individually, of these five increased affinity seven-fold. The remaining residues unexpectedly retained them, significantly increasing the cumulative effects. Increased affinity was found to correlate with interaction energy differences rather than total protein energy; this data may be valuable when designing inhibitors via protein and genetic engineering [177].
8.3. The Use of Fasciculin in Medical Research
In addition to mambalgin, black mamba venom also contains fasciculin: another protein with medically significant properties associated with its potential neurological effects, and which may also influence pain transmission [178]. It has been proposed to have potential value in the indirect treatment of Alzheimer’s disease [179,180,181,182,183,184,185]. This progressive neurodegenerative disorder, characterized by the loss of nerve cells, is considered a major lifestyle-related disease. In 2021, it is estimated that there were 57 million people worldwide living with dementia, of which 60–70% were cases of Alzheimer’s disease (WHO, 2021) [186]. Physiologically, the disease is associated with deposition of abnormal beta-amyloid and tau protein structures in the brain, along with the loss of cholinergic neurons, leading to the formation of neurofibrillary plaques and tangles. Currently, while some pharmacological approaches targeting reduced acetylcholine synthesis and psychosocial care exist, Alzheimer’s disease remains incurable and only symptomatic and palliative treatment is possible [187,188,189,190,191].
Toiber et al. investigated the role of an alternative acetylcholinesterase (AChE) isoform, N-AChE (N-terminal acetylcholinesterase), in neuronal apoptosis [179]. Using a combination of neural cell lines and molecular and histological analyses, it was found that N-AChE overexpression induces apoptosis via the caspase cascade, i.e., activation of Tau kinase GSK3, Tau hyperphosphorylation, and by altering mitochondrial membrane potential. Fasciculin was observed to act as a specific AChE inhibitor, thus separating the enzymatic function of AChE from its signaling role in apoptosis. It was found N-AChE-S-induced cell death could be prevented primarily through inhibition of GSK3 or caspases, by forced overexpression of anti-apoptotic Bcl2 proteins, and by AChE silencing
These findings support the potential of AChE inhibitor therapy in early-stage Alzheimer’s disease, which is in line with the cholinergic hypothesis. Briefly, by inhibiting the degradation of acetylcholine (ACh), AChE inhibitors increase its availability in the brain, thus compensating for ACh loss due to cholinergic neuron death [192].
Fasciculin not only inhibits the activity of AChE but also modulates its interactions with other molecules, including amyloid-β (Aβ). Hu et al. used it as a fluorescent marker to track AChE transport in neurons exposed to Aβ. It was found that AChE labeled with Fasciculin-2 was transported to intracellular vesicles, primarily late endosomes and early lysosomes, confirmed by the LAMP-1 marker. However, in the presence of exogenous Aβ, accumulation increased and shifted from the perinuclear region to the peripheral cytoplasm. Amyloid-β raises AChE levels by reducing degradation and enzyme release and by disrupting intracellular trafficking, potentially causing enzyme accumulation in abnormal locations. Impaired AChE transport to lysosomes may promote neurodegeneration by inter alia neurotoxin accumulation. As with fasciculin, blocking the enzyme’s active site offers dual therapeutic benefit by simultaneously inhibiting AChE activity and reducing amyloid-β deposition. Substances based on fasciculin may elicit fewer adverse effects than conventional treatments by acting allosterically, rather than by directly blocking the catalytic center [180].
Nachon et al. determined the crystal structure of the hAChE–FAS-2 complex, comprising human acetylcholinesterase (hAChE) in complex with fasciculin II (FAS-2) and a hydroxylated derivative of huprine [181]. It was found that fasciculin bound to PAS, structurally blocking substrate access. FAS-2 served as a reference ligand for studying PAS, thus enabling analysis of dual inhibitors acting on both PAS and the catalytic site. This can facilitate the development of multitarget-directed ligands (MTDLs) that function as AChE inhibitors and Aβ aggregation blockers [193,194].
An in silico study evaluated 15 snake venom toxins, including FAS-2, as potential AChE inhibitors for Alzheimer’s therapy. It was found that by using FAS-2 as a model, it was possible to identify ligands with similar binding potential [182].
A study of embryonic mouse AChE found it to be potentially analogous to pathological AChE in Alzheimer’s disease, due to it showing altered PAS and reduced binding affinity. Two molecular forms appear to play a role in mouse brain development: a monomeric (G1) and a tetrameric (G4) form. Of these, the G1 form exhibited lower binding and enzymatic activity, suggesting it may play a role in amyloid plaques and could represent a therapeutic target [183]. Dajas et al. confirmed two types of AChE in rat substantia nigra via fasciculin microinfusion. Fasciculin caused strong, localized AChE inhibition (~87%), without cell death or changes in dopamine, demonstrating that the enzyme functions independently of cholinergic transmission [184].
Anderson et al. report that fasciculin neither affects presynaptic transmitter release nor blocks postsynaptic receptors in mouse diaphragm preparations [185]. Blasina et al. found FAS-II to influence chick retinal development, resulting in significant morphological changes without toxic effects; this supports the hypothesis that PAS inhibitors influence non-cholinergic neurodevelopmental processes [195].
Research into fasciculin has been supported through genetic engineering and proteomics. Marchot et al. resolved the crystal structure of mouse AChE-fasciculin II and identified the residues that play a crucial role in the interaction by extensive mutagenesis; the results enabled the design of allosteric AChE inhibitors for Alzheimer’s therapy [196]. Similarly, da Silva Gonçalves et al. used fasciculin as a template to design AChE inhibitors. This resulted in the design of small-molecule analogs that both inhibit AChE and prevent amyloid-β aggregation, and which may represent next-generation Alzheimer’s drugs [197]. The mechanism of action of fasciculin is summarized in Figure 4.
Figure 4.
Mechanism of acetylcholinesterase inhibition. Created with https://www.biorender.com/ (accessed on 6 October 2025). Abbreviations: Co-A—Coenzyme A; SNAP25—Synaptosomal-Associated Protein (25 kDa).
9. Dendrotoxin
9.1. Characteristics of Dendrotoxins
Dendroaspis venom also contains dendrotoxins (originally named C13S2C3) [8,198]. These homologous proteins have been isolated from several mamba species: α-dendrotoxin isoforms (α, β2, γ, and δ) from the eastern green mamba (Dendroaspis angusticeps) [199,200], dendrotoxin I and dendrotoxin K from the black mamba (Dendroaspis polylepis) [8,201], and Dv14 from the western green mamba (Dendroaspis viridis) [200]. Dendrotoxins are potent presynaptic neurotoxins that bind to the nodes of Ranvier in motor neurons and block voltage-gated potassium (K+) channels [198]; this blockage prevents proper repolarization of neurons after an action potential, resulting in excessive acetylcholine release at neuromuscular junctions, resulting in muscle hyperexcitability, leading to paralysis and potentially, fatal respiratory failure [201,202].
Despite their high toxicity, dendrotoxins demonstrate high potency and selectivity, and are widely used in neurobiology to study potassium channels and nerve conduction [199,200]. Each mamba species produces a unique set of dendrotoxins with different amino acid sequences and K+ channel affinities [199,200]: of these, α-dendrotoxins are the most widely studied and are selective for Kv1.1 and Kv1.2 channels [200], β-dendrotoxins have a different binding profile and affect other Kv channel variants [199], while κ-dendrotoxins are particularly potent against Kv1.2 channels and are primarily found in green mamba venom [200]. Functional classification is based on the specific potassium channels targeted, e.g., dendrotoxin K is selective for Kv1.1, κ-dendrotoxin for Kv1.2 or Kv1.6, while others exhibit a broader spectrum, blocking multiple channel subtypes [198,200].
The ability of dendrotoxins to inhibit repolarization after action potentials by selective blockage of potassium channels makes them invaluable in research into potassium channel physiology, neuronal excitability and synaptic transmission; they are also suitable for modeling neurological disorders related to ion channel dysfunction. Their specificity and high potency allow precise study of neuronal conduction and the role of potassium channels in both normal and pathological conditions [198,200,202].
9.2. Structure of Dendrotoxins
Dendrotoxins are small proteins with a mass of approximately 7 kDa, being typically composed of 57–60 amino acids [8,203,204]. They are classified as Kunitz-type protease inhibitors, which act on proteolytic enzymes such as trypsin and chymotrypsin, as well as Alzheimer’s amyloid precursor protein (APP) [205] and tissue factor pathway inhibitor (TFPI). However, the primary function of a dendrotoxin, is not enzyme inhibition but blocking voltage-gated potassium (K+) channels [206].
Dendrotoxin structure is stabilized by three disulfide bridges; this arrangement confers resistance to denaturation and proteolysis. These Kunitz domains, comprising two short α-helices and a three-stranded β-sheet, have been utilized as scaffolds for the development of biopharmaceutical drugs [207,208,209]. Dendrotoxins are typified by a compact, spherical shape and the presence of a specific “inhibitor” loop that interacts with the outer part of the potassium channel, often near the outer pore gate. The amino acid residues within this loop determine the selectivity of a dendrotoxin for a particular potassium channel subtype, e.g., DTX-K and DTX-I correspond to Kv1.1 and Kv1.2 [210].
Structurally, a two-turn α-helix is located near the C-terminus, and a short 310-helix near the N-terminus, with the central region occupied by a double-stranded, antiparallel β-sheet, connected by a β-turn (residues 27–39 in DTX-I numbering), which is essential for channel-blocking activity; these features, α-helices, β-sheets and bends are stabilized by abundant lysine and arginine residues [8,17,203,204,211,212,213]. The protein conformation is kept rigid and stable by three pairs of disulfide bridges (-S-S-), which confer resistance to degradation, high temperature and enzymatic digestion. In DTX-I, the cysteine residues form obligatory bridges at C7-C57, C16-C40, and C32-C53 [8,17,211,212].
Dendrotoxins are basic, with a high concentration of positively charged residues forming cationic domains critical for potassium channel binding. For instance, dendrotoxin I contains seven arginines, seven lysines, and three glutamates, with clusters of positive charges in the β-turn region (Lys26, Lys27, Lys28), near the C-terminus (Arg52, Arg53, Arg54, Lys57), and near the N-terminus (Arg2, Arg3, Lys3). These residues play a major role in binding to potassium channels and determining channel selectivity [210].
9.3. Mechanism of Dendrotoxin Action
Dendrotoxins act through the selective and reversible blockade of voltage-gated potassium channels from the Kv1 family, primarily Kv1.1, Kv1.2, and Kv1.6, located on the presynaptic membrane of neurons, especially at neuromuscular junctions and near the nodes of Ranvier. Dendrotoxins bind to the external part of the channel pore, stabilizing its closed state and preventing the efflux of K+ ions during the repolarization phase of the action potential, thereby prolonging the action potential. This leads to extended depolarization of the presynaptic membrane, suppressing the fast potassium current (f1), and prolonging the opening of voltage-gated calcium channels (Ca2+), resulting in excessive Ca2+ influx into the nerve terminal. Elevated intracellular Ca2+ levels trigger an increased release of the neurotransmitter acetylcholine (ACh) into the synaptic cleft, causing prolonged muscle excitation, followed by muscle fatigue and paralysis. Electrophysiological recordings show increased amplitude and frequency of terminal potentials. The toxic effects arise from hyperstimulation of the neuromuscular system, manifesting as tremors, spasms, and, in severe cases, paralysis due to receptor desensitization or impaired muscle repolarization. Loss of control over respiratory muscles can, if untreated, result in death by asphyxiation. Structural studies indicate that dendrotoxin binds eccentrically to the Kv channel, interacting with the channel turret and two adjacent subunits without fully occluding the pore. This binding is reversible and characterized by high affinity (nanomolar Ke) and slow dissociation from the channel [198,213,214,215,216,217,218].
9.4. The Use of Dendrotoxin-K in Medical Research
Dendrotoxin-K (DTX-K) is a highly selective inhibitor of Kv1.1 potassium channels. It has been widely used as a precise research tool in neurophysiology, oncology, cardiology, and gastrointestinal studies. Its mechanism involves blocking K+ efflux, leading to prolonged membrane depolarization, modulation of cellular excitability, and alterations in synaptic transmission [215].
In Oncology research, DTX-K has been shown to inhibit tumor cell proliferation. Jeon et al. demonstrated that Kv1.1 channel blockade in gefitinib-resistant H460 cells significantly reduced cell survival and caused G1 phase cell cycle arrest, indicating inhibition of the G1/S transition. This effect was confirmed in vivo using xenograft models in nude mice, where direct intratumoral injection of DTX-K significantly reduced tumor growth [219]. Jang et al. also confirmed the medical usefulness of DTX-K, observing a 72–84% reduction in tumor growth in A549 xenografts after 72 h of treatment. Molecular analysis revealed increased expression of cyclin-dependent kinase inhibitors (p21, p27, p15) and decreased cyclin D3 levels, confirming G1/S cell cycle blockade. In addition to its anti-tumor effects, DTX-K exhibits immunomodulatory properties [220]. Fellerhoff-Losch et al. [221] showed that selective Kv1.1 blockade in CD4+ T lymphocytes induces strong TNF-α secretion independent of classical TCR/CD3 activation, without affecting IFN-γ, IL-4, or IL-10 levels. This effect involves activation of the non-canonical NF-κB pathway, suggesting potential applications in cancer immunotherapy and chronic inflammatory conditions. In the nervous system, DTX-K influences GABAergic transmission in preganglionic neurons of the paraventricular nucleus (PVN), modulating nitric oxide (NO) signaling via the cGMP/PKG pathway [222]. This mechanism may play a role in regulating blood pressure, heart rate, and sympathetic overactivity. In the gastrointestinal system, DTX-K enhances intestinal peristalsis by stimulating acetylcholine and tachykinin release from enteric neurons [223,224]. In the interstitial cells of Cajal (ICC), Kv1.1 blockade modulates slow waves and rhythmic contractile activity [225].
DTX-K also has relevance in neurological and pain studies. Finnegan et al. [226] demonstrated that DTX-K blocks GABA inhibition by μ-opioid receptors in the amygdala, suggesting potential modulation of analgesic effects and emotional processes. In sensory neurons, DTX-K increases the number of action potentials and lowers the excitability threshold, highlighting its potential in developing novel analgesics for neuropathic pain [227,228]. Furthermore, in atrial myocytes, DTX-K prolongs action potentials, indicating that Kv1.1 may have a role in cardiac electrophysiology and potential impact on arrhythmias [229]. In pancreatic β-cells, DTX-K enhances insulin secretion in mice, suggesting possible applications in diabetes therapy [230].
In summary, dendrotoxin-K is a highly selective Kv1.1 potassium channel blocker that acts at both cellular and systemic levels, modulating tumor cell proliferation, immune function, neuronal and cardiac activity, and gastrointestinal motility. These properties make it not only a valuable research tool but also a promising starting point for developing new therapeutic strategies in oncology, immunotherapy, neurology, cardiology, and gastroenterology.
9.5. The Use of Dendrotoxin-I in Medical Research
Dendrotoxin-I (DTX-I) also shows potential medical applications, including in cancer research, due to specific inhibition of Kv1.1 channels. Research indicates that Kv1.1 regulation can play a role in understanding the dynamic control of potassium channel expression in glial cells. Increasing intracellular cAMP concentrations were found to significantly accelerate the degradation of Kv1.1 mRNA, thereby reducing Kv1.1 protein levels and the total potassium current in C6 glioma cells [231,232,233,234,235]. Dendrotoxin-I blocks up to 96% of the potassium current in glial cells, shifting the resting membrane potential from −40 mV to −7 mV. This indicates that Kv1.1 plays a key role in maintaining membrane polarization in these cells. Reducing the potassium current may have potential therapeutic applications in glioma by influencing tumor cell excitability and proliferation [131].
Wang et al. [236] report that C6 astrocytoma cells exhibit a delayed rectifier potassium current generated by RBK1 channels of the Kv1 family. Electrophysiological characterization using patch-clamp techniques revealed high sensitivity to specific blockers. One of the most potent inhibitors was found to be DTX-I, with an IC50 (half maximal inhibitory concentration) of 9 nM, indicating that RBK1 channels play a key role in K+ conduction. Hence, the observed potassium current appears to be directly associated with RBK1 homomer activity. This finding is crucial for understanding the role of K+ conductance in regulating membrane potential and excitability, and potentially, cell proliferation in glial tumors. Hashimoto examined serotonin (5-HT) neurons in the dorsal raphe nucleus (DRN) of control, stress-resistant, and “learned helplessness” (LH) male Sprague Dawley rats [237]. In the LH group, depolarization-induced firing was significantly reduced, despite normal subthreshold properties; however, this firing was restored to control levels by administration of DTX-I, which blocks Kv1.1, Kv1.2, and Kv1.6 channels. In another study, 5-HT neuronal activity was also restored following inhibition of these channels by ketamine treatment, indicating a potential therapeutic target. Pharmacological inhibition of dendrotoxin-I-sensitive Kv1 channels may thus help normalize serotonergic activity in affective disorders [238].
Treatment with DTX-I can also influence the nervous system and certain sensory organs, such as the auditory system. A study of three distinct potassium currents in rat ventral cochlear nucleus neurons by Rothman and Manis found that selective blockage of Kv1.1 and Kv1.2 channels by DTX-I (10–100 nM) facilitated functional differentiation of current types [239]. Similarly, Hamlet et al. demonstrated in chick nucleus laminaris neurons that DTX-I-mediated blockade of Kv1.1 and Kv1.2 alters postsynaptic potential characteristics and the frequency of spontaneous inhibitory potentials; this may have implications for treating disorders associated with abnormal neuronal electrical activity [240].
The cardiac effects of DTX-I were investigated in rat ventricular fibroblasts [241]. Patch-clamp recordings showed that DTX-I blocks depolarization-activated potassium currents; this may prove of value in the development of antiarrhythmic therapies and interventions aimed at limiting pathological cardiac remodeling [242]. Vanzolini et al. [243] note that DTX-I also interacts with acetylcholinesterase (AChE), stabilizing its activity in vitro. This suggests potential applications in diseases with impaired cholinergic signaling, such as Alzheimer’s disease or myasthenia gravis. Finally, DTX-I was also found to block the Kv1.1 and Kv1.2 channels in cerebellar Purkinje neurons [244,245], modulating repetitive firing without substantially prolonging single action potentials. These findings highlight the importance of DTX-sensitive potassium channels in limiting hyperexcitability and may aid in developing therapies for cerebellar disorders such as ataxia. The mechanism of action of dendroxins is summarized in Figure 5.
Figure 5.
Mechanism of dendotoxin action. Created with © 2025 BioRender. Abbreviations: DTX—Dendrotoxin; Kv—Voltage-gated potassium channel; ACh—Acetylcholine; A549—Adenocarcinomic human alveolar basal epithelial cells; CDKI—Cyclin-dependent kinase inhibitor protein; p21Waf1/Cip1—cyclin-dependent kinase inhibitor 1; p27Kip1—Cyclin-dependent kinase inhibitor 1B; p15INK4b—Cyclin-dependent kinase 4 inhibitor B; H460—human large cell lung carcinoma cell line; TNF-α—Tumor necrosis factor; CD4+—T helper cells; NF-κB—Nuclear factor kappa-light-chain-enhancer of activated B cells.
10. Conclusions, Limitations and Future Perspectives
The toxin proteins derived from Dendroaspis polylepis venom, such as mambalgins, fasciculins and dendrotoxins, represent a new generation of bioactive molecules with high preclinical potential. All are selective modulators of physiological and pathological pathways, and have been found to interact with particular molecular targets, such as ion channels (ASIC1a, Kv1.1–1.6) and enzymes (acetylcholinesterase).
Mambalgins are known for their powerful pain-relieving properties, which come from their ability to block ASIC1a channels; however, unlike opioids, they are not associated with unwanted side effects. In addition, they appear to have potential application in the treatment of gliomas, melanoma, leukemia, and lung cancer due to their ability to target cancer cells in an acidic microenvironment. Fasciculins are effective AChE inhibitors used in Alzheimer’s disease research and may have a role in multidirectional drugs. Dendrotoxins are able to influence potassium channels, making them candidates for treating cancer, neurological diseases, cardiovascular and gastrointestinal diseases, as well as immunotherapy.
However, there are significant limitations to using animal toxins in therapy. Their immunogenicity and potential toxicity are concerns, as is their lack of bioavailability and stability under physiological conditions. In addition, most of the data originates from preclinical in vitro and animal studies, which restricts their direct clinical application. While the design of recombinant alternatives is developing rapidly, problems still exist with post-translational modifications in heterologous expression systems.
It is worth emphasizing that the development of venom gland organoid technology opens new perspectives in toxin research. Venom-gland organoids provide an ethical, reproducible in vitro platform for producing biologically active venom components and for detailed functional and single-cell studies. This approach complements traditional isolation methods and recombinant techniques, enabling more controlled and reproducible production of bioactive venom proteins. Organoids have already been derived from several species, including, among others, Naja naja, Naja pallida, Naja nigricollis, Bungarus multicinctus, Bothrops jararaca, Bothrops atrox, Bothrops lanceolatus, and Echis coloratus, and have been analyzed for toxin expression and bioactive peptide production. This technology may provide a safer and more efficient source of research material, thereby facilitating the study of the therapeutic potential and translational applications of snake venom proteins [246,247].
Future research should focus on using protein engineering to optimize the structure of these proteins to increase their stability and selectivity, and to minimize side effects. A promising development is the creation of immunotoxins, which are conjugates of toxins and antibodies. These will allow for the precise delivery of therapeutic molecules to target cells, such as cancer cells. The use of mambalgins and dendrotoxins as components of combination therapies in oncology and neurology is also worth considering. To date, the focus has been primarily on recombinant antibodies neutralizing venom toxins or on using toxin scaffolds to design new binding proteins. However, while the concept of conjugating toxins to antibodies may be an interesting one, it remains in a preliminary phase, and its safety, immunogenicity, and efficacy require further validation. We note this potential in our manuscript, leaving its broader analysis to future, more specialized studies. Furthermore, the scope of translational research should be broadened, and phase I clinical trials aimed at assessing the safety and effectiveness of these molecules in humans should be initiated when possible.
In summary, animal toxins are generally extremely useful in research and treatment, and the proteins from Dendroaspis polylepis venom are particularly valuable biomedical tools. Thanks to recent advances in recombinant biotechnology and molecular pharmacology, there is an increasing possibility of converting venom toxins into and effective pharmaceuticals. However, before their therapeutic use can become a reality, it is necessary to overcome certain obstacles, including difficulties in standardizing venom proteins, ethical issues related to obtaining venom from animals, and the high potential production costs, in addition to the short half-life of many toxins and the complexity of approval processes.
Acknowledgments
The authors thank Helena Hubáčková, Safari Park Dvůr Králové, Dvur Kralove, Czechia, 2025 for a photo of a black mamba.
Author Contributions
Conceptualization, P.S. and T.K.; Formal analysis, M.M., M.K., P.S., P.R., B.K., M.S., J.P. and T.K.; Writing—original draft preparation, P.S., T.K., M.M., M.S. and J.P.; Writing—review and editing, J.P., M.S., P.R., B.K., M.M., T.K. and P.S.; Supervision—P.S. and T.K. All authors have read and agreed to the published version of the manuscript.
Institutional Review Board Statement
Not applicable.
Informed Consent Statement
Not applicable.
Data Availability Statement
Not applicable.
Conflicts of Interest
The authors declare no conflicts of interest.
Funding Statement
This research received no external funding.
Footnotes
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
References
- 1.Borzelleca J.F. Paracelsus: Herald of modern toxicology. Toxicol. Sci. 2000;53:2–4. doi: 10.1093/toxsci/53.1.2. [DOI] [PubMed] [Google Scholar]
- 2.Grandjean P. Paracelsus revisited: The dose concept in a complex world. Basic Clin. Pharmacol. Toxicol. 2016;119:126–132. doi: 10.1111/bcpt.12622. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Gantenbein U.L. Toxicology in the Middle Ages and Renaissance. Academic Press; Cambridge, MA, USA: 2017. Poison and its dose: Paracelsus on toxicology; pp. 1–10. [Google Scholar]
- 4.Robinson S.D., Norton R.S. Conotoxin gene superfamilies. Mar. Drugs. 2014;12:6058–6101. doi: 10.3390/md12126058. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Jin A.H., Muttenthaler M., Dutertre S., Himaya S.W.A., Kaas Q., Craik D.J., Lewis R.J., Alewood P.F. Conotoxins: Chemistry and biology. Chem. Rev. 2019;119:11510–11549. doi: 10.1021/acs.chemrev.9b00207. [DOI] [PubMed] [Google Scholar]
- 6.Antunes T.C., Yamashita K.M., Barbaro K.C., Saiki M., Santoro M.L. Comparative analysis of newborn and adult Bothrops jararaca snake venoms. Toxicon. 2010;56:1443–1458. doi: 10.1016/j.toxicon.2010.08.011. [DOI] [PubMed] [Google Scholar]
- 7.Serrano S.M., Oliveira A.K., Menezes M.C., Zelanis A. The proteinase-rich proteome of Bothrops jararaca venom. Toxin Rev. 2014;33:169–184. doi: 10.3109/15569543.2014.922581. [DOI] [Google Scholar]
- 8.Joubert F.J., Strydom D.J. Snake venom. The amino acid sequence of protein A from Dendroaspis polylepis polylepis (black mamba) venom. Hoppe Seylers Z. Physiol. Chem. 1980;361:1787–1794. doi: 10.1515/bchm2.1980.361.2.1787. [DOI] [PubMed] [Google Scholar]
- 9.Spawls S., Branch B. The Dangerous Snakes of Africa. Blandford; London, UK: 1995. [Google Scholar]
- 10.World Health Organization . Guidelines for the Management of Snakebites. 2nd ed. World Health Organization; Geneva, Switzerland: 2019. [Google Scholar]
- 11.Waheed H., Moin S.F., Choudhary M.I. Snake Venom: From Deadly Toxins to Life-saving Therapeutics. Curr. Med. Chem. 2017;24:1874–1891. doi: 10.2174/0929867324666170605091546. [DOI] [PubMed] [Google Scholar]
- 12.Petras D., Heiss P., Harrison R.A., Süssmuth R.D., Calvete J.J. Top-down venomics of the East African green mamba, Dendroaspis angusticeps, and the black mamba, Dendroaspis polylepis, highlight the complexity of their toxin arsenals. J. Proteom. 2016;146:148–164. doi: 10.1016/j.jprot.2016.06.018. [DOI] [PubMed] [Google Scholar]
- 13.Wang Y.Z., Xu T.L. Acidosis, acid-sensing ion channels, and neuronal cell death. Mol. Neurobiol. 2011;44:350–358. doi: 10.1007/s12035-011-8204-2. S2CID 15169653. [DOI] [PubMed] [Google Scholar]
- 14.Diochot S., Baron A., Salinas M., Douguet D., Scarzello S., Dabert-Gay A.S., Debayle D., Friend V., Alloui A., Lazdunski M., et al. Black mamba venom peptides target acid-sensing ion channels to abolish pain. Nature. 2012;490:552–555. doi: 10.1038/nature11494. [DOI] [PubMed] [Google Scholar]
- 15.Harvey A.L., Anderson A.J., Mbugua P.M., Karlsson E. Toxins from mamba venoms that facilitate neuroiluscular transmission. J. Toxicol. Toxin Rev. 1984;3:91–137. doi: 10.3109/15569548409097923. [DOI] [Google Scholar]
- 16.Anadón A., Martínez-Larrañaga M.R., Valerio L.G. Handbook of Toxicology of Chemical Warfare Agents. Academic Press; Cambridge, MA, USA: 2020. Onchidal and fasciculins; pp. 455–466. [Google Scholar]
- 17.Harvey A.L. Recent studies on dendrotoxins and potassium ion channels. Gen. Pharmacol. 1997;28:7–12. doi: 10.1016/S0306-3623(96)00173-5. [DOI] [PubMed] [Google Scholar]
- 18.Unterholzner S.J., Poppenberger B., Rozhon W. Toxin–antitoxin systems: Biology, identification, and application. Mob. Genet. Elem. 2013;3:e26219. doi: 10.4161/mge.26219. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Baron A., Waldmann R., Lazdunski M. ASIC-like, proton-activated currents in rat hippocampal neurons. J. Physiol. 2002;539:485–494. doi: 10.1113/jphysiol.2001.014837. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Karalliedde L. Animal toxins. Br. J. Anaesth. 1995;74:319–327. doi: 10.1093/bja/74.3.319. [DOI] [PubMed] [Google Scholar]
- 21.de Castro Figueiredo Bordon K., Cologna C.T., Fornari-Baldo E.C., Pinheiro-Júnior E.L., Cerni F.A., Amorim F.G., Anjolette F.A.P., Cordeiro F.A., Wiezel G.A., Cardoso I.A., et al. From animal poisons and venoms to medicines: Achievements, challenges and perspectives in drug discovery. Front. Pharmacol. 2020;11:1132. doi: 10.3389/fphar.2020.01132. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22.Smith J.J., Herzig V., King G.F., Alewood P.F. The insecticidal potential of venom peptides. Cell. Mol. Life Sci. 2013;70:3665–3693. doi: 10.1007/s00018-013-1315-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23.Nelsen D.R., Nisani Z., Cooper A.M., Fox G.A., Gren E.C., Corbit A.G., Hayes W.K. Poisons, toxungens, and venoms: Redefining and classifying toxic biological secretions and the organisms that employ them. Biol. Rev. 2014;89:450–465. doi: 10.1111/brv.12062. [DOI] [PubMed] [Google Scholar]
- 24.Koh D.C., Armugam A., Jeyaseelan K. Snake venom components and their applications in biomedicine. Cell. Mol. Life Sci. 2006;63:3030–3041. doi: 10.1007/s00018-006-6315-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Casewell N.R., Wüster W., Vonk F.J., Harrison R.A., Fry B.G. Complex cocktails: The evolutionary novelty of venoms. Trends Ecol. Evol. 2013;28:219–229. doi: 10.1016/j.tree.2012.10.020. [DOI] [PubMed] [Google Scholar]
- 26.Fry B.G., Roelants K., Champagne D.E., Scheib H., Tyndall J.D., King G.F., Nevalainen T.J., Norman J.A., Lewis R.J., Norton R.S., et al. The toxicogenomic multiverse: Convergent recruitment of proteins into animal venoms. Annu. Rev. Genom. Hum. Genet. 2009;10:483–511. doi: 10.1146/annurev.genom.9.081307.164356. [DOI] [PubMed] [Google Scholar]
- 27.Ondetti M.A., Rubin B., Cushman D.W. Design of specific inhibitors of angiotensin-converting enzyme: New class of orally active antihypertensive agents. Science. 1977;196:441–444. doi: 10.1126/science.191908. [DOI] [PubMed] [Google Scholar]
- 28.Bryan J. From snake venom to ACE inhibitor-The discovery and rise of captopril. Pharm. J. 2009;282:455. [Google Scholar]
- 29.Camargo A.C., Ianzer D., Guerreiro J.R., Serrano S.M. Bradykinin-potentiating peptides: Beyond captopril. Toxicon. 2012;59:516–523. doi: 10.1016/j.toxicon.2011.07.013. [DOI] [PubMed] [Google Scholar]
- 30.Frangieh J., Rima M., Fajloun Z., Henrion D., Sabatier J.M., Legros C., Mattei C. Snake venom components: Tools and cures to target cardiovascular diseases. Molecules. 2021;26:2223. doi: 10.3390/molecules26082223. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.Hawgood B.J. Maurício Rocha e Silva MD: Snake venom, bradykinin and the rise of autopharmacology. Toxicon. 1997;35:1569–1580. doi: 10.1016/S0041-0101(97)00008-1. [DOI] [PubMed] [Google Scholar]
- 32.Housley D.M., Housley G.D., Liddell M.J., Jennings E.A. Scorpion toxin peptide action at the ion channel subunit level. Neuropharmacology. 2017;127:46–78. doi: 10.1016/j.neuropharm.2016.10.004. [DOI] [PubMed] [Google Scholar]
- 33.Bhavya J., Francois N.N., More V.S., More S.S. Scorpion Toxin Polyptides as Therapeutic Agents: An Overview. Protein Pept. Lett. 2016;23:848–859. doi: 10.2174/0929866523666160630184635. [DOI] [PubMed] [Google Scholar]
- 34.Veiseh M., Gabikian P., Bahrami S.B., Veiseh O., Zhang M., Hackman R.C., Ravanpay A.C., Stroud M.R., Kusuma Y., Hansen S.J., et al. Tumor paint: A chlorotoxin:Cy5.5 bioconjugate for intraoperative visualization of cancer foci. Cancer Res. 2007;67:6882–6888. doi: 10.1158/0008-5472.CAN-06-3948. [DOI] [PubMed] [Google Scholar]
- 35.Al-Asmari A.K., Islam M., Al-Zahrani A.M. In vitro analysis of the anticancer properties of scorpion venom in colorectal and breast cancer cell lines. Oncol. Lett. 2016;11:1256–1262. doi: 10.3892/ol.2015.4036. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 36.Harrison P.L., Abdel-Rahman M.A., Miller K., Strong P.N. Antimicrobial peptides from scorpion venoms. Toxicon. 2014;88:115–137. doi: 10.1016/j.toxicon.2014.06.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Torres-Larios A., Gurrola G.B., Zamudio F.Z., Possani L.D. Hadrurin, a new antimicrobial peptide from the venom of the scorpion Hadrurus aztecus. Eur. J. Biochem. 2000;267:5023–5031. doi: 10.1046/j.1432-1327.2000.01556.x. [DOI] [PubMed] [Google Scholar]
- 38.N’Gouemo P., Rittenhouse A.R. Biophysical and pharmacological characterization of voltage-sensitive calcium currents in neonatal rat inferior colliculus neurons. Neuroscience. 2000;96:753–765. doi: 10.1016/S0306-4522(00)00006-3. [DOI] [PubMed] [Google Scholar]
- 39.Souza A.H., Ferreira J., Cordeiro M.D.N., Vieira L.B., De Castro C.J., Trevisan G., Reis H., Souza I.A., Richardson M., Prado M.A., et al. Analgesic effect in rodents of native and recombinant Phα1β toxin, a high-voltage-activated calcium channel blocker isolated from armed spider venom. Pain. 2008;140:115–126. doi: 10.1016/j.pain.2008.07.014. [DOI] [PubMed] [Google Scholar]
- 40.Rigo F.K., Trevisan G., Rosa F., Dalmolin G.D., Otuki M.F., Cueto A.P., de Castro Junior C.J., Romano-Silva M.A., Cordeiro M.d.N., Richardson M., et al. Spider peptide Phα1β induces analgesic effect in a model of cancer pain. Cancer Sci. 2013;104:1226–1230. doi: 10.1111/cas.12209. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Yan L., Adams M.E. Lycotoxins, antimicrobial peptides from venom of the wolf spider Lycosa carolinensis. J. Biol. Chem. 1998;273:2059–2066. doi: 10.1074/jbc.273.4.2059. [DOI] [PubMed] [Google Scholar]
- 42.Gao L., Zhang J., Feng W., Bao N., Song D., Zhu B.C. Pharmacological characterisation of spider antimicrobial peptides. Protein Pept. Lett. 2005;12:507–511. doi: 10.2174/0929866054395806. [DOI] [PubMed] [Google Scholar]
- 43.Aridoss G., Kim D.M., Kim J.I., Kang J.E. Ziconotide (ω-conotoxin MVIIA)—Efficient solid-phase synthesis of a linear precursor peptide and its strategic native folding. Pept. Sci. 2021;113:e24223. doi: 10.1002/pep2.24223. [DOI] [Google Scholar]
- 44.Miljanich G.P. Ziconotide: Neuronal calcium channel blocker for treating severe chronic pain. Curr. Med. Chem. 2004;11:3029–3040. doi: 10.2174/0929867043363884. [DOI] [PubMed] [Google Scholar]
- 45.Williams J.A., Day M., Heavner J.E. Ziconotide: An update and review. Expert Opin. Pharmacother. 2008;9:1575–1583. doi: 10.1517/14656566.9.9.1575. [DOI] [PubMed] [Google Scholar]
- 46.Safavi-Hemami H., Brogan S.E., Olivera B.M. Pain therapeutics from cone snail venoms: From Ziconotide to novel non-opioid pathways. J. Proteom. 2019;190:12–20. doi: 10.1016/j.jprot.2018.05.009. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 47.Rady I., Siddiqui I.A., Rady M., Mukhtar H. Melittin, a major peptide component of bee venom, and its conjugates in cancer therapy. Cancer Lett. 2017;402:16–31. doi: 10.1016/j.canlet.2017.05.010. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 48.Liu C.-C., Hao D.-J., Zhang Q., An J., Zhao J.-J., Chen B., Zhang L.-L., Yang H. Application of bee venom and its main constituent melittin for cancer treatment. Cancer Chemother. Pharmacol. 2016;78:1113–1130. doi: 10.1007/s00280-016-3160-1. [DOI] [PubMed] [Google Scholar]
- 49.Kong G.M., Tao W.H., Diao Y.L., Fang P.H., Wang J.J., Bo P., Qian F. Melittin induces human gastric cancer cell apoptosis via activation of mitochondrial pathway. World J. Gastroenterol. 2016;22:3186. doi: 10.3748/wjg.v22.i11.3186. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50.Jo M., Park M.H., Kollipara P.S., An B.J., Song H.S., Han S.B., Kim J.H., Song M.J., Hong J.T. Anti-cancer effect of bee venom toxin and melittin in ovarian cancer cells through induction of death receptors and inhibition of JAK2/STAT3 pathway. Toxicol. Appl. Pharmacol. 2012;258:72–81. doi: 10.1016/j.taap.2011.10.009. [DOI] [PubMed] [Google Scholar]
- 51.Liu S., Yu M., He Y., Xiao L., Wang F., Song C., Sun S., Ling C., Xu Z. Melittin prevents liver cancer cell metastasis through inhibition of the Rac1-dependent pathway. Hepatology. 2008;47:1964–1973. doi: 10.1002/hep.22240. [DOI] [PubMed] [Google Scholar]
- 52.Zhang S.F., Chen Z. Melittin exerts an antitumor effect on non-small cell lung cancer cells. Mol. Med. Rep. 2017;16:3581–3586. doi: 10.3892/mmr.2017.6970. [DOI] [PubMed] [Google Scholar]
- 53.Jeong Y.-J., Choi Y., Shin J.-M., Cho H.-J., Kang J.-H., Park K.-K., Choe J.-Y., Bae Y.-S., Han S.-M., Kim C.-H., et al. Melittin suppresses EGF-induced cell motility and invasion by inhibiting PI3K/Akt/mTOR signaling pathway in breast cancer cells. Food Chem. Toxicol. 2014;68:218–225. doi: 10.1016/j.fct.2014.03.022. [DOI] [PubMed] [Google Scholar]
- 54.Eze O.B., Nwodo O.F., Ogugua V.N. Therapeutic effect of honey bee venom. Proteins (Enzym.) 2016;1:48–53. [Google Scholar]
- 55.Kokot Z.J., Matysiak J., Kłs J., Kędzia B., Hołderna-Kędzia E. Application of Principal Component Analysis for evaluation of chemical and antimicrobial properties of honey bee (Apis mellifera) venom. J. Apic. Res. 2009;48:168–175. doi: 10.3896/IBRA.1.48.3.04. [DOI] [Google Scholar]
- 56.Low K.S., Gwee M.C., Yuen R., Gopalakrishnakone P., Khoo H.E. Stonustoxin: Effects on neuromuscular function in vitro and in vivo. Toxicon. 1994;32:573–581. doi: 10.1016/0041-0101(94)90205-4. [DOI] [PubMed] [Google Scholar]
- 57.Ghadessy F.J., Chen D., Kini R.M., Chung M.M., Jeyaseelan K., Khoo H.E., Yuen R. Stonustoxin is a novel lethal factor from stonefish (Synanceja horrida) venom: cDNA cloning and characterization. J. Biol. Chem. 1996;271:25575–25581. doi: 10.1074/jbc.271.41.25575. [DOI] [PubMed] [Google Scholar]
- 58.Low K.S., Gwee M.E., Yuen R., Gopalakrishnakone P., Khoo H.E. Stonustoxin: A highly potent endothelium-dependent vasorelaxant in the rat. Toxicon. 1993;31:1471–1478. doi: 10.1016/0041-0101(93)90212-2. [DOI] [PubMed] [Google Scholar]
- 59.Khoo H.E., Chen D., Yuen R. Role of free thiol groups in the biological activities of stonustoxin, a lethal factor from stonefish (Synanceja horrida) venom. Toxicon. 1998;36:469–476. doi: 10.1016/S0041-0101(97)00152-9. [DOI] [PubMed] [Google Scholar]
- 60.Gomes A., Bhattacharjee P., Mishra R., Biswas A.K., Dasgupta S.C., Giri B. Anticancer potential of animal venoms and toxins. Indian J. Exp. Biol. 2010;48:93. [PubMed] [Google Scholar]
- 61.Gopal G.J., Kumar A. Strategies for the production of recombinant protein in Escherichia coli. Protein J. 2013;32:419–425. doi: 10.1007/s10930-013-9502-5. [DOI] [PubMed] [Google Scholar]
- 62.Sørensen H.P., Mortensen K.K. Advanced genetic strategies for recombinant protein expression in Escherichia coli. J. Biotechnol. 2005;115:113–128. doi: 10.1016/j.jbiotec.2004.08.004. [DOI] [PubMed] [Google Scholar]
- 63.Li P., Anumanthan A., Gao X.G., Ilangovan K., Suzara V.V., Düzgüneş N., Renugopalakrishnan V. Expression of recombinant proteins in Pichia pastoris. Appl. Biochem. Biotechnol. 2007;142:105–124. doi: 10.1007/s12010-007-0003-x. [DOI] [PubMed] [Google Scholar]
- 64.De Schutter K., Lin Y.-C., Tiels P., Van Hecke A., Glinka S., Weber-Lehmann J., Rouzé P., Van de Peer Y., Callewaert N. Genome sequence of the recombinant protein production host Pichia pastoris. Nat. Biotechnol. 2009;27:561–566. doi: 10.1038/nbt.1544. [DOI] [PubMed] [Google Scholar]
- 65.Johnson E.A., Echavarri-Erasun C. The Yeasts. Elsevier; Amsterdam, The Netherlands: 2011. Yeast biotechnology; pp. 21–44. [Google Scholar]
- 66.O’Callaghan P.M., James D.C. Systems biotechnology of mammalian cell factories. Brief. Funct. Genom. Proteom. 2008;7:95–110. doi: 10.1093/bfgp/eln012. [DOI] [PubMed] [Google Scholar]
- 67.Targovnik A.M., Arregui M.B., Bracco L.F., Urtasun N., Baieli M.F., Segura M.M., Simonella M.A., Fogar M., Wolman F.J., Cascone O., et al. Insect larvae: A new platform to produce commercial recombinant proteins. Curr. Pharm. Biotechnol. 2016;17:431–438. doi: 10.2174/138920101705160303163947. [DOI] [PubMed] [Google Scholar]
- 68.Ikonomou L., Schneider Y.J., Agathos S.N. Insect cell culture for industrial production of recombinant proteins. Appl. Microbiol. Biotechnol. 2003;62:1–20. doi: 10.1007/s00253-003-1223-9. [DOI] [PubMed] [Google Scholar]
- 69.Burnett M.J., Burnett A.C. Therapeutic recombinant protein production in plants: Challenges and opportunities. Plants People Planet. 2020;2:121–132. doi: 10.1002/ppp3.10073. [DOI] [Google Scholar]
- 70.Egelkrout E., Rajan V., Howard J.A. Overproduction of recombinant proteins in plants. Plant Sci. 2012;184:83–101. doi: 10.1016/j.plantsci.2011.12.005. [DOI] [PubMed] [Google Scholar]
- 71.Kusnadi A.R., Nikolov Z.L., Howard J.A. Production of recombinant proteins in transgenic plants: Practical considerations. Biotechnol. Bioeng. 1997;56:473–484. doi: 10.1002/(SICI)1097-0290(19971205)56:5<473::AID-BIT1>3.0.CO;2-F. [DOI] [PubMed] [Google Scholar]
- 72.Conley A.J., Zhu H., Le L.C., Jevnikar A.M., Lee B.H., Brandle J.E., Menassa R. Recombinant protein production in a variety of Nicotiana hosts: A comparative analysis. Plant Biotechnol. J. 2011;9:434–444. doi: 10.1111/j.1467-7652.2010.00563.x. [DOI] [PubMed] [Google Scholar]
- 73.Kim J.Y., Kim Y.G., Lee G.M. CHO cells in biotechnology for production of recombinant proteins: Current state and further potential. Appl. Microbiol. Biotechnol. 2012;93:917–930. doi: 10.1007/s00253-011-3758-5. [DOI] [PubMed] [Google Scholar]
- 74.Demain A.L., Vaishnav P. Production of recombinant proteins by microbes and higher organisms. Biotechnol. Adv. 2009;27:297–306. doi: 10.1016/j.biotechadv.2009.01.008. [DOI] [PubMed] [Google Scholar]
- 75.Glick B.R., Patten C.L. Molecular Biotechnology: Principles and Applications of Recombinant DNA. John Wiley Sons; Hoboken, NJ, USA: 2022. [Google Scholar]
- 76.Smith L.A. Development of recombinant vaccines for botulinum neurotoxin. Toxicon. 1998;36:1539–1548. doi: 10.1016/S0041-0101(98)00146-9. [DOI] [PubMed] [Google Scholar]
- 77.Hill K.K., Xie G., Foley B.T., Smith T.J., Munk A.C., Bruce D., A Smith L., Brettin T.S., Detter J.C. Recombination and insertion events involving the botulinum neurotoxin complex genes in Clostridium botulinum types A, B, E and F and Clostridium butyricum type E strains. BMC Biol. 2009;7:66. doi: 10.1186/1741-7007-7-66. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 78.FitzGerald D.J., Kreitman R., Wilson W., Squires D., Pastan I. Recombinant immunotoxins for treating cancer. Int. J. Med. Microbiol. 2004;293:577–582. doi: 10.1078/1438-4221-00302. [DOI] [PubMed] [Google Scholar]
- 79.Akbari B., Farajnia S., Ahdi Khosroshahi S., Safari F., Yousefi M., Dariushnejad H., Rahbarnia L. Immunotoxins in cancer therapy: Review and update. Int. Rev. Immunol. 2017;36:207–219. doi: 10.1080/08830185.2017.1284211. [DOI] [PubMed] [Google Scholar]
- 80.Potala S., Sahoo S.K., Verma R.S. Targeted therapy of cancer using diphtheria toxin-derived immunotoxins. Drug Discov. Today. 2008;13:807–815. doi: 10.1016/j.drudis.2008.06.017. [DOI] [PubMed] [Google Scholar]
- 81.Shafiee F., Aucoin M.G., Jahanian-Najafabadi A. Targeted diphtheria toxin-based therapy: A review article. Front. Microbiol. 2019;10:2340. doi: 10.3389/fmicb.2019.02340. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 82.Wang Z., Wei M., Zhang H., Chen H., Germana S., Huang C.A., Madsen J.C., Sachs D.H., Wang Z. Diphtheria-toxin based anti-human CCR4 immunotoxin for targeting human CCR4+ cells in vivo. Mol. Oncol. 2015;9:1458–1470. doi: 10.1016/j.molonc.2015.04.004. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 83.Litzinger M.T., Fernando R., Curiel T.J., Grosenbach D.W., Schlom J., Palena C. IL-2 immunotoxin denileukin diftitox reduces regulatory T cells and enhances vaccine-mediated T-cell immunity. Blood J. Am. Soc. Hematol. 2007;110:3192–3201. doi: 10.1182/blood-2007-06-094615. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 84.Manoukian G., Hagemeister F. Denileukin diftitox: A novel immunotoxin. Expert Opin. Biol. Ther. 2009;9:1445–1451. doi: 10.1517/14712590903348135. [DOI] [PubMed] [Google Scholar]
- 85.Kreitman R.J., Pastan I. Antibody fusion proteins: Anti-CD22 recombinant immunotoxin moxetumomab pasudotox. Clin. Cancer Res. 2011;17:6398–6405. doi: 10.1158/1078-0432.CCR-11-0487. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 86.Reulen H.J., Suero Molina E., Zeidler R., Gildehaus F.J., Böning G., Gosewisch A., Stummer W. Intracavitary radioimmunotherapy of high-grade gliomas: Present status and future developments. Acta Neurochir. 2019;161:1109–1124. doi: 10.1007/s00701-019-03882-9. [DOI] [PubMed] [Google Scholar]
- 87.Wang B., Xie J., He H.Y., Huang E.W., Cao Q.H., Luo L., Liao Y.S., Guo Y. Suppression of CLC-3 chloride channel reduces the aggressiveness of glioma through inhibiting nuclear factor-κB pathway. Oncotarget. 2017;8:63788. doi: 10.18632/oncotarget.19093. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 88.Minea R., Swenson S., Costa F., Chen T.C., Markland F.S. Development of a novel recombinant disintegrin, contortrostatin, as an effective anti-tumor and anti-angiogenic agent. Pathophysiol. Haemost. Thromb. 2005;34:177–183. doi: 10.1159/000092419. [DOI] [PubMed] [Google Scholar]
- 89.Swenson S., Costa F., Ernst W., Fujii G., Markland F.S. Contortrostatin, a snake venom disintegrin with anti-angiogenic and anti-tumor activity. Pathophysiol. Haemost. Thromb. 2005;34:169–176. doi: 10.1159/000092418. [DOI] [PubMed] [Google Scholar]
- 90.Laustsen A.H., Lohse B., Gutiérrez J.M., Lomonte B., McCafferty J., Rasmussen A.R. Recombinant Antivenoms. University of Copenhagen; Copenhagen, Denmark: 2016. [Google Scholar]
- 91.Liu B.S., Jiang B.R., Hu K.C., Liu C.H., Hsieh W.C., Lin M.H., Sung W.C. Development of a broad-spectrum antiserum against cobra venoms using recombinant three-finger toxins. Toxins. 2021;13:556. doi: 10.3390/toxins13080556. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 92.Wang Y., Jing L., Xu K. A unique approach for high level expression and production of a recombinant cobra neurotoxin in Escherichia coli. J. Biotechnol. 2002;94:235–244. doi: 10.1016/S0168-1656(01)00429-1. [DOI] [PubMed] [Google Scholar]
- 93.Kulkeaw K., Sakolvaree Y., Srimanote P., Tongtawe P., Maneewatch S., Sookrung N., Tungtrongchitr A., Tapchaisri P., Kurazono H., Chaicumpa W. Human monoclonal ScFv neutralize lethal Thai cobra, Naja kaouthia, neurotoxin. J. Proteom. 2009;72:270–282. doi: 10.1016/j.jprot.2008.12.007. [DOI] [PubMed] [Google Scholar]
- 94.Castro J., Oliveira T., Silveira C., Caporrino M., Rodriguez D., Moura-Da-Silva A., Ramos O., Rucavado A., Gutiérrez J., Magalhães G., et al. A neutralizing recombinant single chain antibody, scFv, against BaP1, A PI hemorrhagic metalloproteinase from Bothrops asper snake venom. Toxicon. 2014;87:81–91. doi: 10.1016/j.toxicon.2014.05.017. [DOI] [PubMed] [Google Scholar]
- 95.Lomonte B., Leon G., Angulo Y., Rucavado A., Nunez V. Neutralization of Bothrops asper venom by antibodies, natural products and synthetic drugs: Contributions to understanding snakebite envenomings and their treatment. Toxicon. 2009;54:1012–1028. doi: 10.1016/j.toxicon.2009.03.015. Erratum in Toxicon 2010, 55, 1412–1413. [DOI] [PubMed] [Google Scholar]
- 96.Logtenberg T. Antibody cocktails: Next-generation biopharmaceuticals with improved potency. Trends Biotechnol. 2007;25:390–394. doi: 10.1016/j.tibtech.2007.07.005. [DOI] [PubMed] [Google Scholar]
- 97.Pastan I., Hassan R., Fitzgerald D.J., Kreitman R.J. Immunotoxin therapy of cancer. Nat. Rev. Cancer. 2006;6:559–565. doi: 10.1038/nrc1891. [DOI] [PubMed] [Google Scholar]
- 98.Bandaranayake A.D., Almo S.C. Recent advances in mammalian protein production. FEBS Lett. 2014;588:253–260. doi: 10.1016/j.febslet.2013.11.035. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 99.Foster K.A. Engineered toxins: New therapeutics. Toxicon. 2009;54:587–592. doi: 10.1016/j.toxicon.2009.01.037. [DOI] [PubMed] [Google Scholar]
- 100.Aalten M., Bakhuis C.F.J., Asaggau I., Wulfse M., van Binsbergen M.F., Arntz E.R.A.N., Troenokarso M.F., Oediet Doebe J.L.R., Mahamuud U., Belbachir L., et al. The clinical course and treatment of black mamba (Dendroaspis polylepis) envenomations: A narrative review. Clin. Toxicol. 2021;59:860–868. doi: 10.1080/15563650.2021.1943427. [DOI] [PubMed] [Google Scholar]
- 101.Warrick B.J., Boyer L.V., Seifert S.A. Non-native (exotic) snake envenomations in the US, 2005–2011. Toxins. 2014;6:2899–2911. doi: 10.3390/toxins6102899. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 102.Hodgson P.S., Davidson T.M. Biology and treatment of the mamba snakebite. Wilderness Environ. Med. 1996;7:133–145. doi: 10.1580/1080-6032(1996)007[0133:BATOTM]2.3.CO;2. [DOI] [PubMed] [Google Scholar]
- 103.National Geographic . Black Mamba, Facts and Photos. National Geographic Partners; Washington, DC, USA: [(accessed on 6 October 2025)]. Available online: https://www.nationalgeographic.com/animals/reptiles/b/black-mamba/ [Google Scholar]
- 104.Brittanica . Black Mamba. Encyclopeadia Brittanica; Chicago, IL, USA: 2020. [(accessed on 6 October 2025)]. Available online: https://www.britannica.com/animal/black-mamba. [Google Scholar]
- 105.Guinness World Records Fastest Land Snake, Londyn: Guinness World Records. [(accessed on 6 October 2025)]. Available online: https://www.guinnessworldrecords.com/world-records/70269-fastest-land-snake.
- 106.Spawls S., Spawls S., Howell K., Hinkel H., Menegon M. Field Guide to East African Reptiles. Bloomsbury Publishing; London, UK: 2018. [Google Scholar]
- 107.Gulsevin A., Meiler J. An Investigation of Three-Finger Toxin-nAChR Interactions through Rosetta Protein Docking. Toxins. 2020;12:598. doi: 10.3390/toxins12090598. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 108.Hiremath K., Dodakallanavar J., Sampat G.H., Patil V.S., Harish D.R., Chavan R., Hegde H.V., Roy S. Three finger toxins of elapids: Structure, function, clinical applications and its inhibitors. Mol. Divers. 2024;28:3409–3426. doi: 10.1007/s11030-023-10734-3. [DOI] [PubMed] [Google Scholar]
- 109.Torres S.V., Valle M.B., Mackessy S.P., Menzies S.K., Casewell N.R., Ahmadi S., Burlet N.J., Muratspahić E., Sappington I., Overath M.D., et al. De novo designed proteins neutralize lethal snake venom toxins. Nature. 2025;639:225–231. doi: 10.1038/s41586-024-08393-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 110.RCSB PDB Protein Data Bank [(accessed on 6 October 2025)]. Available online: https://www.rcsb.org/structure/2MFA.
- 111.Diochot S., Baron A., Rash L.D., Deval E., Escoubas P., Scarzello S., Salinas M., Lazdunski M. A new sea anemone peptide, APETx2, inhibits ASIC3, a major acid-sensitive channel in sensory neurons. EMBO J. 2004;23:1516–1525. doi: 10.1038/sj.emboj.7600177. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 112.Escoubas P., De Weille J.R., Lecoq A., Diochot S., Waldmann R., Champigny G., Moinier D., Ménez A., Lazdunski M. Isolation of a tarantula toxin specific for a class of proton-gated Na+ channels. J. Biol. Chem. 2000;275:25116–25121. doi: 10.1074/jbc.M003643200. [DOI] [PubMed] [Google Scholar]
- 113.Bychkov M., Shulepko M., Osmakov D., Andreev Y., Sudarikova A., Vasileva V., Pavlyukov M.S., Latyshev Y.A., Potapov A.A., Kirpichnikov M., et al. Mambalgin-2 Induces Cell Cycle Arrest and Apoptosis in Glioma Cells via Interaction with ASIC1a. Cancers. 2020;12:1837. doi: 10.3390/cancers12071837. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 114.Mourier G., Salinas M., Kessler P., Stura E.A., Leblanc M., Tepshi L., Besson T., Diochot S., Baron A., Douguet D., et al. Mambalgin-1 Pain-relieving Peptide, Stepwise Solid-phase Synthesis, Crystal Structure, and Functional Domain for Acid-sensing Ion Channel 1a Inhibition. J. Biol. Chem. 2015;291:2616–2629. doi: 10.1074/jbc.M115.702373. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 115.Cristofori-Armstrong B., Rash L.D. Acid-sensing ion channel (ASIC) structure and function: Insights from spider, snake and sea anemone venoms. Neuropharmacology. 2017;127:173–184. doi: 10.1016/j.neuropharm.2017.04.042. [DOI] [PubMed] [Google Scholar]
- 116.Lingueglia E., de Weille J.R., Bassilana F., Heurteaux C., Sakai H., Waldmann R., Lazdunski M. A modulatory subunit of acid sensing ion channels in brain and dorsal root ganglion cells. J. Biol. Chem. 1997;272:29778–29783. doi: 10.1074/jbc.272.47.29778. [DOI] [PubMed] [Google Scholar]
- 117.Jasti J., Furukawa H., Gonzales E.B., Gouaux E. Structure of acid-sensing ion channel 1 at 1.9 A resolution and low pH. Nature. 2007;449:316–323. doi: 10.1038/nature06163. [DOI] [PubMed] [Google Scholar]
- 118.Gründer S., Pusch M. Biophysical properties of acid-sensing ion channels (ASICs) Neuropharmacology. 2015;94:9–18. doi: 10.1016/j.neuropharm.2014.12.016. [DOI] [PubMed] [Google Scholar]
- 119.Waldmann R., Champigny G., Bassilana F., Heurteaux C., Lazdunski M. A proton-gated cation channel involved in acid-sensing. Nature. 1997;386:173–177. doi: 10.1038/386173a0. [DOI] [PubMed] [Google Scholar]
- 120.MacLean D.M., Soto E. Editorial: ASICs: Structure, Function, and Pharmacology. Front. Physiol. 2022;13:831830. doi: 10.3389/fphys.2022.831830. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 121.Hanukoglu I. ASIC and ENaC type sodium channels: Conformational states and the structures of the ion selectivity filters. FEBS J. 2017;284:525–545. doi: 10.1111/febs.13840. [DOI] [PubMed] [Google Scholar]
- 122.Sherwood T.W., Frey E.N., Askwith C.C. Structure and activity of the acid-sensing ion channels. Am. J. Physiol. Cell Physiol. 2012;303:C699–C710. doi: 10.1152/ajpcell.00188.2012. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 123.Osmakov D.I., Andreev Y.A., Kozlov S.A. Acid-sensing ion channels and their modulators. Biochem. Biokhimiia. 2014;79:152845. doi: 10.1134/S0006297914130069. S2CID 14874830. [DOI] [PubMed] [Google Scholar]
- 124.Elkhatib W., Yanez-Guerra L.A., Mayorova T.D., Currie M.A., Singh A., Perera M., Gauberg J., Senatore A. Function and phylogeny support the independent evolution of an ASIC-like Deg/ENaC channel in the Placozoa. Commun. Biol. 2023;6:951. doi: 10.1038/s42003-023-05312-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 125.Sluka K.A., Winter O.C., Wemmie J.A. Acid-sensing ion channels: A new target for pain and CNS diseases. Curr. Opin. Drug Discov. Dev. 2009;12:693–704. [PMC free article] [PubMed] [Google Scholar]
- 126.Zha X.M. Acid-sensing ion channels: Trafficking and synaptic function. Mol. Brain. 2013;6:1. doi: 10.1186/1756-6606-6-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 127.Xiong Z.G., Pignataro G., Li M., Chang S.Y., Simon R.P. Acid-sensing ion channels (ASICs) as pharmacological targets for neurodegenerative diseases. Curr. Opin. Pharmacol. 2008;8:25–32. doi: 10.1016/j.coph.2007.09.001. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 128.Baron A., Lingueglia E. Pharmacology of acid-sensing ion channels—Physiological and therapeutical perspectives. Neuropharmacology. 2015;94:19–35. doi: 10.1016/j.neuropharm.2015.01.005. S2CID 25550294. [DOI] [PubMed] [Google Scholar]
- 129.Voilley N. Acid-sensing ion channels (ASICs): New targets for the analgesic effects of non-steroid anti-inflammatory drugs (NSAIDs) Curr. Drug Targets Inflamm. Allergy. 2004;3:71–79. doi: 10.2174/1568010043483980. [DOI] [PubMed] [Google Scholar]
- 130.Lynagh T., Romero-Rojo J.L., Lund C., Pless S.A. Molecular Basis for Allosteric Inhibition of Acid-Sensing Ion Channel 1a by Ibuprofen. J. Med. Chem. 2017;60:8192–8200. doi: 10.1021/acs.jmedchem.7b01072. [DOI] [PubMed] [Google Scholar]
- 131.Leng T.D., Si H.F., Li J., Yang T., Zhu M., Wang B., Simon R.P., Xiong Z.G. Amiloride Analogs as ASIC1a Inhibitors. CNS Neurosci. Ther. 2016;22:468–476. doi: 10.1111/cns.12524. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 132.Khezri G., Baghban Kohneh Rouz B., Ofoghi H., Davarpanah S.J. Heterologous expression of biologically active Mambalgin-1 peptide as a new potential anticancer, using a PVX-based viral vector in Nicotiana benthamiana. Plant Cell Tissue Organ Cult. 2020;142:241–251. doi: 10.1007/s11240-020-01838-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 133.Goodin M.M., Zaitlin D., Naidu R.A., Lommel S.A. Nicotiana benthamiana: Its History and Future as a Model for Plant-Pathogen Interactions. Mol. Plant-Microbe Interact. 2015;2015:28–39. doi: 10.1094/MPMI-00-00-1015-REV.testissue. [DOI] [PubMed] [Google Scholar]
- 134.Kurotani K.I., Hirakawa H., Shirasawa K., Tanizawa Y., Nakamura Y., Isobe S., Notaguchi M. Genome Sequence and Analysis of Nicotiana benthamiana, the Model Plant for Interactions between Organisms. Plant Cell Physiol. 2023;64:248–257. doi: 10.1093/pcp/pcac168. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 135.Carlson E.D., Rajniak J., Sattely E.S. Multiplicity of the Agrobacterium Infection of Nicotiana benthamiana for Transient DNA Delivery. ACS Synth. Biol. 2023;12:2329–2338. doi: 10.1021/acssynbio.3c00148. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 136.Norkunas K., Harding R., Dale J., Dugdale B. Improving agroinfiltration-based transient gene expression in Nicotiana benthamiana. Plant Methods. 2018;14:71. doi: 10.1186/s13007-018-0343-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 137.Abd-Aziz N., Tan B.C., Rejab N.A., Othman R.Y., Khalid N. A New Plant Expression System for Producing Pharmaceutical Proteins. Mol. Biotechnol. 2020;62:240–251. doi: 10.1007/s12033-020-00242-2. [DOI] [PubMed] [Google Scholar]
- 138.Kumar P., Nagarajan A., Uchil P.D. Analysis of Cell Viability by the MTT Assay. Cold Spring Harb. Protoc. 2018;2018:pdb-prot095505. doi: 10.1101/pdb.prot095505. [DOI] [PubMed] [Google Scholar]
- 139.Grela E., Kozłowska J., Grabowiecka A. Current methodology of MTT assay in bacteria—A review. Acta Histochem. 2018;120:303–311. doi: 10.1016/j.acthis.2018.03.007. [DOI] [PubMed] [Google Scholar]
- 140.Bychkov M.L., Kirichenko A.V., Shulepko M.A., Mikhaylova I.N., Kirpichnikov M.P., Lyukmanova E.N. Mambalgin-2 Inhibits Growth, Migration, and Invasion of Metastatic Melanoma Cells by Targeting the Channels Containing an ASIC1a Subunit Whose Up-Regulation Correlates with Poor Survival Prognosis. Biomedicines. 2021;9:1324. doi: 10.3390/biomedicines9101324. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 141.Martínez-Zaguilán R., Seftor E.A., Seftor R.E., Chu Y.W., Gillies R.J., Hendrix M.J. Acidic pH enhances the invasive behavior of human melanoma cells. Clin. Exp. Metastasis. 1996;14:176–186. doi: 10.1007/BF00121214. [DOI] [PubMed] [Google Scholar]
- 142.Böhme I., Bosserhoff A.K. Acidic tumor microenvironment in human melanoma. Pigment Cell Melanoma Res. 2016;29:508–523. doi: 10.1111/pcmr.12495. [DOI] [PubMed] [Google Scholar]
- 143.Paramonov A.S., Kocharovskaya M.V., Tsarev A.V., Kulbatskii D.S., Loktyushov E.V., Shulepko M.A., Kirpichnikov M.P., Lyukmanova E.N., Shenkarev Z.O. Structural Diversity and Dynamics of Human Three-Finger Proteins Acting on Nicotinic Acetylcholine Receptors. Int. J. Mol. Sci. 2020;21:7280. doi: 10.3390/ijms21197280. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 144.Idalia V.M.N., Bernardo F. Escherichia coli as a model organism and its application in biotechnology. Recent Adv. Physiol. Pathog. Biotechnol. Appl. 2017;13:253–274. [Google Scholar]
- 145.Pouresmaeil M., Azizi-Dargahlou S. Factors involved in heterologous expression of proteins in E. coli host. Arch. Microbiol. 2023;205:212. doi: 10.1007/s00203-023-03541-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 146.Osmakov D.I., Koshelev S.G., Lyukmanova E.N., Shulepko M.A., Andreev Y.A., Illes P., Kozlov S.A. Multiple Modulation of Acid-Sensing Ion Channel 1a by the Alkaloid Daurisoline. Biomolecules. 2019;9:336. doi: 10.3390/biom9080336. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 147.Shulepko M.A., Lyukmanova E.N., Shenkarev Z.O., Dubovskii P.V., Astapova M.V., Feofanov A.V., Arseniev A.S., Utkin Y.N., Kirpichnikov M.P., Dolgikh D.A. Towards universal approach for bacterial production of three-finger Ly6/uPAR proteins: Case study of cytotoxin I from cobra N. oxiana. Protein Expr. Purif. 2017;130:13–20. doi: 10.1016/j.pep.2016.09.021. [DOI] [PubMed] [Google Scholar]
- 148.Zuiderweg E.R. Mapping protein—Protein interactions in solution by NMR spectroscopy. Biochemistry. 2002;41:1–7. doi: 10.1021/bi011870b. [DOI] [PubMed] [Google Scholar]
- 149.Kay B.K., Peng H.B. Xenopus laevis: Practical Uses in Cell and Molecular Biology. Volume 36 Academic Press; Cambridge, MA, USA: 1992. [Google Scholar]
- 150.Bychkov M.L., Shulepko M.A., Vasileva V.Y., Sudarikova A.V., Kirpichnikov M.P., Lyukmanova E.N. ASIC1a Inhibitor mambalgin-2 Suppresses the Growth of Leukemia Cells by Cell Cycle Arrest. Acta Naturae. 2020;12:101–116. doi: 10.32607/actanaturae.11158. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 151.Sudarikova A.V., Bychkov M.L., Kulbatskii D.S., Chubinskiy-Nadezhdin V.I., Shlepova O.V., Shulepko M.A., Koshelev S.G., Kirpichnikov M.P., Lyukmanova E.N. Mambalgin-2 Inhibits Lung Adenocarcinoma Growth and Migration by Selective Interaction with ASIC1/α-ENaC/γ-ENaC Heterotrimer. Front. Oncol. 2022;12:904742. doi: 10.3389/fonc.2022.904742. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 152.Laustsen A.H., Lomonte B., Lohse B., Fernández J., Gutiérrez J.M. Unveiling the nature of black mamba (Dendroaspis polylepis) venom through venomics and antivenom immunoprofiling: Identification of key toxin targets for antivenom development. J. Proteom. 2015;119:126–142. doi: 10.1016/j.jprot.2015.02.002. [DOI] [PubMed] [Google Scholar]
- 153.Rodríguez-Ithurralde D., Silveira R., Barbeito L., Dajas F. Fasciculin, a powerful anticholinesterase polypeptide from Dendroaspis angusticeps venom. Neurochem. Int. 1983;5:267–274. doi: 10.1016/0197-0186(83)90028-1. [DOI] [PubMed] [Google Scholar]
- 154.Quarch V., Brander L., Cioccari L. An Unexpected Case of Black Mamba (Dendroaspis polylepis) Bite in Switzerland. Case Rep. Crit. Care. 2017;2017:5021924. doi: 10.1155/2017/5021924. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 155.Low B.W., Preston H.S., Sato A., Rosen L.S., Searl J.E., Rudko A.D., Richardson J.S. Three dimensional structure of erabutoxin b neurotoxic protein: Inhibitor of acetylcholine receptor. Proc. Natl. Acad. Sci. USA. 1976;73:2991–2994. doi: 10.1073/pnas.73.9.2991. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 156.Kumar T.K.S., Jayaraman G., Lee C.S., Arunkumar A.I., Sivaraman T., Samuel D., Yu C. Snake venom cardiotoxins-structure, dynamics, function and folding. J. Biomol. Struct. Dyn. 1997;15:431–463. doi: 10.1080/07391102.1997.10508957. [DOI] [PubMed] [Google Scholar]
- 157.le Du M., Marchot P., Bougis P., Fontecilla-Camps J. 1.9-A resolution structure of fasciculin 1, an anti-acetylcholinesterase toxin from green mamba snake venom. J. Biol. Chem. 1992;267:22122–22130. doi: 10.1016/S0021-9258(18)41644-4. [DOI] [PubMed] [Google Scholar]
- 158.Protein Data Bank 2025. [(accessed on 6 October 2025)]. Available online: https://www.rcsb.org/structure/1FSC.
- 159.Larréché S., Mion G., Clapson P., Debien B., Wybrecht D., Goyffon M. Neurotoxines ophidiennes. Ann. Françaises D’Anesthésie Réanimation. 2008;27:310–316. doi: 10.1016/j.annfar.2008.02.010. [DOI] [PubMed] [Google Scholar]
- 160.Durán R., Cerveñansky C., Dajas F., Tipton K.F. Fasciculin inhibition of acetylcholinesterase is prevented by chemical modification of the enzyme at a peripheral site. Biochim. Biophys. Acta. 1994;1201:381–388. doi: 10.1016/0304-4165(94)90066-3. [DOI] [PubMed] [Google Scholar]
- 161.Chippaux J.P., Goyffon M. Envenimations et intoxications par les animaux venimeux ou vénéneux—I. Généralitś [Venomous and poisonous animals—I. Overview] Med. Trop. Rev. Corps Sante Colon. 2006;66:215–220. [PubMed] [Google Scholar]
- 162.Taylor P. Anticholinesterase agents. Goodman Gilman’s Pharmacol. Basis Ther. 2006;11:201–216. [Google Scholar]
- 163.Karlsson E., Mbugua P.M., Rodriguez-Ithurralde D. Fasciculins, anticholinesterase toxins from the venom of the green mamba Dendroaspis angusticeps. J. Physiol. 1984;79:232–240. [PubMed] [Google Scholar]
- 164.Rosenberry T.L., Rabl C.R., Neumann E. Binding of the neurotoxin fasciculin 2 to the acetylcholinesterase peripheral site drastically reduces the association and dissociation rate constants for N-methylacridinium binding to the active site. Biochemistry. 1996;35:685–690. doi: 10.1021/bi952431d. [DOI] [PubMed] [Google Scholar]
- 165.van denBorn H.K., Radić Z., Marchot P., Taylor P., Tsigelny I. Theoretical analysis of the structure of the peptide fasciculin and its docking to acetylcholinesterase. Protein Sci. 1995;4:703–715. doi: 10.1002/pro.5560040410. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 166.Marchot P. L’interaction fasciculine-acétylcholinestérase [The fasciculin-acetylcholinesterase interaction] J. Soc. Biol. 1999;193:505–508. doi: 10.1051/jbio/1999193060505. [DOI] [PubMed] [Google Scholar]
- 167.Dvir H., Silman I., Harel M., Rosenberry T.L., Sussman J.L. Acetylcholinesterase: From 3D structure to function. Chem. Biol. Interact. 2010;187:10–22. doi: 10.1016/j.cbi.2010.01.042. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 168.Radić Z., Quinn D.M., Vellom D.C., Camp S., Taylor P. Allosteric control of acetylcholinesterase catalysis by fasciculin. J. Biol. Chem. 1995;270:20391–20399. doi: 10.1074/jbc.270.35.20391. [DOI] [PubMed] [Google Scholar]
- 169.Bartolucci C., Stojan J., Yu Q.S., Greig N.H., Lamba D. Kinetics of Torpedo californica acetylcholinesterase inhibition by bisnorcymserine and crystal structure of the complex with its leaving group. Biochem. J. 2012;444:269–277. doi: 10.1042/BJ20111675. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 170.Radić Z., Duran R., Vellom D.C., Li Y., Cervenansky C., Taylor P. Site of fasciculin interaction with acetylcholinesterase. J. Biol. Chem. 1994;269:11233–11239. doi: 10.1016/S0021-9258(19)78115-0. [DOI] [PubMed] [Google Scholar]
- 171.Harel M., Kleywegt G.J., Ravelli R.B., Silman I., Sussman J.L. Crystal structure of an acetylcholinesterase-fasciculin complex: Interaction of a three-fingered toxin from snake venom with its target. Structure. 1995;3:1355–1366. doi: 10.1016/S0969-2126(01)00273-8. [DOI] [PubMed] [Google Scholar]
- 172.Eastman J., Wilson E.J., Cerveñansky C., Rosenberry T.L. Fasciculin 2 binds to the peripheral site on acetylcholinesterase and inhibits substrate hydrolysis by slowing a step involving proton transfer during enzyme acylation. J. Biol. Chem. 1995;270:19694–19701. doi: 10.1074/jbc.270.34.19694. [DOI] [PubMed] [Google Scholar]
- 173.Bourne Y., Taylor P., Marchot P. Acetylcholinesterase inhibition by fasciculin: Crystal structure of the complex. Cell. 1995;83:503–512. doi: 10.1016/0092-8674(95)90128-0. [DOI] [PubMed] [Google Scholar]
- 174.Cerveñansky C., Durán R., Karlsson E. Fasciculin: Modification of carboxyl groups and discussion of structure-activity relationship. Toxicon. 1996;34:718–721. doi: 10.1016/0041-0101(95)00155-7. [DOI] [PubMed] [Google Scholar]
- 175.Tai K., Shen T., Henchman R.H., Bourne Y., Marchot P., McCammon J.A. Mechanism of acetylcholinesterase inhibition by fasciculin: A 5-ns molecular dynamics simulation. J. Am. Chem. Soc. 2002;124:6153–6161. doi: 10.1021/ja017310h. [DOI] [PubMed] [Google Scholar]
- 176.Sharabi O., Peleg Y., Mashiach E., Vardy E., Ashani Y., Silman I., Sussman J.L., Shifman J.M. Design, expression and characterization of mutants of fasciculin optimized for interaction with its target, acetylcholinesterase. Protein Eng. Des. Sel. 2009;22:641–648. doi: 10.1093/protein/gzp045. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 177.Kafurke U., Erijman A., Aizner Y., Shifman J.M., Eichler J. Synthetic peptides mimicking the binding site of human acetylcholinesterase for its inhibitor fasciculin 2. J. Pept. Sci. 2015;21:723–730. doi: 10.1002/psc.2797. [DOI] [PubMed] [Google Scholar]
- 178.Marchot P., Bougis P.E. Elapidae Toxins: The Fasciculins, and their Interaction with Acetylcholinesterase. In: Rochat H., Martin-Eauclaire M.F., editors. Animal Toxins. Birkhäuser; Basel, Switzerland: 2000. (Methods and Tools in Biosciences and Medicine). [DOI] [Google Scholar]
- 179.Toiber D., Berson A., Greenberg D., Melamed-Book N., Diamant S., Soreq H. N-acetylcholinesterase-induced apoptosis in Alzheimer’s disease. PLoS ONE. 2008;3:e3108. doi: 10.1371/journal.pone.0003108. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 180.Hu W., Gray N.W., Brimijoin S. Amyloid-beta alters trafficking of internalized acetylcholinesterase and dextran. Int. J. Physiol. Pathophysiol. Pharmacol. 2009;1:15–24. [PMC free article] [PubMed] [Google Scholar]
- 181.Nachon F., Carletti E., Ronco C., Trovaslet M., Nicolet Y., Jean L., Renard P.Y. Crystal structures of human cholinesterases in complex with huprine W and tacrine: Elements of specificity for anti-Alzheimer’s drugs targeting acetyl- and butyryl-cholinesterase. Biochem. J. 2013;453:393–399. doi: 10.1042/BJ20130013. [DOI] [PubMed] [Google Scholar]
- 182.Waqar M., Batool S. In silico analysis of binding of neurotoxic venom ligands with acetylcholinesterase for therapeutic use in treatment of Alzheimer’s disease. J. Theor. Biol. 2015;372:107–117. doi: 10.1016/j.jtbi.2015.02.028. [DOI] [PubMed] [Google Scholar]
- 183.Moreno R.D., Campos F.O., Dajas F., Inestrosa N.C. Developmental regulation of mouse brain monomeric acetylcholinesterase. Int. J. Dev. Neurosci. 1998;16:123–134. doi: 10.1016/S0736-5748(98)00008-2. [DOI] [PubMed] [Google Scholar]
- 184.Dajas F., Silveira R., Costa G., Castello M.E., Jerusalinsky D., Medina J., Levesque D., Greenfield S. Differential cholinergic and non-cholinergic actions of acetylcholinesterase in the substantia nigra revealed by fasciculin-induced inhibition. Brain Res. 1993;616:1–5. doi: 10.1016/0006-8993(93)90184-O. [DOI] [PubMed] [Google Scholar]
- 185.Anderson A.J., Harvey A.L., Mbugua P.M. Effects of fasciculin 2, an anticholinesterase polypeptide from green mamba venom, on neuromuscular transmission in mouse diaphragm preparations. Neurosci. Lett. 1985;54:123–128. doi: 10.1016/S0304-3940(85)80066-5. [DOI] [PubMed] [Google Scholar]
- 186. [(accessed on 6 October 2025)]. Available online: https://www.who.int/
- 187.Scheltens P., De Strooper B., Kivipelto M., Holstege H., Chételat G., Teunissen C.E., Cummings J., van der Flier W.M. Alzheimer’s disease. Lancet. 2021;397:1577–1590. doi: 10.1016/S0140-6736(20)32205-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 188.Ballard C., Gauthier S., Corbett A., Brayne C., Aarsland D., Jones E. Alzheimer’s disease. Lancet. 2011;377:1019–1031. doi: 10.1016/S0140-6736(10)61349-9. [DOI] [PubMed] [Google Scholar]
- 189.Katzman R. Alzheimer’s disease. N. Engl. J. Med. 1986;314:964–973. doi: 10.1056/NEJM198604103141506. [DOI] [PubMed] [Google Scholar]
- 190.Scheltens P., Blennow K., Breteler M.M., De Strooper B., Frisoni G.B., Salloway S., Van der Flier W.M. Alzheimer’s disease. Lancet. 2016;388:505–517. doi: 10.1016/S0140-6736(15)01124-1. [DOI] [PubMed] [Google Scholar]
- 191.Munoz D.G., Feldman H. Causes of Alzheimer’s disease. Can. Med. Assoc. J. 2000;162:65–72. [PMC free article] [PubMed] [Google Scholar]
- 192.Stahl S.M. The new cholinesterase inhibitors for Alzheimer’s disease, Part 2: Illustrating their mechanisms of action. J. Clin. Psychiatry. 2000;61:813–814. doi: 10.4088/JCP.v61n1101. [DOI] [PubMed] [Google Scholar]
- 193.Leon R., Garcia A.G., Marco-Contelles J. Recent advances in the multitarget-directed ligands approach for the treatment of Alzheimer’s disease. Med. Res. Rev. 2013;33:139–189. doi: 10.1002/med.20248. [DOI] [PubMed] [Google Scholar]
- 194.Oset-Gasque M.J., Marco-Contelles J. Alzheimer’s disease, the “one-molecule, one-target” paradigm, and the multitarget directed ligand approach. ACS Chem. Neurosci. 2018;9:401–403. doi: 10.1021/acschemneuro.8b00069. [DOI] [PubMed] [Google Scholar]
- 195.Blasina M.F., Faria A.C., Gardino P.F., Hokoc J.N., Almeida O.M., de Mello F.G., Arruti C., Dajas F. Evidence for a noncholinergic function of acetylcholinesterase during development of chicken retina as shown by fasciculin. Cell Tissue Res. 2000;299:173–184. doi: 10.1007/s004419900117. [DOI] [PubMed] [Google Scholar]
- 196.Marchot P., Bourne Y., Prowse C.N., Bougis P.E., Taylor P. Inhibition of mouse acetylcholinesterase by fasciculin: Crystal structure of the complex and mutagenesis of fasciculin. Toxicon. 1998;36:1613–1622. doi: 10.1016/S0041-0101(98)00154-8. [DOI] [PubMed] [Google Scholar]
- 197.Gonçalves A.d.S., França T.C.C., de Oliveira O.V. Computational studies of acetylcholinesterase complexed with fullerene derivatives: A new insight for Alzheimer disease treatment. J. Biomol. Struct. Dyn. 2016;34:1307–1316. doi: 10.1080/07391102.2015.1077345. [DOI] [PubMed] [Google Scholar]
- 198.Anderson A.J., Harvey A.L., Rowan E.G., Strong P.N. Effects of charybdotoxin, a blocker of Ca2+-activated K+ channels, on motor nerve terminals. Brit. J. Pharmacol. 1988;95:1329–1335. doi: 10.1111/j.1476-5381.1988.tb11772.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 199.Joubert F.J., Taljaard N. The amino acid sequence of two proteinase inhibitor homologues from Dendroaspis angusticeps venom. Hoppe Seylers Z. Physiol. Chem. 1980;361:661–674. doi: 10.1515/bchm2.1980.361.1.661. [DOI] [PubMed] [Google Scholar]
- 200.Benishin C.G., Sorensen R.G., Brown W.E., Krueger B.K., Blaustein M.P. Four polypeptide components of green mamba venom selectively block certain potassium channels in rat brain synaptosomes. Mol. Pharmacol. 1988;34:152–159. doi: 10.1016/S0026-895X(25)09347-2. [DOI] [PubMed] [Google Scholar]
- 201.Závada J., Valenta J., Kopecký O., Stach Z., Leden P. Black mamba Dendroaspis polylepis bite: A case report. Prague Med. Rep. 2011;112:298–304. [PubMed] [Google Scholar]
- 202.Christensen P.A., Anderson C.G. Animals’ Toxins. Pergamon Press; Oxford, UK: 2016. Observations on Dendroaspis venoms; pp. 223–234. [Google Scholar]
- 203.Protein Data Bank [(accessed on 6 October 2025)]. Available online: https://www.rcsb.org/3d-view/1DTK.
- 204.Protein Data Bank [(accessed on 6 October 2025)]. Available online: https://www.rcsb.org/structure/1DEM.
- 205.Oltersdorf T., Fritz L.C., Schenk D.B., Lieberburg I., Johnson-Wood K.L., Beattie E.C., Ward P.J., Blacher R.W., Dovey H.F., Sinha S. The secreted form of the Alzheimer’s amyloid precursor protein with the Kunitz domain is protease nexin-II. Nature. 1989;341:144–147. doi: 10.1038/341144a0. [DOI] [PubMed] [Google Scholar]
- 206.Petersen L.C., Sprecher C.A., Foster D.C., Blumberg H., Hamamoto T., Kisiel W. Inhibitory properties of a novel human Kunitz-type protease inhibitor homologous to tissue factor pathway inhibitor. Biochemistry. 1996;35:266–272. doi: 10.1021/bi951501d. [DOI] [PubMed] [Google Scholar]
- 207.Yuan C.H., He Q.Y., Peng K., Diao J.B., Jiang L.P., Tang X., Liang S.P. Discovery of a distinct superfamily of Kunitz-type toxin (KTT) from tarantulas. PLoS ONE. 2008;3:e3414. doi: 10.1371/annotation/5a7fb62a-94b0-4a9e-9031-b391502df41a. Erratum in PLoS ONE 2008, 3. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 208.Bendre A.D., Ramasamy S., Suresh C.G. Analysis of Kunitz inhibitors from plants for comprehensive structural and functional insights. Int. J. Biol. Macromol. 2018;113:933–943. doi: 10.1016/j.ijbiomac.2018.02.148. [DOI] [PubMed] [Google Scholar]
- 209.Mishra M. Evolutionary aspects of the structural convergence and functional diversification of Kunitz-domain inhibitors. J. Mol. Evol. 2020;88:537–548. doi: 10.1007/s00239-020-09959-9. [DOI] [PubMed] [Google Scholar]
- 210.Harvey A.L., Rowan E.G. Dendrotoxins and BPTI-like Proteins. In: Rochat H., Martin-Eauclaire M.F., editors. Animal Toxins. Birkhäuser; Basel, Switzerland: 2000. (Methods and Tools in Biosciences and Medicine). [DOI] [Google Scholar]
- 211.Harvey A.L., Robertson B. Dendrotoxins: Structure-activity relationships and effects on potassium ion channels. Curr. Med. Chem. 2004;11:3065–3072. doi: 10.2174/0929867043363820. [DOI] [PubMed] [Google Scholar]
- 212.Swaminathan P., Hariharan M., Murali R., Singh C.U. Molecular structure, conformational analysis, and structure-activity studies of Dendrotoxin and its homologues using molecular mechanics and molecular dynamics techniques. J. Med. Chem. 1996;39:2141–2155. doi: 10.1021/jm950579p. [DOI] [PubMed] [Google Scholar]
- 213.Imredy J.P., MacKinnon R. Energetic and structural interactions between delta-dendrotoxin and a voltage-gated potassium channel. J. Mol. Biol. 2000;296:1283–1294. doi: 10.1006/jmbi.2000.3522. [DOI] [PubMed] [Google Scholar]
- 214.Katoh E., Nishio H., Inui T., Nishiuchi Y., Kimura T., Sakakibara S., Yamazaki T. Structural basis for the biological activity of dendrotoxin-I, a potent potassium channel blocker. Biopolym. Orig. Res. Biomol. 2000;54:44–57. doi: 10.1002/(SICI)1097-0282(200007)54:1<44::AID-BIP50>3.0.CO;2-Z. [DOI] [PubMed] [Google Scholar]
- 215.Dufton M.J., Harvey A.L. Dendrotoxins: How does structure determine function? J. Toxicol. Toxin Rev. 1998;17:161–182. doi: 10.3109/15569549809009248. [DOI] [Google Scholar]
- 216.Lallement G., Fosbraey P., Baille-Le-Crom V., Tattersall J.E.H., Blanchet G., Wetherell J.R., Rice P., Passingham S.L., Sentenac-Roumanou H. Compared toxicity of the potassium channel blockers, apamin and dendrotoxin. Toxicology. 1995;104:47–52. doi: 10.1016/0300-483X(95)03120-5. [DOI] [PubMed] [Google Scholar]
- 217.Halliwell J.V., Othman I.B., Pelchen-Matthews A., Dolly J.O. Central action of dendrotoxin: Selective reduction of a transient K conductance in hippocampus and binding to localized acceptors. Proc. Natl. Acad. Sci. USA. 1986;83:493–497. doi: 10.1073/pnas.83.2.493. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 218.Tibbs G.R., Dolly J.O., Nicholls D.G. Dendrotoxin, 4-aminopyridine, and β-bungarotoxin act at common loci but by two distinct mechanisms to induce Ca2+-dependent release of glutamate from guinea-pig cerebrocortical synaptosomes. J. Neurochem. 1989;52:201–206. doi: 10.1111/j.1471-4159.1989.tb10917.x. [DOI] [PubMed] [Google Scholar]
- 219.Jeon W.I., Ryu P.D., Lee S.Y. Effects of voltage-gated K+ channel blockers in gefitinib-resistant H460 non-small cell lung cancer cells. Anticancer Res. 2012;32:5279–5284. [PubMed] [Google Scholar]
- 220.Jang S.H., Choi S.Y., Ryu P.D., Lee S.Y. Anti-proliferative effect of Kv1.3 blockers in A549 human lung adenocarcinoma in vitro and in vivo. Eur. J. Pharmacol. 2011;651:26–32. doi: 10.1016/j.ejphar.2010.10.066. [DOI] [PubMed] [Google Scholar]
- 221.Fellerhoff-Losch B., Korol S.V., Ganor Y., Gu S., Cooper I., Eilam R., Besser M., Goldfinger M., Chowers Y., Wank R., et al. Normal human CD4+ helper T cells express Kv1.1 voltage-gated K+ channels, and selective Kv1.1 block in T cells induces by itself robust TNFα production and secretion and activation of the NFκB non-canonical pathway. J. Neural Transm. 2016;123:137–157. doi: 10.1007/s00702-015-1446-9. [DOI] [PubMed] [Google Scholar]
- 222.Yang Q., Chen S.R., Li D.P., Pan H.L. Kv1.1/1.2 channels are downstream effectors of nitric oxide on synaptic GABA release to preautonomic neurons in the paraventricular nucleus. Neuroscience. 2007;149:315–327. doi: 10.1016/j.neuroscience.2007.08.007. [DOI] [PubMed] [Google Scholar]
- 223.Vianna-Jorge R., Oliveira C.F., Garcia M.L., Kaczorowski G.J., Suarez-Kurtz G. Shaker-type Kv1 channel blockers increase the peristaltic activity of guinea-pig ileum by stimulating acetylcholine and tachykinins release by the enteric nervous system. Br. J. Pharmacol. 2003;138:57–62. doi: 10.1038/sj.bjp.0705023. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 224.Forootan M., Bagheri N., Darvishi M. Chronic constipation: A review of literature. Medicine. 2018;97:e10631. doi: 10.1097/MD.0000000000010631. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 225.Hatton W.J., Mason H.S., Carl A., Doherty P., Latten M.J., Kenyon J.L., Sanders K.M., Horowitz B. Functional and molecular expression of a voltage-dependent K+ channel (Kv1.1) in interstitial cells of Cajal. Pt 2J. Physiol. 2001;533:315–327. doi: 10.1111/j.1469-7793.2001.0315a.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 226.Finnegan T.F., Chen S.R., Pan H.L. Mu opioid receptor activation inhibits GABAergic inputs to basolateral amygdala neurons through Kv1.1/1.2 channels. J. Neurophysiol. 2006;95:2032–2041. doi: 10.1152/jn.01004.2005. [DOI] [PubMed] [Google Scholar]
- 227.Chi X.X., Nicol G.D. Manipulation of the potassium channel Kv1.1 and its effect on neuronal excitability in rat sensory neurons. J. Neurophysiol. 2007;98:2683–2692. doi: 10.1152/jn.00437.2007. [DOI] [PubMed] [Google Scholar]
- 228.Hao J., Padilla F., Dandonneau M., Lavebratt C., Lesage F., Noël J., Delmas P. Kv1.1 channels act as mechanical brake in the senses of touch and pain. Neuron. 2013;77:899–914. doi: 10.1016/j.neuron.2012.12.035. [DOI] [PubMed] [Google Scholar]
- 229.Si M., Trosclair K., Hamilton K.A., Glasscock E. Genetic ablation or pharmacological inhibition of Kv1.1 potassium channel subunits impairs atrial repolarization in mice. Am. J. Physiology Cell Physiol. 2019;316:C154–C161. doi: 10.1152/ajpcell.00335.2018. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 230.Ma Z., Lavebratt C., Almgren M., Portwood N., Forsberg L.E., Bränström R., Berglund E., Falkmer S., Sundler F., Wierup N., et al. Evidence for presence and functional effects of Kv1.1 channels in β-cells: General survey and results from mceph/mceph mice. PLoS ONE. 2011;6:e18213. doi: 10.1371/journal.pone.0018213. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 231.Allen M.L., Koh D.S., Tempel B.L. Cyclic AMP regulates potassium channel expression in C6 glioma by destabilizing Kv1.1 mRNA. Proc. Natl. Acad. Sci. USA. 1998;95:7693–7698. doi: 10.1073/pnas.95.13.7693. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 232.Valsecchi F., Ramos-Espiritu L.S., Buck J., Levin L.R., Manfredi G. cAMP and mitochondria. Physiology. 2013;28:199–209. doi: 10.1152/physiol.00004.2013. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 233.Manor D., Moran N. Modulation of small conductance calcium-activated potassium channels in C6 glioma cells. J. Membr. Biol. 1994;140:69–79. doi: 10.1007/BF00234487. [DOI] [PubMed] [Google Scholar]
- 234.Strupp M., Staub F., Grafe P. A Ca2+-and pH-Dependent K+ Channel of rat C6 glioma cells and its possible role in acidosis-induced cell swelling. Glia. 1993;9:136–145. doi: 10.1002/glia.440090207. [DOI] [PubMed] [Google Scholar]
- 235.Rouzaire-Dubois B., Milandri J.B., Bostel S., Dubois J.M. Control of cell proliferation by cell volume alterations in rat C6 glioma cells. Pflügers Arch. 2000;440:881–888. doi: 10.1007/s004240000371. [DOI] [PubMed] [Google Scholar]
- 236.Wang S.Y., Castle N.A., Wang G.K. Identification of RBK1 potassium channels in C6 astrocytoma cells. Glia. 1992;5:146–153. doi: 10.1002/glia.440050209. [DOI] [PubMed] [Google Scholar]
- 237.Hashimoto K., Yamawaki Y., Yamaoka K., Yoshida T., Okada K., Tan W., Yamasaki M., Matsumoto-Makidono Y., Kubo R., Nakayama H., et al. Spike firing attenuation of serotonin neurons in learned helplessness rats is reversed by ketamine. Brain Commun. 2021;3:fcab285. doi: 10.1093/braincomms/fcab285. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 238.Corriger A., Pickering G. Ketamine and depression: A narrative review. Drug Des. Dev. Ther. 2019;13:3051–3067. doi: 10.2147/DDDT.S221437. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 239.Rothman J.S., Manis P.B. Differential expression of three distinct potassium currents in the ventral cochlear nucleus. J. Neurophysiol. 2003;89:3070–3082. doi: 10.1152/jn.00125.2002. [DOI] [PubMed] [Google Scholar]
- 240.Hamlet W.R., Liu Y.W., Tang Z.Q., Lu Y. Interplay between low threshold voltage-gated K+ channels and synaptic inhibition in neurons of the chicken nucleus laminaris along its frequency axis. Front. Neural Circuits. 2014;8:51. doi: 10.3389/fncir.2014.00051. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 241.Shibukawa Y., Chilton E.L., Maccannell K.A., Clark R.B., Giles W.R. K+ currents activated by depolarization in cardiac fibroblasts. Biophys. J. 2005;88:3924–3935. doi: 10.1529/biophysj.104.054429. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 242.Humeres C., Frangogiannis N.G. Fibroblasts in the infarcted, remodeling, and failing heart. JACC Basic Transl. Sci. 2019;4:449–467. doi: 10.1016/j.jacbts.2019.02.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 243.Vanzolini K.L., Ainsworth S., Bruyneel B., Herzig V., Seraus M.G.L., Somsen G.W., Casewell N.R., Cass Q.B., Kool J. Rapid ligand fishing for identification of acetylcholinesterase-binding peptides in snake venom reveals new properties of dendrotoxins. Toxicon. 2018;152:1–8. doi: 10.1016/j.toxicon.2018.06.080. [DOI] [PubMed] [Google Scholar]
- 244.Haghdoust H., Janahmadi M., Behzadi G. Physiological role of dendrotoxin-sensitive K+ channels in the rat cerebellar Purkinje neurons. Physiol. Res. 2007;56:807–813. doi: 10.33549/physiolres.931041. [DOI] [PubMed] [Google Scholar]
- 245.Caputi A., Melzer S., Michael M., Monyer H. The long and short of GABAergic neurons. Curr. Opin. Neurobiol. 2013;23:179–186. doi: 10.1016/j.conb.2013.01.021. [DOI] [PubMed] [Google Scholar]
- 246.Post Y., Puschhof J., Beumer J., Kerkkamp H.M., de Bakker M.A., Slagboom J., de Barbanson B., Wevers N.R., Spijkers X.M., Olivier T., et al. Snake Venom Gland Organoids. Cell. 2020;180:233–247.e21. doi: 10.1016/j.cell.2019.11.038. [DOI] [PubMed] [Google Scholar]
- 247.Lüddecke T., Paas A., Harris R.J., Talmann L., Kirchhoff K.N., Billion A., Hardes K., Steinbrink A., Gerlach D., Fry B.G., et al. Venom biotechnology: Casting light on nature’s deadliest weapons using synthetic biology. Front. Bioeng. Biotechnol. 2023;11:1166601. doi: 10.3389/fbioe.2023.1166601. [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Data Availability Statement
Not applicable.




Dendrotoxin-I




