Abstract
Background: Killed Whole Cell Genome-Reduced Bacteria (KWC/GRB), a versatile vaccine platform, can produce very low cost, thermostable, easily manufactured vaccines expressing complex immunogens that include potent immunomodulators. This system supports iterative optimization through a Design–Build–Test–Learn (DBTL) workflow aimed at enhancing immunogenicity. We applied this approach to developing HIV-1 gp41 Membrane-Proximal External Region (MPER) vaccines using the scaffolded MPER antigen, 3AGJ, a recombinant heterologous protein engineered to mimic MPER structures recognized by broadly neutralizing monoclonal antibodies (bNAbs). Methods: Five KWC/GRB vaccines expressing versions of 3AGJ were designed, including versions linked to immunomodulators and multimers of the immunogen. Display on the surface of the bacteria was evaluated by flow cytometry using the broadly neutralizing monoclonal antibody 2F5. Outbred HET3 mice were vaccinated intramuscularly, and MPER-specific antibody responses were assessed by ELISA and by the ability of the vaccines to induce neutralizing antibodies. Neutralization was measured against tier 1 and tier 2 HIV-1 pseudoviruses. Results: All five vaccines were strongly expressed on the bacterial surface and induced clear MPER-specific antibody responses in every mouse. About 33% of the animals showed detectable HIV-1 neutralization. Conclusions: These results demonstrate that a KWC/GRB-based scaffold-MPER (3AGJ) vaccine can elicit HIV-1 neutralizing antibodies in a subset of animals. Although further optimization will be required to improve the consistency and magnitude of neutralizing responses, the findings provide an initial validation of the concept. There are many strategies that can be used to enhance and extend immune responses induced by KWC/GRB vaccines that can be employed to yield improved anti-HIV-1 immune responses.
Keywords: autotransporter, genome-reduced bacteria, HIV-1 neutralization, HIV-1 vaccine, killed whole-cell, MPER, surface-antigen display, vaccine engineering, vaccine platform
1. Introduction
Vaccination remains an effective and economical public-health intervention, drastically reducing the global burden of infectious diseases [1,2,3]. There is an urgent need for vaccine technologies that are fast, flexible, and easy and inexpensive to produce. Current mRNA, viral-vectored, and protein-subunit platforms—although efficacious—depend on costly reagents and complex bioprocessing, and have cold-chain requirements that limit equitable access, particularly in low- and middle-income regions [4,5,6,7,8]. More economical viral-vectored vaccines may, on the other hand, have limited use for developing vaccines against many pathogens due to anti-vector immunity. An ideal vaccine platform should combine low production cost, rapid adaptability, distribution-friendliness, and scalable manufacturing while maintaining potency and safety. Despite impressive progress, most existing systems face technical challenges in targeting immunogens that are small, hydrophobic, immune-subdominant, or conformationally sensitive, hampering the development of vaccines against difficult viral targets [9,10,11,12,13,14,15,16,17]. Overcoming these barriers is essential for a widely applicable, rapidly deployable vaccine technology.
An effective HIV-1 vaccine must elicit potent humoral responses capable of neutralizing a broad range of viral strains in serum and mucosal compartments [18,19,20,21]. A fraction of chronically infected individuals develop broadly neutralizing antibodies (bNAbs), from which monoclonal bnAbs (bNAbs) have been cloned and characterized [19,22,23,24,25]. Binding sites of those bNAbs have been determined and revealed several vulnerable sites and states of the HIV-1 envelop glycoprotein [26,27]. An immunogen that mimics the binding site of a bNAb can potentially engage naïve B cells and initiate the development of the bnAb lineage. A key goal of HIV vaccine design is to engineer immunogens that elicit bnAb-like responses [28,29]. Among the conserved viral epitopes recognized by bnAbs, the membrane-proximal external region (MPER) of gp41 is targeted by bNAbs 2F5, 4E10, and 10E8 and others, and the fusion peptide (FP) is targeted by bNAbs VRC34.01 [23,24,30,31] and ACS202 [32]. Both MPER and FP are relatively short, linear peptide sequences that make attractive engineering targets, but their structures and physico-chemical characteristics pose challenges for immunogen design [30,33,34]. A problem for vaccine antigen design is that pathogens have evolved so as to elicit immune responses against immunodominant virion features that readily undergo mutation, while highly conserved features that are the targets of antibodies with broadly neutralizing activity, like FP and MPER tend to be immuno-subdominant [35,36,37,38].
Anti-MPER antibodies are frequently detected in sera exhibiting broad HIV-1 neutralizing activity and have been associated with increased neutralization potency and breadth [33,34]. Despite this, early vaccine efforts based on synthetic MPER peptides were unsuccessful, most likely because isolated MPER peptides failed to adopt the correct tertiary structure required for effective antibody induction [39,40]. Later approaches, including liposomal formulations, nanoparticle-based delivery, and scaffold-based immunogens, resulted in only modest or limited neutralization breadth. More recently, computationally designed scaffolded MPER immunogens that recapitulate structural features of native MPER recognized by bNAbs have shown the ability to bind these antibodies, but their practical implementation remains challenging. In particular, expression of MPER-scaffolded proteins in mammalian systems is inefficient, while bacterial, yeast, and Pichia expression often leads to insoluble aggregates or inclusion body formation, complicating purification and large-scale production [41,42]. In addition, MPER-directed bNAbs such as 2F5 possess long, hydrophobic CDR H3 loops that interact with lipid membranes; although these interactions are not strictly required for epitope recognition, they play an important role in achieving high-affinity binding, neutralization breadth, and potency [22,25,43]. Collectively, these observations support the notion that MPER-targeted vaccine immunogens may benefit from presentation in close proximity to a lipid bilayer, thereby more closely approximating the structural and biophysical context of MPER in intact virions.
Killed whole cell bacterial vaccines or bacterins have been used from more than 100 years. There are many currently approved KWC vaccines used both for humans and in agriculture, for example the WHO-preapproved KWC oral cholera vaccines and currently marketed KWC E. coli vaccines for bovine mastitis [44,45,46]. We developed a new vaccine platform that constitutes a contemporary, synthetic biology enabled, structural biology-informed update to the earlier KWC vaccine concept: Killed Whole-Cell Genome-Reduced Bacteria (KWC/GRB). In the KWC/GRB platform recombinant immunogens, expressed under the control of an inducible promoter, are placed on the surface of Gram-negative bacteria, along with immunomodulators. With the KWC/GRB platform we use additional strategies to enhance immunogenicity, for example expressing multimeric versions of the immunogens separated by larger linkers. Genome reduction removes nonessential surface proteins, enhancing antigen visibility. Recombinant immunogens are displayed on the bacterial outer membrane using a Gram-negative autotransporters (ATs) secretion system that export a passenger protein into the extracellular space through the pore of the AT C-terminal β-barrel domain present in the outer membrane. so that the passenger protein emerges on the cell surface. Substituting native passenger sequence with sequence encoding a vaccine antigen can yield bacteria that display ~2 × 105 recombinant antigen copies per cell, [47,48,49,50,51,52,53,54]. Producing a KWC/GRB vaccine then just involves growing the GRB transformed with the expression plasmid, inducing expression of the recombinant surface-expressed immunogen and inactivation of the bacteria.
The E. coli AIDA-I AT is a monomeric autotransporter that can display a wide variety of recombinant proteins at high density and has been shown to function in genome-reduced strains [51]. By fusing engineered antigens to AIDA-I, the KWC/GRB system can place surface displayed immunogens in close proximity to a lipid bilayer—a configuration suited for epitopes like MPER, since some potent neutralizing bNAbs interact with the lipid bilayer in addition to sites on the MPER peptide itself [55].
The first demonstration of the KWC/GRB platform was described in Maeda et al. [55]. KWC/GRB vaccines expressing either a Porcine Epidemic Diarrhea Virus (PEDV) FP or a SARS-CoV-2 FP protected pigs against clinical disease after challenge with infectious PEDV. Building on that work, Quintero et al. [56] introduced a Design–Build–Test–Learn (DBTL) workflow using the HIV-1 fusion peptide (FP) as a model antigen. In that study, FP multimerization, long, rigid α-helical linkers (AQQASSS × 3), and short immunomodulatory sequences (PADRE, a non-cognate T-cell agonist [57,58], and a derivative of Salmonella flagellin (FLIC), a TLR-5 agonist [59,60,61,62], or the Group B streptococcus surface immunogenic protein (rSIP), a TLR-2 and -4 agonist [63]) were added to improve immunogenicity. We used multimerization to increase the amount of immunogen and because we hypothesized that providing multimeric versions of the immunogen would enable an increase in B-cell precursor B-cell receptor avidity, since the overall binding constant would be the product of the individual binding constants and multiple antigen-B-cell receptor binding events would produce multiple signal transduction events to initiate differentiation and antibody maturation. Particularly for HIV, B-cell precursors for some of the most desirable Abs appear to have very low affinity B-cell receptors for the HIV antigens. The α-helical linker also helps maintain the FP units in a more extended shape that antibodies can access. Combining several of these immunogen engineering strategies increased the ability of the immunogens to induce antibodies, as assessed by ELISA AUC values, by about 8-fold over a single FP immunogen. Unfortunately, the induced antibodies did not neutralize HIV, probably because the FP sequence was not expressed in its native conformation. However, the study established strategies that can be used to engineer KWC/GRB vaccines with substantially increased immunogenicity. If the antigen expressed using the KWC/GRB platform is stabilized in a biologically correct conformation, vaccines made using the platform should elicit a neutralizing immune response.
In this work, we used an MPER-derived scaffolded antigen, 3AGJ, designed to provide a stable structure closely resembling the binding sites of multiple bNAbs [11]. The 3AGJ design preserves the continuous α-helical segment encompassing the epitope and embeds it within a compact framework that limits hydrophobic collapse [9,10]. Prior studies demonstrated that 3AGJ-based immunogens preserve bNAb-recognition surfaces and are also bound by the very high affinity 10E8 class antibodies in recombinant proteins and on nanoparticles [11,64]. Making a candidate HIV vaccine by using 3AGJ in the KWC/GRB platform and the AIDA-I AT expression cassette enables the expression of the structurally rigid 3AGJ recombinant antigen on the surface of bacteria, adjacent to a membrane, and recreates the lipid bilayer-adjacent environment required for maximal MPER binding by some bNAbs.
Here we describe five different 3AGJ scaffold-derived KWC/GRB vaccine candidates All five vaccines showed high-affinity binding by the bNAb 2F5 in flow cytometry studies, confirming proper antigen folding and exposure. Mice (n = 5 per group) immunized intramuscularly with each vaccine developed anti-MPER IgG responses detectable by ELISA, inducing the production of anti-3AGJ antibodies. Sera from at least one mouse in every group exhibited measurable ID50 neutralization against tier-1 HIV-1 pseudovirus, and several groups contained multiple animals showed neutralization across more than one pseudovirus. These outcomes provide functional evidence that the KWC/GRB platform can elicit neutralizing activity when coupled with structurally stabilized, membrane-anchored scaffolded MPER immunogens.
The findings provide a proof-of-principle for the KWC/GRB platform, showing that with the right expressed antigen, it can induce a neutralizing antibody response. The results confirm that KWC/GRB vaccines can display conformationally sensitive epitopes and induce specific antibodies that yield detectable neutralization in vivo. These initial candidate vaccines can then be used in combination with other vaccines and improved vaccination strategies to develop even more immunogenic vaccines.
2. Materials and Methods
2.1. Vaccines Design
Five vaccine candidates were designed, informed by the immunogenicity enhancement strategies we recently established [56]. All candidates encoded the HIV-1 MPER-derived scaffold 3AGJ (gp41 residues 659–683) incorporated within the scaffold [11]. Each vaccine included an N-terminal 3DA (DADADA) motif, which improves surface display [56] and to inhibit the expressed protein from burying itself into the outer membrane lipid bilayer. To modulate immune activation, several vaccines incorporated immunomodulatory sequences, including Flagellin from Salmonella enterica (FLIC—TLR5 agonist fragment) [59,60,61,62,65], Pan DR Epitope non-cognate T-cell antigen (PADRE—universal CD4+ T-helper epitope) [57,58], Group B streptococcal surface immunogenic protein (rSIP—TLR4 antagonist) [63] and OX40L (T-cell co-stimulation) [66].
AQQASSS Three linker designs were used to control spatial separation between domains: L1 (GSGSGSGS) [46], L2 (AQQASSS × 3) [47], a long, rigid alpha helix structure with a length exceeding that of the typical size of B-cell receptor, and L3 ((EAAAK)4–L–(EAAAK)4) [67,68,69]. Linker L1 was used to separate adjacent immunomodulatory sequences, L2 to separate repeated 3AGJ units, and L3 to connect the immunomodulator and antigen domains. These designs were informed by our previous work [56].
2.2. Three-Dimensional Structure Prediction
After developing each vaccine design, AlphaFold2 v2.3.0 [70] was used to generate predicted tertiary structures for the 3AGJ scaffold designs. For multimeric versions, the repeated 3AGJ–linker units were modeled as a single continuous polypeptide chain. Five independent AlphaFold2 runs were performed per vaccine with template search enabled. The highest-confidence model, as determined by pLDDT and pTM scores, was visualized in UCSF ChimeraX (version 1.11.1) for figure generation [71,72,73]. Models were used qualitatively to guide vaccine design and assess spatial orientation of linkers and immunomodulators; no quantitative structural restraints were inferred. The AIDA-I autotransporter domain used for surface anchoring corresponded to residues Q962–F1286 from UniProt entry Q03155.
2.3. Plasmid Construction
All DNAs encoding the immunogens were commercially synthesized (Twist Bioscience, South San Francisco, CA, USA), inserted into the pRAIDA2 expression vector and sequence verified. This plasmid includes a rhamnose-inducible promoter, a high-copy origin of replication, a kanamycin resistance gene, and an AIDA-I autotransporter cassette that enables surface display of recombinant proteins.
2.4. Bacterial Strain and Transformation
The genome-reduced Escherichia coli strain ME5125 (harboring a 29.7% genomic deletion) was obtained from Dr. Jun Kato (Tokyo Metropolitan University, Tokyo, Japan) through the National Bioresource Project [74,75]. The strain originates from E. coli MG1655 and was routinely cultured in LB broth or on LB agar at 37 °C. Following transformation with the pRAIDA2-based expression constructs, cultures were maintained in media supplemented with kanamycin (50 µg/mL) for plasmid selection.
To generate electrocompetent cells, ME5125 cultures were grown overnight at 37 °C, diluted 1:100 into fresh LB medium, and incubated until reaching logarithmic growth as determined by OD600 monitoring. Cells were washed sequentially ice-cold distilled water and water containing 10% glycerol, resuspended in water–10% glycerol, and electroporated with the recombinant pRAIDA2 plasmids with the MPER (3AGJ scaffold)-derived sequences using 0.1 cm cuvettes and a Gene Pulser Xcell™ (Bio-Rad Laboratories, Hercules, CA, USA) at 1.8 kV, 25 µF, 200 Ω. After electroporation, cells were recovered for 1 h at 37 °C in SOC medium, then plated on LB agar with kanamycin for colony selection.
2.5. Colony PCR Verification
To verify successful transformation, three to five kanamycin-resistant colonies from each design were screened by colony PCR. A sterile pipette tip was used to gently touch each colony, which was then transferred into 5 mL of LB broth containing kanamycin (50 µg/mL) to initiate an overnight starter culture. The same tip was subsequently dipped into a 16 µL reaction mixture prepared with Phusion Flash High-Fidelity Master Mix (Thermo Fisher Scientific, Waltham, MA, USA) and the primer pair pRAIDA forward (5′-CAGCATATGCACATGGAACA-3′) and pRAIDA reverse (5′-CATAACTTCCGTTCTCCGGT-3′). PCR cycling conditions were: 95 °C for 2 min, followed by 35 cycles of 95 °C for 45 s, 58 °C for 45 s, and 72 °C for 1 min 20 s, with a final extension at 72 °C for 5 min. Amplicons were resolved on 1.5% agarose/TAE gels and visualized under UV illumination. Colonies yielding amplicons of the expected size were retained for subsequent expression and immunization studies. The corresponding 5 mL LB starter cultures were expanded overnight to generate the inoculum for vaccine production. In parallel, an aliquot of each verified culture was mixed 1:1 with sterile 30% glycerol (final 15%) and stored at −80 °C as a long-term master stock.
2.6. Vaccine Production
Overnight cultures were prepared in LB broth supplemented with kanamycin (50 µg/mL) and incubated at 37 °C with shaking (210 rpm). The following day, each culture was diluted 1:10 in fresh LB medium and grown until reaching an OD600 of 0.5–0.6, at which point expression was induced with 5 mM L-rhamnose for 2 h at 37 °C. Cells were then collected by centrifugation (5000× g, 20 min, 4 °C), resuspended in Hank’s Balanced Salt Solution (HBSS) containing 0.2% formalin, and chemically inactivated for 1 h at 37 °C with gentle agitation. Following inactivation, bacterial pellets were washed twice with 1× PBS to remove residual formalin. Formalin was used solely for bacterial killing, and only washed, inactivated whole-cell preparations were administered to animals. Final vaccine preparations were resuspended in PBS containing 20% glycerol to an OD600 of 1.0 (corresponding to approximately 8 × 108 bacteria/mL), aliquoted into sterile cryovials, and stored at −80 °C until use.
2.7. Post-Inactivation Testing
Each vaccine batch was evaluated for sterility immediately following the final PBS wash. Triplicate 100-µL aliquots of each preparation were serially diluted 10-fold (100–10−4) and spread onto LB agar plates, which were incubated at 37 °C for 7 days (detection limit: 0.2 CFU mL−1). In parallel, a 1-mL sample from each batch was inoculated into 10 mL of LB broth and incubated statically at 37 °C for 14 days. No colony formation or turbidity was observed in any sample, confirming complete bacterial inactivation across all vaccine lots.
2.8. Flow Cytometry
Formalin-inactivated bacterial suspensions (5 × 107 cells/mL) were blocked in PBS containing 10% fetal bovine serum (FBS) for 30 min on ice. After a wash step with PBS supplemented with 2% FBS, samples were incubated with 2 µg/mL of the anti-HIV-1 MPER monoclonal antibody 2F5 for 30 min on ice. Cells were then washed and stained with Alexa Fluor 488-conjugated goat anti-human IgG (1:600; Invitrogen, Carlsbad, CA, USA) for an additional 30 min on ice. Data acquisition was performed using an Attune CytPix Flow Cytometer (Invitrogen), and analyses were conducted with FCS Express 7 software, version 7.28.0035 (De Novo Software, Pasadena, CA, USA). Gating was based on forward- and side-scatter profiles, and percentage binding was quantified relative to unstained bacterial controls. Experimental controls included untransformed ME5125 bacteria processed in parallel to determine background fluorescence, a PBS blank to monitor instrument baseline, an isotype control antibody to assess nonspecific binding, and a secondary-only control to measure autofluorescence. All flow cytometry experiments were conducted at the University of Virginia Flow Cytometry Core Facility.
2.9. Mouse Immunization
Outbred HET3 mice (Jackson Laboratory genetic stock; F1 [CByB6F1 × B6C3F1], catalog #036603) were obtained at 6 weeks of age and acclimated for at least 7 days under specific-pathogen-free (SPF) conditions (12 h light/dark cycle, with feed and water provided ad libitum). Animals were block-allocated into five experimental groups corresponding to the five vaccine candidates, plus two control groups receiving either PBS or formalin-inactivated untransformed ME5125, with five mice per vaccine group (three females and two males; V4, n = 4 [three females and one male]). Immunizations were administered intramuscularly in the quadriceps at weeks 0 (prime), 3, 6, 9, and 12 using 5 × 109 inactivated bacteria suspended in 50 µL PBS per dose. Blood samples were collected by submandibular bleed prior to the first vaccination (pre-immune, week 0) and at weeks 3, 6, 9, and 12. At week 15, terminal cardiac exsanguination was performed under deep surgical anesthesia induced by intraperitoneal injection of ketamine (100 mg/kg) and xylazine (10 mg/kg). Plasma was isolated by centrifugation (10,000× g, 10 min) and stored at −80 °C until analysis. Mice were weighed weekly and monitored after each immunization for signs of local reactogenicity (erythema, swelling) and systemic effects (ruffled fur, lethargy). No unexpected adverse events or significant differences in behavior were observed during the study. In particular, no signs consistent with formalin-related toxicity were detected following immunization.
2.10. Enzyme-Linked Immunosorbent Assay (ELISA)
High-binding 96-well plates (Thermo Fisher) were coated overnight at 4 °C with recombinant HIV-1 MPER peptide (sequence: 656-NEQELLELDKWASLWNWFDITNWLWYIK-683; Biomatik, Kitchener, ON, Canada) at a concentration of 1 µg/mL in PBS (pH 7.4). Plates were washed three times with TBST (TBS containing 0.05% Tween-20) and blocked for 1 h at room temperature with 3% BSA in TBST. Mouse plasma samples were serially diluted from 1:10 to 1:10,000 in 1% BSA/TBST using a 10-fold dilution series (1:10, 1:100, 1:1000, and 1:10,000), and each dilution was added to the plate in duplicate. After 1 h incubation at room temperature, plates were washed and bound IgG was detected using HRP-conjugated goat anti-mouse IgG (Thermo Fisher; 1:5000) for 1 h, followed by TMB substrate development. Reactions were stopped with 1 N H2SO4, and absorbance was measured at 450 nm. Each assay included an 8-point standard curve of the 2F5 monoclonal antibody (starting at 1 µg/mL, 3-fold serial dilutions) to verify assay performance and to calculate relative antibody units (RAU) using a 4-parameter logistic regression fit. Negative controls included blank wells (no antigen), secondary-only wells, a pre-immune serum pool, and sera from mice immunized with untransformed ME5125 bacteria prepared in the same way as the vaccines.
For descriptive and comparative analyses, ELISA responses were primarily summarized using the area under the curve (AUC) calculated from OD450 values across the full dilution series. In addition, endpoint titers were determined as a complementary readout and defined as the highest serum dilution yielding an OD450 value greater than the mean blank signal plus three standard deviations. Endpoint titers were calculated for all animals, vaccines, and time points, and are reported in Supplementary Table S1 to contextualize inter-animal variability observed in AUC-based analyses.
2.11. Neutralization Assays
Neutralization assays were performed at Duke University using HIV-1 Env pseudoviruses [76] (25710-2.43, CNE55, MN.3, and X1632_S2_B10) and TZM-bl cells [77,78], following standard operating. Mouse plasma samples were heat-inactivated (56 °C, 15 min) and serially diluted in cell culture medium. The diluted plasma was incubated with pseudovirus for 1 h at 37 °C, then added to TZM-bl cells. After approximately 48 h, luciferase activity was measured. ID50 and ID80 titers were defined as the reciprocal serum dilutions at which relative luminescence units (RLUs) were reduced by 50% or 80%, respectively, compared to virus control wells after subtraction of background RLUs from cells controls. Samples that did not reach 50% inhibition within the tested dilution range were reported as ID50 < lowest dilution tested. Virus-specific assay positivity ID50 cutoffs were determined as the 90th percentile of ID50 titers of all baseline mouse plasma samples.
The HIV-1 pseudovirus panel included MN.3 (tier 1A), 25710-2.43 (tier 1B), and the tier 2 viruses CNE55 and X1632_S2_B10. Thus, three of the four strains correspond to difficult-to-neutralize tier-2 viruses, offering a stringent and representative panel for evaluating neutralization breadth.
2.12. Statistical Analysis
All statistical analyses were performed in R v4.4.1 using the packages tidyverse, ggplot2, psych, corrplot, FactoMineR, factoextra, AER, lmtest, car, broom, and pROC. The full analysis workflow, including preprocessing, model fitting, and visualization steps, was implemented using custom R scripts developed by the authors with assistance from ChatGPT (OpenAI, GPT-5.2 model), and the complete annotated code is provided in Supplementary File S1. ELISA titration curves were fitted using a four-parameter logistic model to compute AUC(ELISA). Flow-cytometry titration curves for 2F5 were modeled using nonlinear least-squares regression to estimate EC50 values, which were transformed to the exposure_score (−log10EC50). The integrated flow-cytometry signal, AUC(FLOW), was calculated as the area under the fluorescence–antibody concentration curve. Neutralization titers below the detection limit (<45) were set to the cutoff prior to log10 transformation. All datasets (ELISA, flow cytometry, neutralization) were merged by animal ID and immunization week to generate a unified matrix for analysis.
Associations between antigen display (exposure_score and AUC(FLOW)) and antibody magnitude (AUC(ELISA)) were assessed using both Pearson and Spearman correlations to capture linear and rank-based relationships. Statistical significance was evaluated using Benjamini–Hochberg false discovery rate (FDR) correction, and 95% confidence intervals were obtained from bootstrapped standard errors. Neutralization data were analyzed per pseudovirus and also as a composite neutralization index calculated as the mean log10ID50 across all viruses tested.
To determine whether antigen display or antibody magnitude predicted neutralization potency, linear regression models were fitted; because ID50 values include left-censored data at the assay detection limit, censored-normal (Tobit) regression was also conducted using the AER package (version 1.2-15). Model assumptions were verified through standardized residuals, Q–Q plots, and variance inflation factors. Multivariate relationships among assays were examined using principal component analysis (PCA) on z-scored variables (exposure_score, AUC(FLOW), AUC(ELISA), and mean log10ID50). Hierarchical clustering with Euclidean distance and complete linkage was used to visualize the modular organization of display, binding, and neutralization variables.
Responder analyses quantified the proportion of animals achieving ID50 titers at or above predefined thresholds for each pseudovirus. Paired week-0 and week-15 neutralization values were also compared to confirming acquisition of functional activity during immunization. Unless otherwise noted, data are presented as mean ± SEM, and statistical significance was defined as p < 0.05 after FDR adjustment.
2.13. Ethics, Animal Welfare, and Biosafety
All animal procedures were conducted in accordance with the Guide for the Care and Use of Laboratory Animals and were approved by the University of Virginia Animal Care and Use Committee (protocol 41101224; approval date: 5 November 2024; Unique ID: 7018391). Recombinant DNA work and handling of formalin-inactivated E. coli vaccine lots were performed under BSL-2 conditions approved by the UVA Institutional Biosafety Committee (IBC protocol 4276-15). The study complied with ARRIVE reporting guidelines where applicable.
3. Results
3.1. Scaffold-MPER KWC/GRB Vaccine Design
We used strategies previously determined to enhance the immunogenicity of recombinant vaccine immunogens to design immunogens based on the MPER scaffold 3AGJ protein in the KWC/GRB platform. These included expressing multimer versions of 3AGJ, separated by a long, rigid alpha helical linker, with added immunomodulators, including the PADRE non-cognate T-cell agonist, and sequences that function as TLR agonists, and a T-cell co-stimulatory molecule (Table 1).
Table 1.
Components of the Scaffold-MPER construct library.
| Component | Name | Sequence | Abbreviation | Function | Refs |
|---|---|---|---|---|---|
| Motif | DADADA Box | DADADA | 3DA | Increases expression of autotransporter-expressed recombinant passenger proteins | [56] |
| Immunomodulators | Pan DR Epitope non-cognate T-cell antigen | AKFVAAWTLKAAA | PADRE | Enhances the adaptive immune response by providing broad T-helper cell epitope coverage, thereby improving T-cell activation and memory | [57,58] |
| Flagellin from Salmonella enterica (short fragment) | GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ | FLIC | TLR5 agonist | [59,60,61,62,65] | |
| Grp A Strep Recombinant Surface Immunogenic Protein | CDTTWTARTVSEVKADLVKQDNK | rSIP | TLR2 and 4 agonists | [63] | |
| OX40L peptide | SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL | OX40L | T-cell co-stimulation | [66] | |
| Antigen | 3AGJ | KPHMNLVVIGHVDHGKSTLVGHLLARLGYIEWFKLTNLLWQARARGKGSFGFAWILDKMKEERERGITIDLTFMKFETKKYVFTIIDAPGHRDFVKNMITGASQADAAILVVSARKGEFEAGMSTEGQTREHLLLARTMGIEQIIVAVNKMDAPDVNYDQKRYEFVVSVLKKFMKGLGYQVDKIPFIPVSAWKGDNLIERSPNMPWYNGPTLVEALDQLQPPAK | 3AGJ | HIV MPER target | [11] |
| Linkers | GSx4 | GSGSGSGS | L1 | Shorter linker with non-charged, hydrophilic amino acids | [69] |
| AQQASSS × 3 | AQQASSSAQQASSS AQQASSS | L2 | Semi-flexible alpha helical linker between scaffold repeats | [68] | |
| (EAAAK)4–L–(EAAAK)4 | AEAAAKEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKEAAAKA | L3 | Rigid linker separating immunomodulator from antigen | [67] |
The 3AGJ component of the vaccines was originally designed as an MPER scaffold to present bNMAbs 10E8/4E10 binding site and is also recognized by bNMAb 2F5. The resulting Scaffold-MPER immunogen designs comprised five candidates (V1–V5) that incorporated immunomodulatory elements (PADRE, FLIC, rSIP, OX40L) and either a single 3AGJ or multimers of 3AGJ (Table 1 and Table 2). Each design represented selected design features.
Table 2.
Composition of the five 3AGJ vaccine designs.
| Vaccine | Composition (N → C) |
|---|---|
| V1 | 3DA–3AGJ |
| V2 | 3DA–PADRE–GS × 4–3AGJ |
| V3 | 3DA–PADRE–GS × 4–FLIC–GS × 4–3AGJ |
| V4 | 3DA–PADRE–GS × 4–rSIP–GS × 4–short FLIC–(EAAAK)4–L–(EAAAK)4–3AGJ–AQQASSS × 3–3AGJ |
| V5 | 3DA–PADRE–GS × 4–rSIP–GS × 4–short FLIC–GS × 4–OX40L–(EAAAK)4–L–(EAAAK)4–3AGJ–AQQASSS × 3–3AGJ |
3.2. Structural Modeling and Predicted Architecture
Predicted tertiary structures generated with AlphaFold2 (v2.3.0) showed that all designs were likely to fold correctly and that the addition of the immunomodulators and other features were unlikely to disrupt the basic structure of the 3AGJ domain (Figure 1a–e). The models had high confidence scores (pLDDT and pTM > 85%). They also retained the main structural features of 3AGJ, including the central helix and the surrounding elements that stabilize the MPER in its antibody-bound shape. AlphaFold2 does not account for the bacterial outer membrane, so any predicted orientation in which the antigen bends downward toward the β-barrel would not occur in vivo because that space is blocked by the membrane lipid bilayer. These structures should therefore be interpreted as folding predictions, considering the current limitations of the modeling software.
Figure 1.
Predicted tertiary structures of the five 3AGJ vaccine designs (V1–V5) generated with AlphaFold2 v2.3.0. Each panel (a–e) shows three views of the same model, presented from left to right as a side view, a top-down view looking toward the expressed antigen, and a 180-degree rotated side view. Structural elements are color-coded as follows: 3DA motif (magenta), immunomodulators (PADRE in red, rSIP in orange, FLIC in wheat, OX40L in silver), linkers (GS × 4—L1, AQQASSS × 3—L2, (EAAAK)4–L–(EAAAK)4—L3; green), the Scaffold-MPER 3AGJ (yellow), and the AIDA-I β-barrel (pink). (a) V1 Design containing 3DA, the Scaffold-MPER 3AGJ domain, and AIDA-I. (b) V2 Design containing 3DA, PADRE, the GS × 4 linker (L1), Scaffold-MPER 3AGJ, and AIDA-I. (c) V3 Design containing 3DA, PADRE, L1, FLIC, L1, Scaffold-MPER 3AGJ, and AIDA-I. (d) V4 Design containing 3DA, PADRE, L1, rSIP, L1, FLIC, the AQQASSS × 3 linker (L3), Scaffold-MPER 3AGJ, the AEAAAK linker (L2), and a second Scaffold-MPER 3AGJ domain. (e) V5 Design containing 3DA, PADRE, L1, rSIP, L1, FLIC, L1, OX40L, L3, Scaffold-MPER 3AGJ, L2, and a second Scaffold-MPER 3AGJ domain. All AlphaFold2 models produced high pLDDT and pTM confidence scores (>85%). AlphaFold2 does not account for the bacterial outer membrane, so any predicted orientation in which the antigen extends downward along the β-barrel would not occur in vivo because that space is blocked by the outer membrane lipid bilayer. The structures should therefore be interpreted in the light of the software limitations. Abbreviations: 3DA, DADADA motif; PADRE, Pan DR epitope; rSIP, Group B Streptococcus recombinant surface immunogenic protein; FLIC, flagellin fragment (TLR5 agonist); OX40L, OX40 ligand peptide; L1, GS × 4 linker; L2, AQQASSS × 3 linker; L3, (EAAAK)4–L–(EAAAK)4 linker; 3AGJ, scaffolded HIV-1 MPER antigen; AIDA-I, autotransporter β-barrel domain.
V1 represented the minimal configuration. It contained 3DA linked directly to 3AGJ scaffold, without any additional immunomodulators (Figure 1a). V2 added the PADRE sequence upstream of 3AGJ through the flexible GS × 4 linker, which extended the 3AGJ region outward (Figure 1b). V3 included PADRE followed by the short FLIC segment, resulting in a slightly longer arrangement (Figure 1c). V4 and V5 contained two copies of 3AGJ. These domains were separated by the longer semi-rigid alpha helical AQQASSS × 3 linker and were combined with additional immunomodulators. V4 included rSIP and a short FLIC, while V5 also included OX40L (Figure 1d,e). In the AlphaFold2 predictions, the two linked 3AGJ units remained parallel and remained separated from each other, and all immunomodulators were positioned in solvent-exposed regions.
Taken together, these in silico predictions support the concept that the strategy produced stable designs with the 3AGJ components arranged in what could be anticipated to be exposed on the surfaces of the outer membranes of the GRB, appropriate for the production of KWC/GRB vaccines.
3.3. Surface Expression and bNAb 2F5 Recognition
Surface expression of the MPER epitope was assessed by flow cytometry using the bNAb 2F5 [22]. All five vaccines showed strong, concentration-dependent binding (Figure 2). Untransformed ME5125 bacteria showed minimal binding, as expected.
Figure 2.
Flow cytometric analysis of 2F5 binding to formalin-inactivated KWC/GRB cells expressing the V1–V5 immunogen designs. Binding was measured across a range of 2F5 concentrations (µg/mL, log10 scale). Each curve shows the percentage of 2F5-positive cells. ME5125 cells without a passenger domain served as the baseline control (red). Curves are colored as follows: V1 (blue), V2 (green), V3 (orange), V4 (purple), and V5 (brown). All vaccines showed clear, concentration-dependent binding that reached a plateau at higher antibody concentrations. V4 and V5 curves shifted left relative to V1–V3, indicating stronger surface exposure of the Scaffold-MPER 3AGJ epitope and higher apparent binding by 2F5. These data confirm that all vaccines displayed MPER on the bacterial surface, and that multimeric designs (V4 and V5) increased antigen accessibility. Abbreviations: KWC/GRB, killed whole-cell/genome-reduced bacteria; 2F5, MPER-specific broadly neutralizing antibody; ME5125, genome-reduced E. coli strain used as baseline control; MPER, membrane-proximal external region; 3AGJ, scaffolded HIV-1 MPER antigen.
Quantitatively, the binding curves for all vaccine designs approached saturation at high antibody concentrations, indicating uniform surface accessibility. However, left-shifted dose–response curves were observed for V4 and V5 compared to V1, V2, and V3, consistent with higher apparent affinity and the fact the V4 and V5 both had two 3AGJ epitopes in each expressed immunogen. V1 and V3 showed intermediate profiles, while V2 required the highest 2F5 concentrations to reach plateau levels. The resulting rank order of apparent binding strength was V4 ≳ V5 > V1 ≈ V3 > V2.
These results demonstrate that 3AGJ was efficiently expressed and properly folded across all vaccines, and that increased modular complexity (addition of rSIP, FLIC, and OX40L together with duplicated 3AGJ) correlated with enhanced 2F5 recognition—an early indicator of preserved MPER antigenicity.
3.4. Induction of MPER-Specific Antibodies (ELISA)
To assess the humoral immunogenicity of the scaffold-MPER 3AGJ vaccines, outbred HET3 mice were vaccinated intramuscularly at weeks 0, 3, 6, 9, and 12 with 5 × 109 formalin-inactivated bacteria (Figure 3a). Plasma samples were collected longitudinally and evaluated by ELISA using a synthetic MPER peptide corresponding to gp41 residues 659–683. Across all vaccine groups, MPER-specific IgG responses were detected following immunization, with antibody levels varying across animals and time points (Figure 3b).
Figure 3.
Vaccination regimen and longitudinal anti-MPER antibody responses induced by 3AGJ MPER vaccines. (a) Schematic of the vaccination schedule. Outbred HET3 mice (n = 5 per group; V4, n = 4) received intramuscular injections of 5 × 109 formalin-inactivated bacteria at weeks 0, 3, 6, 9, and 12. Plasma samples were collected at each indicated time point, with terminal sampling at week 15. (b) ELISA analysis of plasma IgG binding to a synthetic MPER peptide. Data are shown as mean ± SEM AUC(ELISA) values for each vaccine group over time. MPER-specific antibody responses were detected in all vaccinated groups, whereas mice immunized with untransformed bacteria did not exhibit MPER-specific binding. To contextualize inter-animal variability observed in AUC values, endpoint titers for individual animals, defined as the highest serum dilution yielding binding above background, are reported in Supplementary Table S1. Abbreviations: MPER, membrane-proximal external region; AUC(ELISA), area under the ELISA binding curve; SEM, standard error of the mean; 3AGJ, scaffolded HIV-1 MPER antigen.
Mean AUC(ELISA) values increased after the initial prime and booster doses and were maintained through later time points, although substantial inter-animal variability was observed within each group. Antibody responses were detectable in all vaccinated groups (V1–V5), whereas mice immunized with the negative control vaccine derived from untransformed ME5125 did not exhibit MPER-specific binding. Vaccine groups containing duplicated 3AGJ units (V4 and V5) tended to show higher mean endpoint AUC(ELISA) values compared with monomeric designs, while V3 (single 3AGJ with extended linkers) exhibited intermediate responses.
To further contextualize the observed variability in AUC values, endpoint titers were determined for individual animals as a complementary ELISA readout. Endpoint analysis confirmed seroconversion in nearly all vaccinated mice and demonstrated that the increased variability reflected heterogeneity in response magnitude rather than the presence of non-responders (Supplementary Table S1).
Analysis of individual animal data confirmed seroconversion in nearly all vaccinated mice (n = 5 per group; n = 4 for V4), with variability in the magnitude and durability of antibody responses across animals. While multimeric designs were associated with higher average antibody levels, overlap between groups was evident, underscoring the heterogeneity of responses in this outbred mouse model.
Collectively, these data demonstrate that all scaffold-MPER 3AGJ vaccines were immunogenic and capable of inducing sustained MPER-specific antibody responses. Differences among vaccine designs suggest that antigen valency may influence the magnitude of the humoral response, although the variability observed across animals indicates that additional factors beyond antibody quantity likely contribute to downstream functional outcomes.
3.5. Neutralizing Activity Against HIV-1 Pseudoviruses
Neutralizing antibody responses were evaluated using a panel of HIV-1 Env pseudoviruses representing different tiers of neutralization sensitivity. The panel included MN.3 (tier 1A), 25710-2.43 (tier 1B), and the tier 2 viruses CNE55 and X1632_S2_B10. Among these viruses, only MN.3 shares sequence identity with the vaccine MPER sequence in the corresponding region. Plasma samples collected at weeks 0 and 15 were assessed using pseudovirus-based TZM-bl neutralization assays. All week 0 plasma samples were below assay detection thresholds, confirming the absence of pre-existing neutralizing activity.
At week 15, neutralizing activity above predefined assay cutoffs was detected in a subset of vaccinated animals (Figure 4). Overall, eight of the 24 vaccinated mice (approximately 33%) exhibited neutralizing activity against at least one pseudovirus. Neutralization was most frequently observed against the tier 1B virus 25710-2.43, followed by MN.3 (tier 1A) and CNE55 (tier 2), whereas no neutralizing activity was detected against the tier 2 virus X1632_S2_B10. Neutralization events were sporadic and heterogeneous, with individual animals displaying variable magnitudes of activity across viruses.
Figure 4.
Neutralizing antibody activity measured at week 15 in mice vaccinated with 3AGJ MPER vaccines. Neutralizing antibody titers (ID50) were determined in plasma samples collected at week 15 from individual mice vaccinated with 3AGJ MPER vaccines (V1–V5). Neutralization was assessed using HIV-1 Env pseudoviruses CNE55 (tier 2), X1632_S2_B10 (tier 2), 25710-2.43 (tier 1B), and MN.3 (tier 1A), shown in the same order as the panels. Each colored dot represents an individual mouse; black diamonds indicate the group mean ± SEM. Dashed horizontal lines denote predefined neutralization cutoffs for each virus (84.2 for CNE55, 121 for X1632_S2_B10, 63 for 25710-2.43, and 45 for MN.3), with titers above these thresholds considered positive. Neutralizing activity was detected in a subset of animals and occurred sporadically across vaccine groups, appearing most frequently against the tier 1B virus 25710-2.43 and not observed against X1632_S2_B10. Abbreviations: ID50, 50% inhibitory dilution; SEM, standard error of the mean; MPER, membrane-proximal external region; 3AGJ, scaffolded HIV-1 MPER antigen.
To determine whether antigen multimerization influenced the likelihood or quality of neutralizing responses, animals were grouped according to vaccine class, with V1–V3 classified as monomeric and V4–V5 as multimeric constructs. When neutralization was considered as a binary outcome, defined as exceeding the virus-specific ID50 cutoff for at least one pseudovirus, a higher proportion of neutralizing mice was observed in the multimeric group compared with the monomeric group. However, this difference did not reach statistical significance by Fisher’s exact test (p = 0.41).
We next compared the magnitude of neutralizing responses between monomeric and multimeric vaccine classes using the log10ID50 values per animal across neutralized viruses. Although multimeric vaccines showed a trend toward higher neutralization titers, this difference was not statistically significant (Wilcoxon rank-sum test, p = 0.55). These results indicate that multimerization alone did not produce a clear increase in neutralization potency at the cohort level.
To further assess neutralization breadth, defined as the number of pseudoviruses neutralized by each animal, we compared breadth distributions between monomeric and multimeric vaccine classes. Broad neutralization was observed in both classes, with a small number of animals in each group neutralizing more than one virus. Overall, the breadth distributions overlapped substantially, and no statistically significant difference between monomeric and multimeric vaccines was detected (Wilcoxon rank-sum test, p = 0.59).
Taken together, these analyses show that neutralizing activity was detected in a subset of animals vaccinated with scaffolded MPER immunogens delivered by the KWC/GRB platform. Neutralization-positive mice were observed in both monomeric and multimeric vaccine groups. Comparisons between vaccine classes revealed no statistically significant differences in the proportion of neutralizing animals, neutralization magnitude, or neutralization breadth. These results indicate that, within the conditions tested, neutralizing responses occurred at low frequency and with substantial inter-animal variability, without a clear separation between monomeric and multimeric vaccine designs.
3.6. Cross-Assay Correlations Between Antigen Exposure and Humoral Response
To quantitatively compare humoral and surface-display readouts, a composite dataset was assembled combining individual ELISA and flow cytometry measurements from all vaccinated mice (V1–V5) across weeks 3, 6, 9, 12, and 15. For each animal and time point, the dataset included the area under the ELISA curve (AUC(ELISA)), representing the magnitude of anti-MPER IgG binding, together with two flow-derived parameters: (i) the exposure_score (−log10EC50_FLOW), calculated from the fitted binding curves of bnAb 2F5 titration, and (ii) the integrated fluorescence intensity (AUC(FLOW)), obtained from the cumulative signal across the full antibody concentration range. This structure enabled direct point-by-point comparisons between surface antigen accessibility and antibody response within and across vaccine candidates (Supplementary Table S2).
Correlation analyses were performed for each vaccination week using both Pearson’s and Spearman’s coefficients. At week 3, a significant positive correlation was detected between AUC(ELISA) and exposure_score (r = 0.57, p = 0.0039) as well as AUC(FLOW) (r = 0.43, p = 0.036), indicating that animals receiving vaccines with higher surface exposure exhibited stronger antibody responses at early time points (Figure 5 and Figure 6).
Figure 5.
Correlation between AUC(ELISA) and AUC(FLOW) at weeks 3 (a), 6 (b), 9 (c), 12 (d), and 15 (e). Each panel shows individual animal data points (n = 24) with a linear regression line and the corresponding 95% confidence interval; the shaded area represents the 95% confidence interval of the linear regression. All panels share the same y-axis scale to allow direct comparison across time points. Significant positive correlations were observed at weeks 3 (Pearson r = 0.43, p = 0.036) and 15 (Pearson r = 0.55, p = 0.005), indicating an association between antigen exposure measured by flow cytometry and the magnitude of the ELISA antibody response at these time points. Abbreviations: AUC(ELISA), area under the ELISA binding curve; AUC(FLOW), integrated flow cytometry signal.
Figure 6.
Correlation between AUC(ELISA) and exposure_score (−log10(EC50_FLOW)) at weeks 3 (a), 6 (b), 9 (c), 12 (d), and 15 (e). Each dot represents one animal (n = 24). Solid lines indicate the linear regression fit with the corresponding 95% confidence intervals; the shaded area represents the 95% confidence interval of the linear regression. Significant correlations were observed at weeks 3 (Pearson r = 0.57, p = 0.0039) and 15 (Pearson r = 0.60, p = 0.0017). Abbreviations: AUC(ELISA), area under the ELISA binding curve; EC50, half-maximal effective concentration; EC50_FLOW, EC50 derived from flow-cytometry binding curves; exposure_score, −log10(EC50_FLOW).
At week 3, a significant positive correlation was observed between antigen exposure and antibody responses. A similar association was also detected at week 15, whereas correlations at weeks 6, 9, and 12 were weaker and did not reach statistical significance. This temporal pattern was observed across both flow-derived metrics (Figure 7).
Figure 7.
Temporal evolution of Pearson correlation coefficients between AUC(ELISA) and flow-cytometry parameters across vaccination weeks. The solid line represents correlations between AUC(ELISA) and exposure_score (−log10EC50_FLOW), and the dashed line represents correlations between AUC(ELISA) and AUC(FLOW). Asterisks indicate statistically significant correlations (p < 0.05). Significant correlations were observed at weeks 3 and 15, whereas intermediate weeks showed weaker or non-significant associations. Abbreviations: AUC(ELISA), area under the ELISA binding curve; AUC(FLOW), integrated flow-cytometry signal; EC50, half-maximal effective concentration; EC50_FLOW, EC50 derived from flow-cytometry binding curves; exposure_score, −log10(EC50).
Spearman’s rank analysis showed the same overall pattern as the Pearson tests, with significant correlations observed at the same time points (Supplementary Table S3). The two flow-cytometry measures (−log10EC50_FLOW and AUC(FLOW)) yielded similar Spearman correlation values across all weeks analyzed.
3.7. Relationship Between Surface Antigen Display and Neutralizing Activity Induction
To determine whether 3AGJ immunogen surface exposure influenced the generation of neutralizing antibodies, flow cytometry readouts were compared with pseudovirus neutralization titers (ID50) for each animal. Analyses were performed separately for the four tested HIV-1 strains (25710-2.43, CNE55, MN.3, X1632_S2_B10) and on a composite neutralization index (log10ID50 per mouse).
Across individual pseudoviruses, neither the exposure_score (−log10 EC50_FLOW) nor AUC(FLOW) showed significant linear correlations with ID50 titers (|r| < 0.25, p > 0.2). When neutralization data were aggregated into a composite index, correlations remained non-significant (exposure: r = −0.021, p = 0.923; AUC(FLOW): r = −0.033, p = 0.879). Nonetheless, most animals displaying measurable neutralization belonged to vaccines with the highest surface exposure (V4 and V5), suggesting that efficient antigen presentation is necessary but not sufficient for functional activity. The absence of a continuous linear trend suggests that neutralization arises once a structural or immunological threshold is reached rather than increasing proportionally with antigen abundance.
3.8. Relationship Between MPER-Specific Antibody Binding and Neutralization
To determine whether the magnitude of the MPER-specific humoral response was associated with HIV-1 neutralizing activity, ELISA binding responses at week 15 were compared with neutralization outcomes. Antibody binding was quantified as AUC values from MPER peptide ELISAs, and neutralization was assessed using per-virus and composite log10ID50 readouts.
Across individual pseudoviruses, no significant associations were detected between AUC(ELISA) and neutralization titers using either Pearson or Spearman analyses. This lack of association was also observed when neutralization was summarized per animal or examined at the vaccine level. Apparent correlations within small subsets of animals were not reproducible across vaccine groups, indicating that higher MPER-binding antibody levels did not consistently correspond to increased neutralization.
Consistent with these findings, AUC(ELISA) values did not differ significantly between neutralizing and non-neutralizing animals and were not associated with neutralization breadth. Neutralizing activity emerged in a subset of mice spanning a wide range of ELISA responses, including animals with relatively modest binding titers. Together, these results indicate that MPER-specific antibody binding magnitude alone was insufficient to predict the presence, magnitude, or breadth of HIV-1 neutralization in this study.
3.9. Integrated Multivariate Modeling of Display, Binding, and Neutralization
To obtain a descriptive overview of how antigen display, antibody binding, and neutralization varied across animals, a principal component analysis (PCA) was performed using exposure_score, AUC(ELISA), and log10ID50 (Figure 8a,b). The analysis revealed a clear separation between variables related to antigen display and antibody binding, which grouped together, and neutralization, which varied largely independently. Animals vaccinated with constructs containing duplicated 3AGJ units (V4 and V5) tended to occupy regions of the PCA space associated with higher display and binding values, whereas animals vaccinated with V1–V3 clustered closer to the center, consistent with overall lower responses.
Figure 8.
Descriptive multivariate analysis of antigen display, antibody binding, and neutralization. (a) PCA score plot showing animal-level clustering based on exposure_score, AUC(ELISA), and mean log10ID50. Symbols indicate vaccine candidates (V1–V5) labeled by animal ID. (b) PCA variable loadings plot illustrating the relative contributions of display (exposure_score), binding (AUC(ELISA)), and neutralization (mean log10ID50) to PC1 and PC2. V4 and V5 cluster in the upper-right quadrant, combining strong display/binding with moderate neutralization, consistent with orthogonal determinants of immune performance. PCA, principal component analysis; PC1, first principal component; PC2, second principal component; exposure_score, −log10(EC50); AUC(ELISA), area under the ELISA binding curve; mean log10ID50, average log10-transformed neutralization titer. M indicates a male mouse, F indicates a female mouse, with the numbers providing the individual identifier.
Despite these trends, multivariate and regression analyses indicated that antigen display and antibody binding did not reliably predict neutralization outcomes. Neutralizing activity was observed only in a subset of animals, including within vaccine groups showing strong display and binding. As illustrated in Figure 8, these results support a descriptive interpretation in which antigen display and antibody magnitude contribute to the overall immune response but are not sufficient on their own to account for the emergence of neutralizing activity.
3.10. Integrated Correlation Network and Data-Driven Clustering
To provide a descriptive summary of how surface antigen display, antibody binding, and neutralizing activity are organized within the dataset, correlation and clustering analyses were performed using exposure_score, AUC(FLOW), AUC(ELISA), and log10ID50 values across the four HIV-1 pseudoviruses. Variables related to antigen display and antibody binding showed strong positive associations with one another, whereas neutralization measurements exhibited weaker and more limited relationships with these readouts (Supplementary Tables S4 and S5).
Unsupervised hierarchical clustering of standardized variables revealed two main groups (Figure 9). One cluster comprised exposure_score, AUC(FLOW), and AUC(ELISA), reflecting assay readouts related to antigen presentation and antibody magnitude. The second cluster consisted of neutralization measurements, which behaved independently of display and binding metrics. This organization mirrors the patterns observed in the principal component analysis (Section 3.9) and highlights consistent structure across descriptive analytical approaches.
Figure 9.
Descriptive correlation structure and unsupervised clustering of flow cytometry, ELISA, and neutralization measurements. Heatmap and hierarchical clustering of ELISA, flow cytometry, and neutralization measurements across individual animals. Each row represents a single mouse, annotated by vaccine group, and each column corresponds to a quantitative assay variable: mean log10ID50 (neutralization), AUC(ELISA) (antibody magnitude), exposure_score (−log10 EC50; flow-derived antigen accessibility), and AUC(FLOW) (integrated flow-cytometry signal). Values were standardized (z-score) to allow direct comparison across assays. Unsupervised hierarchical clustering illustrates how display- and binding-related measurements group together, whereas neutralization measurements form a separate cluster, reflecting relationships among assay readouts rather than immune mechanisms. Abbreviations: ELISA, enzyme-linked immunosorbent assay; AUC, area under the curve; ID50, 50% inhibitory dilution; EC50, half-maximal effective concentration; FLOW, flow cytometry.
Together, these analyses provide a concise quantitative overview of how experimental readouts are related within this study, rather than a mechanistic explanation of immune responses. Antigen display and antibody binding form a tightly linked set of measurements, while neutralization emerges as a distinct outcome observed only in a subset of animals. Although vaccines V4 and V5 tended to show higher values across both clusters, neutralization remained variable even within these groups, indicating that factors beyond display and antibody magnitude likely contribute to functional activity.
4. Discussion
The present study builds directly on earlier work that established the KWC/GRB platform as a versatile system for antigen display and experimental vaccine development. In initial proof-of-concept studies, Maeda et al. demonstrated that GRB can stably express heterologous antigens on the bacterial surface via an autotransporter and that killed whole-cell vaccines derived from these bacteria can protect animals from viral challenge, even in the absence of detectable serum antibodies by ELISA [55]. Together, these findings positioned KWC/GRB not only as an antigen delivery system, but also as a platform capable of inducing protective immune responses through mechanisms that may extend beyond conventional humoral readouts.
Building on this foundation, Quintero et al. [56] subsequently employed the HIV-1 fusion peptide (FP) as a model antigen to investigate how rational antigen design influences antibody induction within the KWC/GRB platform. In that study, FP immunogens incorporating multimerization, rigid α-helical linkers, and immunomodulatory elements (including PADRE and TLR agonists) elicited robust anti-FP antibody responses and exhibited binding to the FP-directed bnAb VRC34.01. Despite these encouraging binding responses, functional neutralization of HIV-1 was not achieved, most likely because FP displayed on the bacterial surface did not sufficiently reproduce the native FP conformation present in Env. Taken together, these studies established KWC/GRB as a powerful DBTL engine for antigen optimization—capable of presenting diverse antigens and driving antibody responses—while also highlighting that successful neutralization would require surface-displayed immunogens that closely approximate the structural features recognized by relevant bNAbs. At this stage, the KWC/GRB platform is best viewed as a flexible and rapidly adaptable screening system for antigen design, rather than as a fully optimized vaccine formulation, and some degree of biological variability is therefore expected.
In the present work, we tested this idea by replacing HIV-1 FP with a stabilized scaffold-MPER immunogen, 3AGJ [11], which reproduces the conformation recognized by the MPER-directed multiple bNAb. Using the same design principles developed previously, we created a series of 3AGJ vaccines that varied in multimerization, linker architecture, and immunomodulatory content, while keeping the same KWC/GRB platform and AIDA-I based surface display system. Across all vaccines, 3AGJ was efficiently expressed on the bacterial surface and showed strong 2F5 binding, with the highest apparent exposure in the multimeric designs, as expected. All vaccines induced MPER-specific antibodies. Vaccine designs containing duplicated 3AGJ units with added immunomodulators produced the strongest and most sustained anti-MPER peptide Ab responses. These results show that a structurally stabilized MPER antigen can be displayed on the KWC/GRB platform and is immunogenic in vivo.
Neutralizing activity against HIV-1 pseudoviruses was detected in a subset of animals. Although ID50 titers were modest, several mice reached values above predefined assay cutoffs for one or more viruses. Neutralization events were observed across multiple vaccine designs and were heterogeneous in magnitude and virus specificity. While neutralization was more frequently detected in animals vaccinated with constructs containing duplicated 3AGJ scaffolds and additional immunomodulatory elements, comparisons between vaccines carrying one versus two copies of 3AGJ did not reveal statistically significant differences in neutralization outcomes. These observations suggest that increased epitope copy number and immunomodulatory content may contribute to conditions that permit functional antibody induction but are not sufficient on their own to predict neutralization. The overall frequency of mice producing neutralizing antibodies was low; however, to our knowledge, this study represents the first demonstration that a KWC/GRB vaccine can elicit detectable HIV-1 neutralizing antibodies when a recombinant scaffold-MPER immunogen is used.
Importantly, approximately one third of vaccinated animals (8 of 24 mice) exhibited neutralizing activity against at least one HIV-1 pseudovirus. Although this frequency is modest, it is notable given the well-documented difficulty of eliciting MPER-directed neutralizing antibodies in small animal models [38,79,80]. MPER is among the most challenging HIV-1 epitopes to target, due to its proximity to the viral membrane, sub-dominant immunogenicity, partial lipid dependence, and the atypical features of many MPER-directed bNAbs [81,82,83,84]. In this context, the observation that a scaffolded MPER immunogen delivered on the KWC/GRB platform can elicit detectable neutralization in a substantial minority of animals represents a meaningful step forward rather than a marginal outcome.
These results were obtained in outbred mice, which do not model the human B cell repertoire in a targeted manner. Their interpretation should therefore be considered alongside studies using knock-in mouse models that express human MPER bNAb precursors, which have provided important insights into lineage-specific activation and maturation requirements [85]. Recent work, including Ray et al., highlights the value of such models for mechanistic studies of MPER antibody development [86]. In contrast, the use of outbred mice in the present study provides an unbiased assessment of whether MPER-directed neutralizing activity can emerge without pre-configuring the immune repertoire. These approaches are complementary, addressing distinct experimental questions.
To summarize the relationships among antigen display, antibody binding, and neutralization in this dataset, we integrated flow cytometry, longitudinal ELISA, and week 15 neutralization measurements. Flow cytometry using 2F5 served as a comparative screening tool for relative MPER surface exposure and correlated with MPER-specific antibody levels at early and late immunization time points [87,88,89]. Early correlations were observed when antibody responses were uniformly low after a single prime vaccination [28,90,91,92,93]. By the end of the immunization schedule, correlations re-emerged between display and ELISA readouts, suggesting that antigen exposure remains relevant at late time points, although additional immunological processes likely contribute to the observed responses [94].
Neither antigen exposure nor the magnitude of antibody induction predicted neutralization potency. AUC(ELISA) values and flow cytometry measures were only weakly related to ID50 titers, and per vaccine analyses gave similar results. Neutralizing activity appeared only in a subset of animals, including some with intermediate binding titers, while many animals with high binding titers did not neutralize. This pattern indicates that beyond a certain level of antigen exposure and antibody production, further increases in antibody quantity do not guarantee the development of functional antibodies [95,96,97,98]. Instead, neutralization likely depends on the quality of the antibody response, and on the particular characteristics of the immunogen, which are not captured by ELISA measurements [95,99].
These findings are consistent with what is known about MPER immunobiology. MPER directed bNAbs as 2F5 recognize epitopes that lie close to the viral membrane and often require coordinated interactions with both peptide and lipids [12,22,25]. Even when a scaffolded MPER immunogen displays structural features consistent with native MPER, this alone is not sufficient to consistently elicit neutralizing activity in vivo. In the KWC/GRB system, immunogens are displayed by the AT in the context of the E. coli outer membrane, which shares some biophysical features with the mammalian cell membrane and virion envelope lipid bilayer but is not identical [100,101]. An additional consideration in this context is the presence of a dense lipopolysaccharide (LPS) layer on the bacterial outer membrane, which may influence antigen accessibility and contribute to variability in antibody recognition and neutralization outcomes across animals. Importantly, the absence of mammalian lipoproteins in the bacterial membrane may also represent a potential safety advantage of this platform, as it could reduce the likelihood of inducing lipid-reactive or autoreactive antibody responses that have been associated with some MPER-directed antibodies. In addition, AlphaFold2 models include only the protein component and do not capture potential effects of membrane embedding on antigen structure.
The design variables evaluated in this study provide guidance for future work. Vaccines containing duplicated 3AGJ domains and multiple immunomodulatory elements showed a higher frequency of neutralization events, indicating a trend toward improved neutralization with multimeric designs. While this difference did not reach statistical significance when comparing monomeric and multimeric vaccine classes, neutralization was an infrequent outcome in this study, and the sample size was limited.
These observations support the exploration of additional strategies, such as heterologous prime-boost regimens, which have shown neutralizing immune responses (and, in primate studies, prime-infection studies) [39,102]. A logical next step is to combine MPER scaffold vaccines in sequential heterologous prime-boost strategies and perhaps more importantly with more physiologically relevant trimeric MPER immunogen designs in other prime-boost regimens. The Haemophilus influenzae Hia trimeric autotransporter has a structure the closely resembles the trimeric coiled-coil trimeric stem/stalk/MPERs of viruses with class 1 viral fusion proteins [53,54], so it may be possible to create a native trimeric MPER KWC/GRB vaccine using that AT in the KWC/GRB platform. Prime-boost regimens that begin with 3AGJ scaffolds and then employ another heterologous KWC/GRB MPER boosters may yield better neutralization responses. Similar heterologous strategies in other vaccine platforms have produced stronger neutralizing responses, particularly when the booster presents the epitope in a more native membrane proximal configuration [39,40,94,99,102,103,104]. There are several additional scaffold-MPER immunogens, for example ES1, ES2, ES3, and ScafMPER.024, and it may be possible that similar vaccines employing these immunogens alone or in combination could yield better neutralization [9,11,102,105].
Additional improvements could include adjusting linker composition and length to control spacing and orientation between scaffold units and modifying the density [67] or distribution of co stimulatory molecules such as OX40L or other TNF receptor ligands, or other immunomodulators to induce better responses without excessive inflammation [106,107]. Complementary studies using germinal center histology, B cell repertoire sequencing, and competition assays with MPER bNAbs will help clarify which lineages are recruited and how closely they approach known neutralizing solutions [37,108]. Because the KWC/GRB platform is modular, these refinements can be incorporated into subsequent work.
This work has several strengths. It applies lessons learned from prior FP immunogen designs to the development of new scaffold-MPER vaccines using the KWC/GRB platform. Importantly, this study demonstrates that a KWC/GRB MPER-targeted vaccine can elicit detectable HIV-1 neutralizing antibodies, representing an initial but meaningful step toward the development of low-cost, easily manufactured, distribution-friendly, and scalable vaccines. The 3AGJ immunogen used in this study is poorly soluble and has proven difficult to express in several protein expression systems, often resulting in intracellular aggregation [11,109,110]. By leveraging autotransporter-mediated surface display, the KWC/GRB platform circumvents these limitations by tightly coupling translation and export of the immunogen directly to the bacterial surface, thereby preventing cytoplasmic accumulation and aggregation [101,111,112]. Consistent with this mechanism, 3AGJ was efficiently displayed and well recognized on the bacterial surface by MPER-directed neutralizing bNAbs, supporting the conclusion that the scaffold is presented in a close-to-native conformation. In addition to these technical advantages, presentation of MPER on a prokaryotic membrane lacking mammalian lipoproteins may also confer a favorable safety profile compared with platforms that express MPER in host-derived lipid environments, where lipid reactivity has been associated with autoreactivity for some MPER-directed antibodies. Finally, the successful expression of 3AGJ in this system highlights the utility of the inducible promoter controlling the AIDA-I autotransporter cassette in pRAIDA2, a feature that may prove broadly useful for other difficult-to-express vaccine immunogens.
This study has several limitations that should be considered when interpreting the results. First, neutralizing activity was evaluated only at a single terminal time point, reflecting the inherent constraints imposed by limited blood volumes in mouse models and restricting our ability to assess the kinetics and durability of functional antibody responses. Second, although the 3AGJ immunogen captures a stabilized MPER conformation, it represents only one of several possible MPER scaffold designs, and alternative scaffolds may present distinct structural features or engage different B cell lineages with greater neutralization potential. In addition, the present work explored a defined subset of linker architectures, multimerization formats, and immunomodulatory elements; broader and more systematic variation in these parameters may reveal additional combinations that improve functional outcomes. Finally, as a killed whole-cell genome-reduced bacterial platform, KWC/GRB introduces a complex antigenic background that is likely to contribute to biological variability and inherently limits the extent to which quantitative or mechanistic conclusions can be drawn from the current dataset. Despite these limitations, the study delineates clear directions for subsequent optimization of antigen design and vaccine performance.
In summary, our findings show that the KWC/GRB platform can display structurally relevant MPER antigens, induce strong MPER-specific antibody responses, and elicit detectable HIV-1 neutralizing activity in some animals. They also clarify that antigen display and antibody quantity, although tightly linked to one another, are not sufficient to guarantee neutralization. Optimizing the quality of the response is clearly critical, but designing new immunogens using structural biology insights, confirmed by improving structure prediction will likely enable the design and production of new, more effective immunogens. By identifying which design features improve display and binding and by highlighting that binding and neutralization do not scale together, this work provides a foundation and a set of concrete targets for future work aimed at improving functional antibody responses.
5. Conclusions
This study demonstrates that the KWC/GRB platform can display a structurally accurate MPER scaffold, induce robust MPER-specific antibody responses, and elicit detectable HIV-1 neutralization in a subset of animals. Taken together, these findings show that functional neutralizing activity can be achieved in this system when the immunogen is presented in a suitable conformation, without implying uniform responses across all animals or vaccine designs. The results further indicate that differences in antigen design contribute substantially to vaccine performance, rather than reflecting intrinsic limitations of the KWC/GRB platform.
The Scaffold-MPER vaccines developed here provide a framework for continued development of KWC/GRB-based MPER vaccines. Future designs that incorporate additional or improved MPER scaffolds, trimeric MPER immunogens, and optimized prime–boost strategies may improve functional responses. Accordingly, this work establishes a foundation for further refinement and evaluation of KWC/GRB-based HIV vaccine designs, rather than a finalized solution.
Collectively, these results demonstrate that the KWC/GRB platform can be readily adapted to new antigens, particularly those that are difficult to express, poorly soluble, or prone to aggregation, and may be especially useful for vaccine immunogens that benefit from membrane-proximal presentation, while recognizing that additional optimization will be required to enhance consistency and potency of neutralizing responses.
Acknowledgments
The authors thank the staff of the University of Virginia Flow Cytometry Core Facility (RRID:SCR_017829) for expert technical assistance and animal facility personnel for their support with immunization and sample collection. Some data for this study were generated using instrumentation supported by the UVA Comprehensive Cancer Center (P30-CA044579). The authors also acknowledge the use of ChatGPT (OpenAI, GPT-5 model) under the authors’ supervision for assistance in generating R scripts used in the statistical analyses. We thank X. J. Meng (Virginia Tech) for helpful discussions, advice, and essential involvement in our initial PEDV work using this vaccine platform. The HIV-1 gp41 monoclonal antibody 2F5 used in this study was obtained through BEI Resources, NIAID, NIH. The authors acknowledge Research Computing at The University of Virginia for providing computational resources and technical support that have contributed to the results reported within this publication. URL: https://rc.virginia.edu (accessed on 31 January 2026).
Abbreviations
The following abbreviations are used in this manuscript:
| 3AGJ | Scaffolded MPER antigen based on PDB 3AGJ |
| 3DA | DADADA N-terminal motif |
| AEAAAK | Rigid α-helical linker motif AEAAAK (EAAAK repeats) |
| AIDA | Adhesin Involved in Diffuse Adherence |
| AIDA-I | Adhesin Involved in Diffuse Adherence I autotransporter |
| AQQASSS | Semi-flexible α-helical linker motif AQQASSS |
| AT | Autotransporter |
| ATs | Autotransporters |
| AUC | Area Under the Curve |
| AUC(ELISA) | ELISA area under the curve |
| AUC(FLOW) | Flow cytometry area under the curve |
| BCR | B-cell receptor |
| BSA | Bovine serum albumin |
| BSL-2 | Biosafety level 2 |
| CFU | Colony-forming unit |
| DBTL | Design–Build–Test–Learn |
| EC50 | Half-maximal effective concentration |
| ELISA | Enzyme-Linked Immunosorbent Assay |
| Env | Envelope glycoprotein |
| FBS | Fetal bovine serum |
| FDR | False discovery rate |
| FLIC | Flagellin fragment (TLR5 agonist) |
| FP | Fusion Peptide |
| FP-like | Fusion peptide-like |
| GC | Germinal center |
| HBSS | Hank’s Balanced Salt Solution |
| HET3 | Four-way crossbred HET3 mouse stock |
| HIV | Human Immunodeficiency Virus |
| HIV-1 | Human Immunodeficiency Virus type 1 |
| HRP | Horseradish peroxidase |
| ID50 | 50% inhibitory dilution titer |
| ID80 | 80% inhibitory dilution titer |
| IgG | Immunoglobulin G |
| KWC/GRB | Killed Whole-Cell Genome-Reduced Bacteria |
| LB | Luria–Bertani broth/agar |
| ME5125 | Genome-reduced Escherichia coli strain ME5125 |
| MG1655 | Escherichia coli strain MG1655 |
| MPER | Membrane-Proximal External Region |
| NCI | National Cancer Institute |
| NIAID | National Institute of Allergy and Infectious Diseases |
| NIFA | National Institute of Food and Agriculture |
| NIH | National Institutes of Health |
| OD600 | Optical density at 600 nm |
| OX40L | OX40 ligand |
| PADRE | Pan DR Epitope (universal CD4+ T-helper epitope) |
| PBS | Phosphate-buffered saline |
| PC1 | Principal component 1 |
| PC2 | Principal component 2 |
| PCA | Principal component analysis |
| PEDV | Porcine epidemic diarrhea virus |
| RAU | Relative antibody units |
| RLU | Relative luminescence units |
| ROC | Receiver operating characteristic |
| SEM | Standard error of the mean |
| SOC | Super Optimal broth with Catabolite repression |
| SPF | Specific-pathogen-free |
| TBS | Tris-buffered saline |
| TBST | Tris-buffered saline with Tween-20 |
| TLR2 | Toll-like receptor 2 |
| TLR2/4 | Toll-like receptors 2 and 4 |
| TLR4 | Toll-like receptor 4 |
| TLR5 | Toll-like receptor 5 |
| TMB | Tetramethylbenzidine |
| TZM-bl | HIV-1 reporter cell line TZM-bl |
| USA | United States of America |
| USDA | United States Department of Agriculture |
| UVA | University of Virginia |
| V1 | Scaffold-MPER vaccine 1 |
| V2 | Scaffold-MPER vaccine 2 |
| V3 | Scaffold-MPER vaccine 3 |
| V4 | Scaffold-MPER vaccine 4 |
| V5 | Scaffold-MPER vaccine 5 |
| bnAb | Broadly neutralizing antibody |
| bnAbs | Broadly neutralizing antibodies |
| gp41 | Glycoprotein 41 |
| rSIP | Recombinant surface immunogenic protein |
Supplementary Materials
The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/v18020209/s1, Supplementary File S1, Supplementary File S2: Table S1. ELISA endpoint titers for individual animals across vaccination time points; Table S2. Integrated dataset for correlation analysis (ELISA and flow cytometry); Table S3. Summary of correlation statistics (Pearson r and Spearman ρ) between AUC(ELISA) and flow-cytometry parameters (Exposure and AUC(FLOW)) across vaccination weeks. The table reports r, ρ, p-values, R2, and 95% confidence intervals. Significant correlations (p < 0.05) are highlighted in bold. Correlation strength peaks at weeks 3 and 15 (R2 ≈ 0.30–0.37), demonstrating alignment between antigen surface exposure and humoral response magnitude; Table S4. Per-virus and per-construct correlation statistics between surface display, antibody magnitude, and neutralization; Table S5. Cross-assay correlation coefficients and FDR-adjusted significance across all time points and variables.
Author Contributions
Conceptualization, J.S.Q.-B. and S.L.Z.; methodology, J.S.Q.-B., Y.S., F.M., S.M., L.L., P.D.K., X.S., D.C.M. and S.L.Z.; software, J.S.Q.-B.; validation, J.S.Q.-B. and S.L.Z.; formal analysis, J.S.Q.-B. and S.L.Z.; investigation, J.S.Q.-B. and S.L.Z.; resources, S.L.Z.; data curation, J.S.Q.-B.; writing—original draft preparation, J.S.Q.-B.; writing—review and editing, S.L.Z.; visualization, J.S.Q.-B.; supervision, S.L.Z.; project administration, S.L.Z.; funding acquisition, S.L.Z. All authors have read and agreed to the published version of the manuscript.
Institutional Review Board Statement
The animal study protocol was conducted in accordance with the Guide for the Care and Use of Laboratory Animals and was approved by the University of Virginia Animal Care and Use Committee (protocol number 41101224; unique ID 701839, approval date 5 November 2024).
Informed Consent Statement
Not applicable.
Data Availability Statement
The original contributions presented in this study are included in the article/Supplementary Material. Further inquiries can be directed to the corresponding author.
Conflicts of Interest
The authors declare no conflicts of interest.
Funding Statement
This work was supported by the Pendleton Laboratory Fund for Pediatric Infectious Disease Research, the Manning Fund for COVID-19 Research at the University of Virginia, the Ivy Foundation, the Coulter Foundation, and by grants from the National Institute of Allergy and Infectious Diseases (NIAID), NIH [R01 AI176515] and the NIAID–Duke University contract (#75N93025C00006). Additional support was provided by the United States Department of Agriculture (USDA) National Institute of Food and Agriculture (NIFA) [2025-67015-44993]. Flow cytometry data were generated in the University of Virginia Flow Cytometry Core Facility (RRID:SCR_017829), which is partially supported by the University of Virginia Comprehensive Cancer Center through the National Cancer Institute (NCI) [P30-CA044579].
Footnotes
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
References
- 1.Plotkin S. Vaccines: Past, Present and Future. Nat. Med. 2005;11:S5–S11. doi: 10.1038/nm1209. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2.Plotkin S.A., Gilbert P.B. Nomenclature for Immune Correlates of Protection After Vaccination. Clin. Infect. Dis. 2012;54:1615–1617. doi: 10.1093/cid/cis238. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Greenwood B. The Contribution of Vaccination to Global Health: Past, Present and Future. Philos. Trans. R. Soc. B Biol. Sci. 2014;369:20130433. doi: 10.1098/rstb.2013.0433. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Pardi N., Hogan M.J., Porter F.W., Weissman D. mRNA Vaccines—A New Era in Vaccinology. Nat. Rev. Drug Discov. 2018;17:261–279. doi: 10.1038/nrd.2017.243. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Yu J., Sreenivasan C., Sheng Z., Zhai S.-L., Wollman J.W., Luo S., Huang C., Gao R., Wang Z., Kaushik R.S., et al. A Recombinant Chimeric Influenza Virus Vaccine Expressing the Consensus H3 Hemagglutinin Elicits Broad Hemagglutination Inhibition Antibodies against Divergent Swine H3N2 Influenza Viruses. Vaccine. 2023;41:6318–6326. doi: 10.1016/j.vaccine.2023.09.007. [DOI] [PubMed] [Google Scholar]
- 6.Hotez P.J., Bottazzi M.E. Whole Inactivated Virus and Protein-Based COVID-19 Vaccines. Annu. Rev. Med. 2022;73:55–64. doi: 10.1146/annurev-med-042420-113212. [DOI] [PubMed] [Google Scholar]
- 7.Broadbent A.J., Subbarao K. Influenza Virus Vaccines: Lessons from the 2009 H1N1 Pandemic. Curr. Opin. Virol. 2011;1:254–262. doi: 10.1016/j.coviro.2011.08.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Corey L., Mascola J.R., Fauci A.S., Collins F.S. A Strategic Approach to COVID-19 Vaccine R&D. Science. 2020;368:948–950. doi: 10.1126/science.abc5312. [DOI] [PubMed] [Google Scholar]
- 9.Ofek G., Guenaga F.J., Schief W.R., Skinner J., Baker D., Wyatt R., Kwong P.D. Elicitation of Structure-Specific Antibodies by Epitope Scaffolds. Proc. Natl. Acad. Sci. USA. 2010;107:17880–17887. doi: 10.1073/pnas.1004728107. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Correia B.E., Ban Y.-E.A., Holmes M.A., Xu H., Ellingson K., Kraft Z., Carrico C., Boni E., Sather D.N., Zenobia C., et al. Computational Design of Epitope-Scaffolds Allows Induction of Antibodies Specific for a Poorly Immunogenic HIV Vaccine Epitope. Structure. 2010;18:1116–1126. doi: 10.1016/j.str.2010.06.010. [DOI] [PubMed] [Google Scholar]
- 11.Zhou T., Zhu J., Yang Y., Gorman J., Ofek G., Srivatsan S., Druz A., Lees C.R., Lu G., Soto C., et al. Transplanting Supersites of HIV-1 Vulnerability. PLoS ONE. 2014;9:e99881. doi: 10.1371/journal.pone.0099881. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Rujas E., Leaman D.P., Insausti S., Ortigosa-Pascual L., Zhang L., Zwick M.B., Nieva J.L. Functional Optimization of Broadly Neutralizing HIV-1 Antibody 10E8 by Promotion of Membrane Interactions. J. Virol. 2018;92:e02249-17. doi: 10.1128/JVI.02249-17. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 13.Eslami M., Fadaee Dowlat B., Yaghmayee S., Habibian A., Keshavarzi S., Oksenych V., Naderian R. Next-Generation Vaccine Platforms: Integrating Synthetic Biology, Nanotechnology, and Systems Immunology for Improved Immunogenicity. Vaccines. 2025;13:588. doi: 10.3390/vaccines13060588. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14.Barrett A., Stanberry L. Vaccines for Biodefense and Emerging and Neglected Diseases. Academic Press; London, UK: 2009. [Google Scholar]
- 15.Buck P.O., Gomes D.A., Beck E., Kirson N., Mattera M., Carroll S., Ultsch B., Jayasundara K., Uhart M., Garrison L.P., Jr. New Vaccine Platforms—Novel Dimensions of Economic and Societal Value and Their Measurement. Vaccines. 2024;12:234. doi: 10.3390/vaccines12030234. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16.Park H., Otte A., Park K. Evolution of Drug Delivery Systems: From 1950 to 2020 and Beyond. J. Control. Release. 2022;342:53–65. doi: 10.1016/j.jconrel.2021.12.030. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Graham B.S., Sullivan N.J. Emerging Viral Diseases from a Vaccinology Perspective: Preparing for the next Pandemic. Nat. Immunol. 2018;19:20–28. doi: 10.1038/s41590-017-0007-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Burton D.R., Hangartner L. Broadly Neutralizing Antibodies to HIV and Their Role in Vaccine Design. Annu. Rev. Immunol. 2016;34:635–659. doi: 10.1146/annurev-immunol-041015-055515. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.McCoy L.E., Burton D.R. Identification and Specificity of Broadly Neutralizing Antibodies against HIV. Immunol. Rev. 2017;275:11–20. doi: 10.1111/imr.12484. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Holmgren J., Czerkinsky C. Mucosal Immunity and Vaccines. Nat. Med. 2005;11:S45–S53. doi: 10.1038/nm1213. [DOI] [PubMed] [Google Scholar]
- 21.Lycke N. Recent Progress in Mucosal Vaccine Development: Potential and Limitations. Nat. Rev. Immunol. 2012;12:592–605. doi: 10.1038/nri3251. [DOI] [PubMed] [Google Scholar]
- 22.Franquelim H.G., Chiantia S., Veiga A.S., Santos N.C., Schwille P., Castanho M.A. Anti-HIV-1 Antibodies 2F5 and 4E10 Interact Differently with Lipids to Bind Their Epitopes. Aids. 2011;25:419–428. doi: 10.1097/QAD.0b013e328342ff11. [DOI] [PubMed] [Google Scholar]
- 23.Kong R., Xu K., Zhou T., Acharya P., Lemmin T., Liu K., Ozorowski G., Soto C., Taft J.D., Bailer R.T., et al. Fusion Peptide of HIV-1 as a Site of Vulnerability to Neutralizing Antibody. Science. 2016;352:828–833. doi: 10.1126/science.aae0474. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Wu X., Yang Z.-Y., Li Y., Hogerkorp C.-M., Schief W.R., Seaman M.S., Zhou T., Schmidt S.D., Wu L., Xu L., et al. Rational Design of Envelope Identifies Broadly Neutralizing Human Monoclonal Antibodies to HIV-1. Science. 2010;329:856–861. doi: 10.1126/science.1187659. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Irimia A., Serra A.M., Sarkar A., Jacak R., Kalyuzhniy O., Sok D., Saye-Francisco K.L., Schiffner T., Tingle R., Kubitz M., et al. Lipid Interactions and Angle of Approach to the HIV-1 Viral Membrane of Broadly Neutralizing Antibody 10E8: Insights for Vaccine and Therapeutic Design. PLoS Pathog. 2017;13:e1006212. doi: 10.1371/journal.ppat.1006212. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26.Burton D.R., Poignard P., Stanfield R.L., Wilson I.A. Broadly Neutralizing Antibodies Present New Prospects to Counter Highly Antigenically Diverse Viruses. Science. 2012;337:183–186. doi: 10.1126/science.1225416. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27.Wang Q., Zhang L. Broadly Neutralizing Antibodies and Vaccine Design against HIV-1 Infection. Front. Med. 2020;14:30–42. doi: 10.1007/s11684-019-0721-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Williams W.B., Wiehe K., Saunders K.O., Haynes B.F. Strategies for Induction of HIV-1 Envelope-Reactive Broadly Neutralizing Antibodies. J. Int. AIDS Soc. 2021;24:e25831. doi: 10.1002/jia2.25831. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Brouwer P.J.M., Antanasijevic A., Berndsen Z., Yasmeen A., Fiala B., Bijl T.P.L., Bontjer I., Bale J.B., Sheffler W., Allen J.D., et al. Enhancing and Shaping the Immunogenicity of Native-like HIV-1 Envelope Trimers with a Two-Component Protein Nanoparticle. Nat. Commun. 2019;10:4272. doi: 10.1038/s41467-019-12080-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Ou L., Kong W.-P., Chuang G.-Y., Ghosh M., Gulla K., O’Dell S., Varriale J., Barefoot N., Changela A., Chao C.W., et al. Preclinical Development of a Fusion Peptide Conjugate as an HIV Vaccine Immunogen. Sci. Rep. 2020;10:3032. doi: 10.1038/s41598-020-59711-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.Huang J., Ofek G., Laub L., Louder M.K., Doria-Rose N.A., Longo N.S., Imamichi H., Bailer R.T., Chakrabarti B., Sharma S.K., et al. Broad and Potent Neutralization of HIV-1 by a Gp41-Specific Human Antibody. Nature. 2012;491:406–412. doi: 10.1038/nature11544. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.van Gils M.J., van den Kerkhof T.L.G.M., Ozorowski G., Cottrell C.A., Sok D., Pauthner M., Pallesen J., de Val N., Yasmeen A., de Taeye S.W., et al. An HIV-1 Antibody from an Elite Neutralizer Implicates the Fusion Peptide as a Site of Vulnerability. Nat. Microbiol. 2016;2:16199. doi: 10.1038/nmicrobiol.2016.199. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Domene C., Wiley B., Insausti S., Rujas E., Nieva J.L. Distinctive Membrane Accommodation Traits Underpinning the Neutralization Activity of HIV-1 Antibody against MPER. Mol. Pharm. 2025;22:2494–2508. doi: 10.1021/acs.molpharmaceut.4c01341. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 34.Pinto D., Fenwick C., Caillat C., Silacci C., Guseva S., Dehez F., Chipot C., Barbieri S., Minola A., Jarrossay D., et al. Structural Basis for Broad HIV-1 Neutralization by the MPER-Specific Human Broadly Neutralizing Antibody LN01. Cell Host Microbe. 2019;26:623–637.e8. doi: 10.1016/j.chom.2019.09.016. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 35.Barouch D.H. Challenges in the Development of an HIV-1 Vaccine. Nature. 2008;455:613–619. doi: 10.1038/nature07352. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 36.Kim J.H., Rerks-Ngarm S., Excler J.-L., Michael N.L. HIV Vaccines—Lessons Learned and the Way Forward. Curr. Opin. HIV AIDS. 2010;5:428–434. doi: 10.1097/COH.0b013e32833d17ac. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Kong R., Duan H., Sheng Z., Xu K., Acharya P., Chen X., Cheng C., Dingens A.S., Gorman J., Sastry M., et al. Antibody Lineages with Vaccine-Induced Antigen-Binding Hotspots Develop Broad HIV Neutralization. Cell. 2019;178:567–584.e19. doi: 10.1016/j.cell.2019.06.030. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38.Liu H., Su X., Si L., Lu L., Jiang S. The Development of HIV Vaccines Targeting Gp41 Membrane-Proximal External Region (MPER): Challenges and Prospects. Protein Cell. 2018;9:596–615. doi: 10.1007/s13238-018-0534-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.Wang H., Cheng C., Santo J.L.D., Shen C.-H., Bylund T., Henry A.R., Howe C.A., Hwang J., Morano N.C., Morris D.J., et al. Potent and Broad HIV-1 Neutralization in Fusion Peptide-Primed SHIV-Infected Macaques. Cell. 2024;187:7214–7231.e23. doi: 10.1016/j.cell.2024.10.003. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40.Cheng C., Xu K., Kong R., Chuang G.-Y., Corrigan A.R., Geng H., Hill K.R., Jafari A.J., O’Dell S., Ou L., et al. Consistent Elicitation of Cross-Clade HIV-Neutralizing Responses Achieved in Guinea Pigs after Fusion Peptide Priming by Repetitive Envelope Trimer Boosting. PLoS ONE. 2019;14:e0215163. doi: 10.1371/journal.pone.0215163. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Ward A.B., Wilson I.A. The HIV-1 Envelope Glycoprotein Structure: Nailing down a Moving Target. Immunol. Rev. 2017;275:21–32. doi: 10.1111/imr.12507. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 42.Azoitei M.L., Ban Y.-E.A., Julien J.-P., Bryson S., Schroeter A., Kalyuzhniy O., Porter J.R., Adachi Y., Baker D., Pai E.F., et al. Computational Design of High-Affinity Epitope Scaffolds by Backbone Grafting of a Linear Epitope. J. Mol. Biol. 2012;415:175–192. doi: 10.1016/j.jmb.2011.10.003. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Rantalainen K., Berndsen Z.T., Antanasijevic A., Schiffner T., Zhang X., Lee W.-H., Torres J.L., Zhang L., Irimia A., Copps J., et al. HIV-1 Envelope and MPER Antibody Structures in Lipid Assemblies. Cell Rep. 2020;31:107583. doi: 10.1016/j.celrep.2020.107583. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44.Zeng X., Vidlund J., Gillespie B., Cao L., Agga G.E., Lin J., Dego O.K. Evaluation of Immunogenicity of Enterobactin Conjugate Vaccine for the Control of Escherichia coli Mastitis in Dairy Cows. J. Dairy Sci. 2023;106:7147–7163. doi: 10.3168/jds.2022-23219. [DOI] [PubMed] [Google Scholar]
- 45.Bhattacharya S.K., Sur D., Ali M., Kanungo S., You Y.A., Manna B., Sah B., Niyogi S.K., Park J.K., Sarkar B., et al. 5 Year Efficacy of a Bivalent Killed Whole-Cell Oral Cholera Vaccine in Kolkata, India: A Cluster-Randomised, Double-Blind, Placebo-Controlled Trial. Lancet Infect. Dis. 2013;13:1050–1056. doi: 10.1016/S1473-3099(13)70273-1. [DOI] [PubMed] [Google Scholar]
- 46.Ferreras E., Chizema-Kawesha E., Blake A., Chewe O., Mwaba J., Zulu G., Poncin M., Rakesh A., Page A.-L., Stoitsova S., et al. Single-Dose Cholera Vaccine in Response to an Outbreak in Zambia. N. Engl. J. Med. 2018;378:577–579. doi: 10.1056/NEJMc1711583. [DOI] [PubMed] [Google Scholar]
- 47.Jose J. Autodisplay: Efficient Bacterial Surface Display of Recombinant Proteins. Appl. Microbiol. Biotechnol. 2006;69:607–614. doi: 10.1007/s00253-005-0227-z. [DOI] [PubMed] [Google Scholar]
- 48.Henderson I.R., Navarro-Garcia F., Nataro J.P. The Great Escape: Structure and Function of the Autotransporter Proteins. Trends Microbiol. 1998;6:370–378. doi: 10.1016/S0966-842X(98)01318-3. [DOI] [PubMed] [Google Scholar]
- 49.Henderson I.R., Navarro-Garcia F., Desvaux M., Fernandez R.C., Ala’Aldeen D. Type V Protein Secretion Pathway: The Autotransporter Story. Microbiol. Mol. Biol. Rev. 2004;68:692–744. doi: 10.1128/MMBR.68.4.692-744.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50.Leyton D.L., Rossiter A.E., Henderson I.R. From Self Sufficiency to Dependence: Mechanisms and Factors Important for Autotransporter Biogenesis. Nat. Rev. Microbiol. 2012;10:213–225. doi: 10.1038/nrmicro2733. [DOI] [PubMed] [Google Scholar]
- 51.Benz I., Schmidt M.A. AIDA-I, the Adhesin Involved in Diffuse Adherence of the Diarrhoeagenic Escherichia coli Strain 2787 (O126:H27), Is Synthesized via a Precursor Molecule. Mol. Microbiol. 1992;6:1539–1546. doi: 10.1111/j.1365-2958.1992.tb00875.x. [DOI] [PubMed] [Google Scholar]
- 52.Cotter S.E., Surana N.K., Grass S., St Geme J.W., III Trimeric Autotransporters Require Trimerization of the Passenger Domain for Stability and Adhesive Activity. J. Bacteriol. 2006;188:5400–5407. doi: 10.1128/JB.00164-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53.Meng G., Surana N.K., St Geme J.W., III, Waksman G. Structure of the Outer Membrane Translocator Domain of the Haemophilus Influenzae Hia Trimeric Autotransporter. EMBO J. 2006;25:2297–2304. doi: 10.1038/sj.emboj.7601132. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54.Surana N.K., Cutter D., Barenkamp S.J., St Geme J.W., III The Haemophilus Influenzae Hia Autotransporter Contains an Unusually Short Trimeric Translocator Domain. J. Biol. Chem. 2004;279:14679–14685. doi: 10.1074/jbc.m311496200. [DOI] [PubMed] [Google Scholar]
- 55.Maeda D.L.N.F., Tian D., Yu H., Dar N., Rajasekaran V., Meng S., Mahsoub H.M., Sooryanarain H., Wang B., Heffron C.L., et al. Killed Whole-Genome Reduced-Bacteria Surface-Expressed Coronavirus Fusion Peptide Vaccines Protect against Disease in a Porcine Model. Proc. Natl. Acad. Sci. USA. 2021;118:e2025622118. doi: 10.1073/pnas.2025622118. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 56.Quintero-Barbosa J.S., Song Y., Mehl F., Mathur S., Livingston L., Shen X., Montefiori D.C., Tan J., Zeichner S.L. Engineering Enhanced Immunogenicity of Surface-Displayed Immunogens in a Killed Whole-Cell Genome-Reduced Bacterial Vaccine Platform Using Class I Viral Fusion Peptides. Vaccines. 2025;14:14. doi: 10.3390/vaccines14010014. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 57.Alexander J., del Guercio M.-F., Maewal A., Qiao L., Fikes J., Chesnut R.W., Paulson J., Bundle D.R., DeFrees S., Sette A. Linear PADRE T Helper Epitope and Carbohydrate B Cell Epitope Conjugates Induce Specific High Titer IgG Antibody Responses1. J. Immunol. 2000;164:1625–1633. doi: 10.4049/jimmunol.164.3.1625. [DOI] [PubMed] [Google Scholar]
- 58.Del Guercio M.-F., Alexander J., Kubo R.T., Arrhenius T., Maewal A., Appella E., Hoffman S.L., Jones T., Valmori D., Sakaguchi K. Potent Immunogenic Short Linear Peptide Constructs Composed of B Cell Epitopes and Pan DR T Helper Epitopes (PADRE) for Antibody Responses in Vivo. Vaccine. 1997;15:441–448. doi: 10.1016/S0264-410X(97)00186-2. [DOI] [PubMed] [Google Scholar]
- 59.Lu Y., Swartz J.R. Functional Properties of Flagellin as a Stimulator of Innate Immunity. Sci. Rep. 2016;6:18379. doi: 10.1038/srep18379. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 60.Sharma P., Levy O., Dowling D.J. The TLR5 Agonist Flagellin Shapes Phenotypical and Functional Activation of Lung Mucosal Antigen Presenting Cells in Neonatal Mice. Front. Immunol. 2020;11:171. doi: 10.3389/fimmu.2020.00171. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 61.Rady H.F., Dai G., Huang W., Shellito J.E., Ramsay A.J. Flagellin Encoded in Gene-Based Vector Vaccines Is a Route-Dependent Immune Adjuvant. PLoS ONE. 2016;11:e0148701. doi: 10.1371/journal.pone.0148701. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 62.Murthy K.G., Deb A., Goonesekera S., Szabó C., Salzman A.L. Identification of Conserved Domains in Salmonella Muenchen Flagellin That Are Essential for Its Ability to Activate TLR5 and to Induce an Inflammatory Response in Vitro. J. Biol. Chem. 2004;279:5667–5675. doi: 10.1074/jbc.M307759200. [DOI] [PubMed] [Google Scholar]
- 63.Diaz-Dinamarca D.A., Manzo R.A., Soto D.A., Avendaño-Valenzuela M.J., Bastias D.N., Soto P.I., Escobar D.F., Vasquez-Saez V., Carrión F., Pizarro-Ortega M.S., et al. Surface Immunogenic Protein of Streptococcus Group B Is an Agonist of Toll-Like Receptors 2 and 4 and a Potential Immune Adjuvant. Vaccines. 2020;8:29. doi: 10.3390/vaccines8010029. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 64.Asokan M., Rudicell R.S., Louder M., McKee K., O’Dell S., Stewart-Jones G., Wang K., Xu L., Chen X., Choe M., et al. Bispecific Antibodies Targeting Different Epitopes on the HIV-1 Envelope Exhibit Broad and Potent Neutralization. J. Virol. 2015;89:12501–12512. doi: 10.1128/JVI.02097-15. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 65.Taylor D.N., Treanor J.J., Sheldon E.A., Johnson C., Umlauf S., Song L., Kavita U., Liu G., Tussey L., Ozer K., et al. Development of VAX128, a Recombinant Hemagglutinin (HA) Influenza-Flagellin Fusion Vaccine with Improved Safety and Immune Response. Vaccine. 2012;30:5761–5769. doi: 10.1016/j.vaccine.2012.06.086. [DOI] [PubMed] [Google Scholar]
- 66.Croft M. Control of Immunity by the TNFR-Related Molecule OX40 (CD134) Annu. Rev. Immunol. 2010;28:57–78. doi: 10.1146/annurev-immunol-030409-101243. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 67.Amet N., Lee H.-F., Shen W.-C. Insertion of the Designed Helical Linker Led to Increased Expression of Tf-Based Fusion Proteins. Pharm. Res. 2009;26:523–528. doi: 10.1007/s11095-008-9767-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 68.Jeong W.H., Lee H., Song D.H., Eom J.-H., Kim S.C., Lee H.-S., Lee H., Lee J.-O. Connecting Two Proteins Using a Fusion Alpha Helix Stabilized by a Chemical Cross Linker. Nat. Commun. 2016;7:11031. doi: 10.1038/ncomms11031. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 69.Chen X., Zaro J., Shen W.-C. Fusion Protein Linkers: Property, Design and Functionality. Adv. Drug Deliv. Rev. 2013;65:1357–1369. doi: 10.1016/j.addr.2012.09.039. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 70.Jumper J., Evans R., Pritzel A., Green T., Figurnov M., Ronneberger O., Tunyasuvunakool K., Bates R., Žídek A., Potapenko A., et al. Highly Accurate Protein Structure Prediction with AlphaFold. Nature. 2021;596:583–589. doi: 10.1038/s41586-021-03819-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 71.Goddard T.D., Huang C.C., Meng E.C., Pettersen E.F., Couch G.S., Morris J.H., Ferrin T.E. UCSF ChimeraX: Meeting Modern Challenges in Visualization and Analysis. Protein Sci. 2018;27:14–25. doi: 10.1002/pro.3235. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 72.Meng E.C., Goddard T.D., Pettersen E.F., Couch G.S., Pearson Z.J., Morris J.H., Ferrin T.E. UCSF ChimeraX: Tools for Structure Building and Analysis. Protein Sci. 2023;32:e4792. doi: 10.1002/pro.4792. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 73.Pettersen E.F., Goddard T.D., Huang C.C., Meng E.C., Couch G.S., Croll T.I., Morris J.H., Ferrin T.E. UCSF ChimeraX: Structure Visualization for Researchers, Educators, and Developers. Protein Sci. 2021;30:70–82. doi: 10.1002/pro.3943. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 74.Hashimoto M., Ichimura T., Mizoguchi H., Tanaka K., Fujimitsu K., Keyamura K., Ote T., Yamakawa T., Yamazaki Y., Mori H., et al. Cell Size and Nucleoid Organization of Engineered Escherichia coli Cells with a Reduced Genome. Mol. Microbiol. 2005;55:137–149. doi: 10.1111/j.1365-2958.2004.04386.x. [DOI] [PubMed] [Google Scholar]
- 75.Kato J., Hashimoto M. Construction of Consecutive Deletions of the Escherichia coli Chromosome. Mol. Syst. Biol. 2007;3:132. doi: 10.1038/msb4100174. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 76.Seaman M.S., Janes H., Hawkins N., Grandpre L.E., Devoy C., Giri A., Coffey R.T., Harris L., Wood B., Daniels M.G., et al. Tiered Categorization of a Diverse Panel of HIV-1 Env Pseudoviruses for Assessment of Neutralizing Antibodies. J. Virol. 2010;84:1439–1452. doi: 10.1128/JVI.02108-09. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 77.Montefiori D.C. Measuring HIV Neutralization in a Luciferase Reporter Gene Assay. In: Prasad V.R., Kalpana G.V., editors. HIV Protocols. Humana Press; Totowa, NJ, USA: 2009. pp. 395–405. [DOI] [PubMed] [Google Scholar]
- 78.Li M., Gao F., Mascola J.R., Stamatatos L., Polonis V.R., Koutsoukos M., Voss G., Goepfert P., Gilbert P., Greene K.M., et al. Human Immunodeficiency Virus Type 1 Env Clones from Acute and Early Subtype B Infections for Standardized Assessments of Vaccine-Elicited Neutralizing Antibodies. J. Virol. 2005;79:10108–10125. doi: 10.1128/JVI.79.16.10108-10125.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 79.Kamdem Toukam D., Tenbusch M., Stang A., Temchura V., Storcksdieck Genannt Bonsmann M., Grewe B., Koch S., Meyerhans A., Nchinda G., Kaptue L., et al. Targeting Antibody Responses to the Membrane Proximal External Region of the Envelope Glycoprotein of Human Immunodeficiency Virus. PLoS ONE. 2012;7:e38068. doi: 10.1371/journal.pone.0038068. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 80.Shao S., Huang W.-C., Lin C., Hicar M.D., LaBranche C.C., Montefiori D.C., Lovell J.F. An Engineered Biomimetic MPER Peptide Vaccine Induces Weakly HIV Neutralizing Antibodies in Mice. Ann. Biomed. Eng. 2020;48:1991–2001. doi: 10.1007/s10439-019-02398-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 81.Buzon V., Natrajan G., Schibli D., Campelo F., Kozlov M.M., Weissenhorn W. Crystal Structure of HIV-1 Gp41 Including Both Fusion Peptide and Membrane Proximal External Regions. PLoS Pathog. 2010;6:e1000880. doi: 10.1371/journal.ppat.1000880. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 82.Pancera M., Zhou T., Druz A., Georgiev I.S., Soto C., Gorman J., Huang J., Acharya P., Chuang G.-Y., Ofek G., et al. Structure and Immune Recognition of Trimeric Pre-Fusion HIV-1 Env. Nature. 2014;514:455–461. doi: 10.1038/nature13808. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 83.Reardon P.N., Sage H., Dennison S.M., Martin J.W., Donald B.R., Alam S.M., Haynes B.F., Spicer L.D. Structure of an HIV-1–Neutralizing Antibody Target, the Lipid-Bound Gp41 Envelope Membrane Proximal Region Trimer. Proc. Natl. Acad. Sci. USA. 2014;111:1391–1396. doi: 10.1073/pnas.1309842111. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 84.Krebs S.J., Kwon Y.D., Schramm C.A., Law W.H., Donofrio G., Zhou K.H., Gift S., Dussupt V., Georgiev I.S., Schätzle S., et al. Longitudinal Analysis Reveals Early Development of Three MPER-Directed Neutralizing Antibody Lineages from an HIV-1-Infected Individual. Immunity. 2019;50:677–691.e13. doi: 10.1016/j.immuni.2019.02.008. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 85.Schiffner T., Phung I., Ray R., Irimia A., Tian M., Swanson O., Lee J.H., Lee C.-C.D., Marina-Zárate E., Cho S.Y., et al. Vaccination Induces Broadly Neutralizing Antibody Precursors to HIV Gp41. Nat. Immunol. 2024;25:1073–1082. doi: 10.1038/s41590-024-01833-w. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 86.Ray R., Schiffner T., Wang X., Yan Y., Rantalainen K., Lee C.-C.D., Parikh S., Reyes R.A., Dale G.A., Lin Y.-C., et al. Affinity Gaps among B Cells in Germinal Centers Drive the Selection of MPER Precursors. Nat. Immunol. 2024;25:1083–1096. doi: 10.1038/s41590-024-01844-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 87.Bachmann M.F., Jennings G.T. Vaccine Delivery: A Matter of Size, Geometry, Kinetics and Molecular Patterns. Nat. Rev. Immunol. 2010;10:787–796. doi: 10.1038/nri2868. [DOI] [PubMed] [Google Scholar]
- 88.Ols S., Lenart K., Arcoverde Cerveira R., Miranda M.C., Brunette N., Kochmann J., Corcoran M., Skotheim R., Philomin A., Cagigi A., et al. Multivalent Antigen Display on Nanoparticle Immunogens Increases B Cell Clonotype Diversity and Neutralization Breadth to Pneumoviruses. Immunity. 2023;56:2425–2441.e14. doi: 10.1016/j.immuni.2023.08.011. [DOI] [PubMed] [Google Scholar]
- 89.Irvine D.J., Read B.J. Shaping Humoral Immunity to Vaccines through Antigen-Displaying Nanoparticles. Curr. Opin. Immunol. 2020;65:1–6. doi: 10.1016/j.coi.2020.01.007. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 90.Victora G.D., Nussenzweig M.C. Germinal Centers. Annu. Rev. Immunol. 2012;30:429–457. doi: 10.1146/annurev-immunol-020711-075032. [DOI] [PubMed] [Google Scholar]
- 91.Mesin L., Ersching J., Victora G.D. Germinal Center B Cell Dynamics. Immunity. 2016;45:471–482. doi: 10.1016/j.immuni.2016.09.001. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 92.Kelly H.G., Tan H.-X., Juno J.A., Esterbauer R., Ju Y., Jiang W., Wimmer V.C., Duckworth B.C., Groom J.R., Caruso F., et al. Self-Assembling Influenza Nanoparticle Vaccines Drive Extended Germinal Center Activity and Memory B Cell Maturation. JCI Insight. 2020;5:e136653. doi: 10.1172/jci.insight.136653. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 93.Ursin R.L., Dhakal S., Liu H., Jayaraman S., Park H.-S., Powell H.R., Sherer M.L., Littlefield K.E., Fink A.L., Ma Z., et al. Greater Breadth of Vaccine-Induced Immunity in Females than Males Is Mediated by Increased Antibody Diversity in Germinal Center B Cells. mBio. 2022;13:e01839-22. doi: 10.1128/mbio.01839-22. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 94.de Taeye S.W., Ozorowski G., Torrents de la Peña A., Guttman M., Julien J.-P., van den Kerkhof T.L.G.M., Burger J.A., Pritchard L.K., Pugach P., Yasmeen A., et al. Immunogenicity of Stabilized HIV-1 Envelope Trimers with Reduced Exposure of Non-Neutralizing Epitopes. Cell. 2015;163:1702–1715. doi: 10.1016/j.cell.2015.11.056. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 95.Sok D., Burton D.R. Recent Progress in Broadly Neutralizing Antibodies to HIV. Nat. Immunol. 2018;19:1179–1188. doi: 10.1038/s41590-018-0235-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 96.Eisen H.N., Siskind G.W. Variations in Affinities of Antibodies during the Immune Response*. Biochemistry. 1964;3:996–1008. doi: 10.1021/bi00895a027. [DOI] [PubMed] [Google Scholar]
- 97.Krammer F., Palese P. Advances in the Development of Influenza Virus Vaccines. Nat. Rev. Drug Discov. 2015;14:167–182. doi: 10.1038/nrd4529. [DOI] [PubMed] [Google Scholar]
- 98.Setliff I., Shiakolas A.R., Pilewski K.A., Murji A.A., Mapengo R.E., Janowska K., Richardson S., Oosthuysen C., Raju N., Ronsard L., et al. High-Throughput Mapping of B Cell Receptor Sequences to Antigen Specificity. Cell. 2019;179:1636–1646.e15. doi: 10.1016/j.cell.2019.11.003. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 99.Conti S., Kaczorowski K.J., Song G., Porter K., Andrabi R., Burton D.R., Chakraborty A.K., Karplus M. Design of Immunogens to Elicit Broadly Neutralizing Antibodies against HIV Targeting the CD4 Binding Site. Proc. Natl. Acad. Sci. USA. 2021;118:e2018338118. doi: 10.1073/pnas.2018338118. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 100.Rojas E.R., Billings G., Odermatt P.D., Auer G.K., Zhu L., Miguel A., Chang F., Weibel D.B., Theriot J.A., Huang K.C. The Outer Membrane Is an Essential Load-Bearing Element in Gram-Negative Bacteria. Nature. 2018;559:617–621. doi: 10.1038/s41586-018-0344-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 101.Nicolay T., Vanderleyden J., Spaepen S. Autotransporter-Based Cell Surface Display in Gram-Negative Bacteria. Crit. Rev. Microbiol. 2015;41:109–123. doi: 10.3109/1040841X.2013.804032. [DOI] [PubMed] [Google Scholar]
- 102.Guenaga J., Dosenovic P., Ofek G., Baker D., Schief W.R., Kwong P.D., Karlsson Hedestam G.B., Wyatt R.T. Heterologous Epitope-Scaffold Prime: Boosting Immuno-Focuses B Cell Responses to the HIV-1 Gp41 2F5 Neutralization Determinant. PLoS ONE. 2011;6:e16074. doi: 10.1371/journal.pone.0016074. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 103.Pugach P., Ozorowski G., Cupo A., Ringe R., Yasmeen A., De Val N., Derking R., Kim H.J., Korzun J., Golabek M., et al. A Native-Like SOSIP.664 Trimer Based on an HIV-1 Subtype B env gene. J. Virol. 2015;89:3380–3395. doi: 10.1128/JVI.03473-14. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 104.Gray E.S., Madiga M.C., Moore P.L., Mlisana K., Karim S.S., Binley J.M., Shaw G.M., Mascola J.R., Morris L. Broad HIV-1 Neutralization Mediated by Plasma Antibodies against the Gp41 Membrane Proximal External Region. J. Virol. 2009;83:11265–11274. doi: 10.1128/JVI.01359-09. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 105.Xu K., Acharya P., Kong R., Cheng C., Chuang G.-Y., Liu K., Louder M.K., O’Dell S., Rawi R., Sastry M., et al. Epitope-Based Vaccine Design Yields Fusion Peptide-Directed Antibodies That Neutralize Diverse Strains of HIV-1. Nat. Med. 2018;24:857–867. doi: 10.1038/s41591-018-0042-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 106.Croft M. The Role of TNF Superfamily Members in T-Cell Function and Diseases. Nat. Rev. Immunol. 2009;9:271–285. doi: 10.1038/nri2526. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 107.Watts T.H. TNF/TNFR family members in costimulation of T cell responses. Annu. Rev. Immunol. 2005;23:23–68. doi: 10.1146/annurev.immunol.23.021704.115839. [DOI] [PubMed] [Google Scholar]
- 108.Shen C.H., DeKosky B.J., Guo Y., Xu K., Gu Y., Kilam D., Ko S.H., Kong R., Liu K., Louder M.K., et al. VRC34-Antibody Lineage Development Reveals How a Required Rare Mutation Shapes the Maturation of a Broad HIV-Neutralizing Lineage. Cell Host Microbe. 2020;27:531–543.e6. doi: 10.1016/j.chom.2020.01.027. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 109.Gao G., Wieczorek L., Peachman K.K., Polonis V.R., Alving C.R., Rao M., Rao V.B. Designing a Soluble near Full-Length HIV-1 Gp41 Trimer. J. Biol. Chem. 2013;288:234–246. doi: 10.1074/jbc.M112.424432. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 110.Krebs S.J., McBurney S.P., Kovarik D.N., Waddell C.D., Jaworski J.P., Sutton W.F., Gomes M.M., Trovato M., Waagmeester G., Barnett S.J., et al. Multimeric Scaffolds Displaying the HIV-1 Envelope MPER Induce MPER-Specific Antibodies and Cross-Neutralizing Antibodies When Co-Immunized with Gp160 DNA. PLoS ONE. 2014;9:e113463. doi: 10.1371/journal.pone.0113463. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 111.Meuskens I., Saragliadis A., Leo J.C., Linke D. Type V Secretion Systems: An Overview of Passenger Domain Functions. Front. Microbiol. 2019;10:1163. doi: 10.3389/fmicb.2019.01163. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 112.van Ulsen P., Zinner K.M., Jong W.S.P., Luirink J. On Display: Autotransporter Secretion and Application. FEMS Microbiol. Lett. 2018;365:fny165. doi: 10.1093/femsle/fny165. [DOI] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Supplementary Materials
Data Availability Statement
The original contributions presented in this study are included in the article/Supplementary Material. Further inquiries can be directed to the corresponding author.









