Volume 69, no. 2, p. 875-884, 2001. Page 876, Fig. 1B: For peptide 6345, the sequence should read KKNVTVQELDYKIRKYLVDNKKLYGC; for peptide 6347, the sequence should read CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLY; for peptide 6348, the sequence should read CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLYGC.
. 2002 Oct;70(10):5900. doi: 10.1128/IAI.70.10.5900.2002
Inhibition of Bacterial Superantigens by Peptides and Antibodies
Kumar Visvanathan
1, Alain Charles
1, Jason Bannan
1, Pavel Pugach
1, Khosrow Kashfi
1, John B Zabriskie
1
Kumar Visvanathan
1Laboratory of Clinical Microbiology and Immunology, Rockefeller University, New York, New York 10021; Bacteriology Section, American Type Culture Collection, Manassas, Virginia 20110Department of Physiology and Pharmacology, City University of New York Medical School, New York, New York 10031
Find articles by Kumar Visvanathan
Alain Charles
1Laboratory of Clinical Microbiology and Immunology, Rockefeller University, New York, New York 10021; Bacteriology Section, American Type Culture Collection, Manassas, Virginia 20110Department of Physiology and Pharmacology, City University of New York Medical School, New York, New York 10031
Find articles by Alain Charles
Jason Bannan
1Laboratory of Clinical Microbiology and Immunology, Rockefeller University, New York, New York 10021; Bacteriology Section, American Type Culture Collection, Manassas, Virginia 20110Department of Physiology and Pharmacology, City University of New York Medical School, New York, New York 10031
Find articles by Jason Bannan
Pavel Pugach
1Laboratory of Clinical Microbiology and Immunology, Rockefeller University, New York, New York 10021; Bacteriology Section, American Type Culture Collection, Manassas, Virginia 20110Department of Physiology and Pharmacology, City University of New York Medical School, New York, New York 10031
Find articles by Pavel Pugach
Khosrow Kashfi
1Laboratory of Clinical Microbiology and Immunology, Rockefeller University, New York, New York 10021; Bacteriology Section, American Type Culture Collection, Manassas, Virginia 20110Department of Physiology and Pharmacology, City University of New York Medical School, New York, New York 10031
Find articles by Khosrow Kashfi
John B Zabriskie
1Laboratory of Clinical Microbiology and Immunology, Rockefeller University, New York, New York 10021; Bacteriology Section, American Type Culture Collection, Manassas, Virginia 20110Department of Physiology and Pharmacology, City University of New York Medical School, New York, New York 10031
Find articles by John B Zabriskie
1Laboratory of Clinical Microbiology and Immunology, Rockefeller University, New York, New York 10021; Bacteriology Section, American Type Culture Collection, Manassas, Virginia 20110Department of Physiology and Pharmacology, City University of New York Medical School, New York, New York 10031
Copyright © 2002, American Society for Microbiology
PMCID: PMC128370
This corrects the article "Inhibition of Bacterial Superantigens by Peptides and Antibodies" in volume 69 on page 875.