Skip to main content
Frontiers in Microbiology logoLink to Frontiers in Microbiology
. 2026 Jul 30;17:1881881. doi: 10.3389/fmicb.2026.1881881

A sapropel-derived Lactiplantibacillus plantarum with antimicrobial activity improves intestinal architecture and remodels gut microbiota

Chongkai Zhai 1,2,3,4,†, Junhui Niu 5,†, Qinghua Qiao 1,†, Hewei Zhang 2,3,4, Fuchao Mao 2,3,4, Chengshui Liao 5,*, Zhongyu Liu 1,*
PMCID: PMC13469455  PMID: 42597825

Abstract

Identifying safe probiotic strains with potent antimicrobial activity is essential for the development of next-generation microbial therapeutics. Here we report a novel sapropel-derived strain, Lactiplantibacillus plantarum (L. plantarum) JH-N1, exhibiting antibacterial activity together with favorable probiotic traits. In vitro safety evaluation showed no mucin degradation, β-haemolytic activity or cytotoxic effects on Caco-2 cells. L. plantarum JH-N1 displayed marked tolerance to simulated gastrointestinal stress, surviving exposure to pH 2 and bile salts, and showed strong cell-surface hydrophobicity, auto-aggregation and co-aggregation with multiple pathogens. The strain also adhered efficiently to Caco-2 cells and remained susceptible to most clinically relevant antibiotics. In vivo, acute and subacute toxicity studies in mice revealed no adverse effects on body weight, organ indices, tissue histology, hematological parameters or serum biochemical markers. Notably, L. plantarum JH-N1 improved intestinal morphology by promoting villus development and increasing crypt depth in multiple gut segments. Moreover, administration of L. plantarum JH-N1 reshaped the gut microbiota, increasing beneficial bacterial populations while reducing potentially harmful taxa. Together, these findings identify L. plantarum JH-N1 as a safe and functionally robust probiotic candidate with promise for animal husbandry and biomedical applications.

Keywords: antimicrobial activity, biosafety, Lactiplantibacillus plantarum, probiotic, sapropel

1. Introduction

Antibiotics have transformed modern medicine since the introduction of penicillin in the early twentieth century. However, their overuse use has accelerated antimicrobial resistance, increased adverse drug reactions and promoted the emergence of multidrug-resistant “superbugs” (Lobanovska and Pilla, 2017; Keith and Pamer, 2019; Shi et al., 2021). In livestock production, bacterial pathogens such as Escherichia coli, Salmonella enterica serovar Typhimurium, Listeria monocytogenes and Staphylococcus aureus continue to cause major economic losses and threaten animal health (Chlebicz and Śliżewska, 2018). Moreover, the extensive use of antibiotics in animal husbandry contributes to the environmental dissemination of antibiotic-resistance genes, posing an increasing risk to global public health (Abate and Birhanu, 2025). These challenges have intensified the search for sustainable alternatives to conventional antibiotics.

Lactic acid bacteria (LAB) have emerged as promising candidates because of their long history of safe use, antimicrobial activity and functional roles in food and feed fermentation (Chen et al., 2025). Increasing evidence indicates that LAB can serve as viable alternatives to antibiotics for controlling animal infections and improving productivity (Reuben et al., 2019). The Food and Agriculture Organization of the United Nations and the World Health Organization have also recognized the health-promoting potential of appropriately selected probiotic strains (Fontana et al., 2013; Jeong et al., 2016). Specific strains of LAB exert a broad spectrum of advantageous biological properties, including anti-allergic activity, antifungal effects, immunomodulation, anti-viral infection and protection against tissue injury (Peng and Hsu, 2005; Rönnqvist et al., 2007; Barone et al., 2016; Amoranto and Balolong, 2020; Moon et al., 2022; Farahmandi et al., 2023). In addition, several studies have suggested anticancer properties of LAB in vitro and in animal models (Garbacz, 2022).

The broad functional potential of LAB has accelerated their application in food, agriculture and pharmaceutical sectors. Regulatory authorities, including the European Food Safety Authority and the United States Food and Drug Administration, have recognized multiple LAB species as safe for use in food systems (Arena et al., 2018). Furthermore, current evidence suggests that the responsible incorporation of LAB into agricultural production systems is unlikely to substantially increase the environmental resistome (Rozman et al., 2022). Nevertheless, each newly isolated LAB strain requires rigorous evaluation of probiotic functionality, genomic safety and toxicological risk before practical application (Pradhan et al., 2019).

Therefore, the objective of the present study was to isolate and characterize a novel LAB strain with potent antibacterial activity and favorable safety properties, thereby providing a scientific basis for its future development in animal husbandry and health-related applications.

2. Materials and methods

2.1. Isolation, screening, and identification of candidate probiotics

2.1.1. Screening and identification of LAB with antibacterial activity against pathogenic bacteria

Five grams of each soil sample were suspended in 95 mL of sterile phosphate-buffered saline (PBS) and incubated under anaerobic conditions at 37 °C for 48 h. The cultures were then serially diluted and plated onto de Man, Rogosa and Sharpe (MRS) agar supplemented with 1% (w/v) bromocresol purple. Plates were incubated anaerobically at 37 °C for 48 h. Colonies surrounded by yellow halos were selected as presumptive LAB isolates. Following primary screening, candidate isolates were cultured in MRS broth under anaerobic conditions at 37 °C for 48 h. Cultures were centrifuged at 7,426 × g at 4 °C for 5 min, and the supernatants were passed through a 0.22-μm membrane filter to obtain cell-free supernatants (CFS). To evaluate antibacterial activity, S. aureus, L. monocytogenes, E. coli, and S. typhimurium were used as indicator strains (Supplementary Table S1).

2.1.2. Acid neutralization and hydrogen peroxide removal

Acid neutralization experiment was performed to exclude inhibition caused solely by acidity. Briefly, the pH of CFS was adjusted to neutrality (pH 7), and the antibacterial activity was subsequently detected using the Oxford cup diffusion assay. The pH value of the corresponding organic acid control (a mixture of lactic acid and acetic acid) is adjusted to be identical to the pH of CFS. Catalase (10 mg/mL) was prepared in phosphate buffer (pH 7.0) and added to the CFS at a ratio of 1:100 (v/v). The mixture was incubated at 37 °C for 1 h to eliminate the effect of hydrogen peroxide. Untreated CFS served as the control.

2.1.3. Identification of the candidate strain

The candidate isolates were subjected to Gram staining. Morphological characteristics were examined using a light microscope (Soptop, Shanghai, China) and a scanning electron microscope (Servicebio, Wuhan, China). Genomic DNA was extracted using a bacterial DNA extraction kit. PCR amplification was performed using universal primers 27F (5′-AGAGTTTGATCMTGGCTCAG-3′) and 1492R (5′-GGTTACCTTGTTACGACTT-3′) targeting the 16S rRNA gene. PCR conditions were as follows: 94 °C for 4 min; 34 cycles of 94 °C for 30 s, 55 °C for 30 s, and 72 °C for 1 min; followed by 72 °C for 10 min. PCR products were analyzed by agarose gel electrophoresis and sequenced commercially. Sequence identity was determined using the BLAST algorithm in the National Center for Biotechnology Information (NCBI) database. A phylogenetic tree was constructed using MEGA11 with the neighbor-joining method.

2.1.4. Determination and assembly of the genome sequence

The purified strain was cultured to the logarithmic phase and subsequently submitted to Bioengineering Co., Ltd. (Shanghai, China) for genome analysis (Kandasamy et al., 2024). FastQC v0.11.2 was used to assess the quality of the raw sequencing reads. SPAdes was employed for de novo assembly of the second-generation sequencing data, and GapFiller was used to close gaps in the assembled genome. The NCBI Prokaryotic Genome Annotation Pipeline (PGAP) was used to predict coding sequences and other genomic features. MinCED v0.4.2 was used to predict clustered regularly interspaced short palindromic repeat (CRISPR) sequences. Genome mapping was performed using CGView v1.0 software.

2.1.5. Molecular confirmation of L. plantarum

The assembled genome sequence was compared against the NCBI Nucleotide Sequence and Non-Redundant Protein Sequence databases using BLAST to evaluate sequence similarity and infer putative functional attributes. In addition, the 16S rRNA gene sequence predicted from the genome assembly was aligned against the NCBI database using BLAST. The top 30 homologous 16S rRNA sequences were retrieved and aligned using MAFFT. Phylogenetic trees were subsequently constructed using FastTree, IQ-TREE, and RAxML. This analysis was used to confirm the taxonomic identity and phylogenetic position of the target strain.

2.1.6. Mining of antimicrobial-related genes of L. plantarum

Secondary metabolite biosynthetic gene clusters were identified using antiSMASH v5.0. Based on the whole-genome sequencing results, antimicrobial-related genes were further mined using antiSMASH v5.0 and BAGEL4. Transmembrane helices were predicted using TMHMM1, and signal peptides were predicted using SignalP2. Protein tertiary structures were modeled using SWISS-MODEL3.

2.2. In vitro probiotic properties assessment

2.2.1. Hemolytic activity

Hemolytic activity was determined as previously described (Mulaw et al., 2019). Bacterial cultures were streaked in triplicate on Columbia blood agar medium (BKMAM Biotechnology Co., Ltd., Hunan, China). S. aureus served as a positive control and was incubated at 37 °C for 48 h. Subsequently, the plates were examined for the presence of β-haemolysis (clear zones surrounding colonies), α-haemolysis (greenish zones surrounding colonies), or γ-haemolysis (absence of haemolytic zones surrounding colonies).

2.2.2. Mucin degradation

Mucin degradation was assessed as previously described (Fernández et al., 2005). The fundamental composition of the medium consisted of tryptone (Aoboxing Bio-tech Co., Ltd., Beijing, China) 15.0 g, yeast extract (Thermo Fisher Scientific, Shanghai, China) 5.0 g, Tween 80 (Bailun Biotechnology Co., Ltd., Tianjin, China) 1 mL, KH2PO4 (Chengdu Kelong Chemical Reagent Factory, Sichuan, China) 2.0 g, CH3COONa (Chengdu Kelong Chemical Reagent Factory, Sichuan, China) 5.0 g, C6H5Na3O7 (Xilong Chemical Co., Ltd., Guangdong, China) 2.0 g, MgSO4 (Fengchuan Chemical Reagent Technology Co., Ltd., Tianjin, China) 0.2 g, and MnSO4 (Fengchuan Chemical Reagent Technology Co., Ltd., Tianjin, China) 0.05 g. Porcine gastric mucin (Shanghai Genye Biotechnology Co., Ltd., Shanghai, China) and a minimal anaerobic culture medium were utilized. The activated monocultures of probiotic strains were inoculated (10 μL) onto the basic culture medium, both with and without 1% (w/v) glucose, and containing 0.3% (w/v) mucin derived from the porcine stomach. These cultures were then subjected to anaerobic incubation at 37 °C for 48 h. After incubation, the cultures were stained with 0.1% amido black in 3.5 mol/L acetic acid for 30 min. Subsequently, amido black was washed with 1.2 mol/L acetic acid until a mucin lysis zone (a discolored halo) became visible around the colony.

2.2.3. Cytotoxic activity of candidate strain and CFS toward Caco-2 cells

The cytotoxicity was assessed in accordance with the guidelines provided by the Cell Counting Kit 8 (CCK-8, Beyotime Biotechnology, Shanghai, China). Caco-2 cells were cultured in a complete medium and seeded at a density of 5 × 105 cells per well in a 96-well plate. The cells were then incubated at 37 °C in 5% CO2 for 24 h to allow for attachment. L. plantarum was cultivated for 12 h, and plate counting was performed. The strain was added to Caco-2 cells at multiplicities of infection (MOI) of 10, 20, 50, and 100. CFS was prepared at concentrations of 5, 10, 20, and 50% (v/v) and added to Caco-2 cells, which were incubated at 37 °C and 5% CO2 for 24 h. Subsequently, 100 μL of Dulbecco’s Modified Eagle’s Medium (DMEM) and 10 μL of CCK-8 were added to each well, and the mixture was incubated at 37 °C for 2 h. The absorbance at OD450 nm was measured using a Spectrophotometer (Dequan Xingye Trading Co., Ltd., Henan, China). Cell viability (%) was calculated using the formula provided below:

Cell viability(%)=[(Aa−Ab)/(Ac−Ab)]×100%

The experimental group is represented as Aa, which refers to the cell viability of candidate strains or CFS added to Caco-2 cells. The control group is represented as Ac, consisting of Caco-2 cells at 100% viability. The blank group, denoted as Ab, received only DMEM.

2.2.4. Tolerance of acid and bile salts

The acid and bile salt tolerance of LAB was assessed using the previously described method (Śliżewska et al., 2021). The pH of the MRS broth was adjusted to 2, 3, and 4. LAB was resuspended in the acidic solutions described above at a concentration of 108 CFU/mL, and the untreated MRS suspension served as a control. Aliquots were taken at intervals of 0, 1, 2, 3, and 4 h, serially diluted, and plated onto MRS agar. The plates were incubated anaerobically at 37 °C for 48 h, and viable counts were obtained. MRS broth supplemented with 0.3, 0.5, and 1% bile salt (Sigma Aldrich, Missouri, United States) was prepared, with a preparation without bile salt serving as the control. The LAB was resuspended in the solution mentioned above at a concentration of 108 CFU/mL. Aliquots were taken at 0, 1, 2, 3, and 4 h, serially diluted, and plated onto MRS agar. The plate count method was employed to determine the number of LAB colonies on MRS agar. The survival rate was calculated using the following equation:

Survival rate(%)=[Ax/A0]×100%

The number of bacteria after treatment with acid or bile salts is expressed in CFU/mL and denoted as Ax, while the number of untreated bacteria, also expressed in CFU/mL, is denoted as A0.

2.2.5. Cell surface hydrophobicity

The cell surface hydrophobicity was determined as previously described (Niederle et al., 2019), with some improvements. The candidate strains were centrifuged at 7426 g for 5 min. Subsequently, the suspension of LAB cells was collected and washed twice with PBS to achieve a concentration of 108 CFU/mL. A mixture comprising 1 mL of xylene and 3 mL of the cell suspension was prepared, vigorously mixed, and vortexed for 2 min. The resulting mixture was then incubated at room temperature for 2 h, forming a two-phase system with the organic phase separating from the aqueous phase. The organic phase was removed. The absorbance of the aqueous phase was measured at a wavelength of 600 nm, with PBS serving as the control. The degree of bacterial cell surface hydrophobicity was categorized as low (0 ~ 29%), medium (30 ~ 59%), or high (60 ~ 100%).

The cell surface hydrophobicity (%) was calculated using the formula:

Cell surface hydrophobicity(%)=[(A0−A1)/A0]×100%

Here, A0 is the initial OD600 of LAB and A1 is OD600 of the water phase after the incubation.

2.2.6. Aggregation and co-aggregation assay with pathogens

The aggregation assay was conducted following a previously described methodology (Malfa et al., 2023). The suspension of LAB was obtained by centrifugation at 7,246 g for 5 min, followed by washing and re-suspension in PBS to achieve a concentration of 108 CFU/mL. The LAB cell suspension was subjected to vortex shaking for 20 s and then incubated at 37 °C. Subsequently, the absorbance of the upper suspension (100 μL) was measured at 600 nm using a spectrophotometer at 0, 2, 4, 6, 10, and 24 h. The rate of auto-aggregation was determined using the following calculation:

Auto−aggregation(%)=[(A0−At)/A0]×100%

Here, A0 is the absorbance at time 0 h, while At is the absorbance at 2, 4, 6, 10, or 24 h.

For the co-aggregation assay based on a previously described method (Śliżewska et al., 2021), the cell suspensions were prepared the same way as for the auto-aggregation test. Equal volumes of monocultures of LAB and pathogenic bacterial suspensions (S. aureus, L. monocytogenes, E. coli, and S. typhimurium) were mixed by vortexing for 20 s. After 24 h of incubation at ambient temperature, the absorbance of the upper suspension was measured at 600 nm. The percentage of co-aggregation was calculated according to a previously established method (Malfa et al., 2023).

Co−aggregation(%)=[1−2×−Amix/(ALAB+APath)]×100%

Here, ALAB and APath represent the initial OD600 of LAB and pathogenic bacteria, respectively, while Amix denotes the OD600 of the mixture after incubation.

2.2.7. Adhesion assay to Caco-2 cells

The Caco-2 cells were cultured (5 × 105 cells/mL) in 12-well microplates (Biofil, Guangzhou, China) in 5% CO2 at 37 °C. The candidate strain was harvested during the mid-logarithmic phase and added to the cells at an MOI of 100 at 37 °C for 2 h. Each experiment was performed in triplicate. After incubation, the unbound microorganisms were aspirated, and the plate was washed twice with sterile PBS. Then, cells containing adherent bacteria were lysed with 1 mL of 0.1% (w/v) Triton-100 (Solarbio, Beijing, China). After 15 min of incubation, the solution containing the released bacteria was collected, serially diluted, and plated on MRS agar. The adhesion rate was calculated according to the formula:

Adhesion ability(%)=[Ax/At]×100%

Here, Ax is the initial bacteria count, and At is the bacterial adhesion count.

After removing non-adherent microorganisms, the wells were rinsed with PBS, and the Caco-2 cells were fixed with 4% (v/v) paraformaldehyde for 15 min. After air-drying, the cells were stained using Gram staining. The adhesion was observed by microscopy. This procedure was adapted from a previously described methodology (Wang et al., 2022).

2.2.8. Susceptibility test

The antibiotic sensitivity of LAB was assessed using the disk diffusion method as recommended by the National Committee for Clinical Laboratory Standards. Commonly used veterinary antibiotics were employed to determine antibiotic susceptibility. LAB in the logarithmic phase, with approximately 108 CFU/mL, was utilized for the experiment. The LAB suspensions were seeded onto MRS agar plates using a glass rod. Antibiotic-impregnated disks were placed on the seeded plates and incubated at 37 °C for 24 h. The assay was conducted in triplicate, and the size of the inhibition zone was measured to determine the antibiotic susceptibility.

2.3. In vivo probiotic properties assessment

2.3.1. Acute toxicity test

To evaluate the acute toxicity of L. plantarum, mice were acclimated and divided into a control group and experimental groups, with 10 mice in each group. The control group was administered oral saline, while the three experimental groups were gavaged with L. plantarum at doses of 1 × 109, 1 × 1010, and 1 × 1011 CFU, respectively. All animal procedures were reviewed and approved by the Laboratory Animal Welfare and Ethical Committee of the Henan University of Science and Technology (approval no. HAUST-026-M0429080). Experimental protocols were performed in compliance with the institutional guidelines for the care and use of laboratory animals established by the Henan University of Science and Technology. Daily observations were carried out for 7 days to monitor clinical toxicity symptoms and mortality. Blood samples were collected after 7 days and cultured anaerobically in 1% MRS medium. If bacterial growth occurred, colonies were identified by PCR. The acute oral toxicity test experiment was performed in accordance with the established protocol (Deng et al., 2023).

2.3.2. Subchronic toxicity test

After a period of acclimation, the control group received equal amounts of saline via gavage. The experimental group received L. plantarum via gavage at doses of 1 × 107, 1 × 109, and 1 × 1011 CFU once daily. Throughout the 28-day gavage period, the mice were observed daily for clinical signs. Additionally, their weights were recorded weekly (Samtiya et al., 2020). On day 28, the mice were weighed, and blood samples were collected to assess routine blood and biochemical indexes. Subsequently, the mice were euthanized, and an anatomical examination was performed to determine the organ indices of the heart, liver, spleen, lungs, and kidneys. Simultaneously, a pathological histological examination was conducted on the heart, liver, spleen, lungs, kidneys, and intestines. Homogenates of aseptically collected organ tissues were cultured anaerobically in 1% MRS medium. Bacterial growth, if any, was identified by PCR.

2.3.3. Intestinal flora

Based on the study of Wiredu Ocansey et al. (2023) on the intestinal flora of mice, fecal samples were collected after the 28-day subchronic toxicity test and immediately transported on dry ice to Oebiotch (Shanghai, China). High-throughput sequencing was carried out using the Illumina Hiseq 2500 (PE250) system. The original image data files were transformed into original paired-end sequences through base calling analysis. Quality control on the original sequences was performed using Utilizing Trimmatic (v 0.35), FLASH (v 1.2.11), Split_ Libraries (v 1.8.0), and UCHIME (v 2.4.2) to obtain high-quality sequences. Using DADA2 from QIIME2, the sequences were denoised, chimeras were removed, and then deduplicated. Each deduplicated sequence was referred to as an Amplicon Sequence Variant (ASV). Diversity analyses, including the Chao1 index, Coverage index, Simpson index, and Shannon index, as well as microbial composition analysis, were performed. Additionally, the different species of gut microbiota in four groups of mice were compared.

2.4. Statistical analysis

The experimental data were presented as the mean ± standard deviation. The comparison of the mean values was performed by one-way analysis of variance (ANOVA) and Tukey’s test using the IBM SPSS Statistics 25 software (SPSS Inc., Chicago, United States). p < 0.05 was considered statistically significant. The data were further processed, and figures were generated using GraphPad Prism 8.0.1 (GraphPad Inc., San Diego, California, United States) and Biorender software (Biorender Inc., Toronto, Canada).

3. Results

3.1. Isolation, screening, and identification of LAB with antibacterial activity

3.1.1. Isolation of antibacterial LAB

A total of 135 LAB isolates obtained from 179 soil samples were screened (Supplementary Figure S1). Among these isolates, 40 strains exhibited antibacterial activity against pathogenic bacteria, whereas 15 strains displayed broad-spectrum antibacterial activity (Supplementary Table S2). Among them, strain JH-N1 showed particularly strong inhibitory activity and was therefore selected for further study.

3.1.2. Acid neutralization and hydrogen peroxide removal

The CFS of strain JH-N1 showed significantly greater inhibitory activity against pathogenic bacteria than the corresponding organic acid control. A comparable antibacterial efficacy was observed between acid-neutralized CFS and untreated CFS. After treatment of the CFS with catalase for 1 h, no significant reduction in antibacterial activity was observed compared with the untreated CFS (Figure 1). These results indicate that extracellular metabolites other than organic acids or hydrogen peroxide contributed to the antibacterial activity of strain JH-N1.

Figure 1.

Bar chart comparing bacteriostasis circle diameter in millimeters for four bacteria—S. aureus, L. monocytogenes, E. coli, and S. Typhimurium—across four treatments: control, catalase, acid, neutralized. Control, catalase, and neutralized groups show larger inhibition zones than acid for all bacteria, with statistically significant differences indicated by triple asterisks. Error bars are present.

Effects of acid neutralization and hydrogen peroxide removal on the antibacterial activity of the LAB strain with strong inhibitory potential. Control, untreated CFS of JH-N1; neutralized: acid-neutralized CFS of JH-N1; Catalase, CFS of JH-N1 treated with catalase; Acid, organic acid solution containing lactic acid and acetic acid. ***p < 0.001.

3.1.3. Identification of antibacterial strain

The JH-N1 strain was cultured on MRS agar supplemented with 1% bromocresol purple. Single colonies surrounded by yellow halos, indicating acid production, were selected. These colonies were of uniform size and displayed similar morphology (Figure 2a). Gram staining was performed on strain JH-N1, and the samples were examined under a microscope at 1,000× magnification. The observed rod-shaped cells exhibited a blue-purple color, confirming that the isolate was Gram-positive (Figure 2b). Scanning electron microscopy was used to further examine cellular morphology, and the results were consistent with those obtained by Gram staining (Figures 2c,d). Genomic DNA from strain JH-N1 was extracted and subjected to PCR amplification, yielding a specific amplicon of approximately 1,479 bp (Supplementary Figure S2). Furthermore, analysis of the 16S rRNA gene sequence revealed 99.93% identity to L. plantarum WSJ-11 (Supplementary Figure S3). Based on these findings, strain JH-N1 was identified as L. plantarum.

Figure 2.

Panel a: Circular petri dish with red agar and visible streaked bacterial colonies in yellowish lines. Panel b: Microscopic view showing scattered rod-shaped bacteria stained purple on a white background. Panel c: Scanning electron microscope image with numerous oval rod-shaped bacteria spread on a gray surface, scale five micrometers. Panel d: Close-up scanning electron microscope image shows a single, textured rod-shaped bacterium on a gray background, scale one micrometer.

Morphological identification of L. plantarum JH-N1. (a) Colony morphology of strain JH-N1 cultured on MRS agar supplemented with 1% bromocresol purple. (b) Gram-stained micrograph of L. plantarum JH-N1 (1,000× magnification). (c,d) Scanning electron micrographs of L. plantarum JH-N1.

3.1.4. Genomic information of L. plantarum JH-N1

The genome of L. plantarum JH-N1 was subjected to Illumina sequencing, followed by quality assessment and data filtering. High-quality second-generation sequencing reads were assembled using SPAdes. The whole genome sequence of L. plantarum JH-N1 has been deposited in the NCBI GenBank database under the accession number SUB16153499. Genome survey analysis was performed using sequencing-based K-mer analysis of low-depth short-insert libraries, enabling rapid estimation of the genomic characteristics of the strain. CGView was used to generate the circular genome map (Figure 3). The results showed that the chromosome size of L. plantarum JH-N1 was 3,204,278 bp, with a GC content of 44.5%. The predicted numbers of CRISPR loci, genomic islands, and prophages were 3, 0, and 0, respectively. In addition, the genome contained 7 rRNA genes, 64 tRNA genes, and 1 ncRNA gene (Table 1).

Figure 3.

Circular genomic map illustration showing annotation of a chromosome 3.2 megabase pairs in length, with concentric rings indicating coding sequences, tRNA, rRNA, non-coding RNA, GC content, GC skew positive, and GC skew negative regions, with gene names labeled around the circumference.

Complete genome map of L. plantarum JH-N1. Circular chromosome features predicted from Illumina sequencing data are visualized using CGView.

Table 1.

Genomic information of L. plantarum JH-N1.

Indicator Number or content
Chromosome (bp) 3,204,278
G + C content of chromosome (%) 44.5%
Coding gene numbers 2,998
Total length of coding genes (bp) 2,696,097
Total rRNA numbers 7
Total length of rRNA (bp) 4,774
Total tRNA numbers 64
Total length of tRNA (bp) 4,982
Total ncRNA numbers 1
Total length of ncRNA (bp) 369
Total feature numbers 3,070
Total length of feature 2,706,222
CRISPRs 3
Pseudogene numbers 0
Genomic islands 0
Plasmid 0

3.1.5. Mining of bacteriocins from L. plantarum JH-N1

The secondary metabolite biosynthetic potential of L. plantarum JH-N1 was analyzed using antiSMASH, and the results are shown in Figures 4a,b. Region 2 was identified as a ribosomally synthesized and post-translationally modified peptide (RiPP) gene cluster, which may encode peptides with antibacterial activity. Further analysis of the Region 2 cluster identified two putative bacteriocin genes, designated ctg00002_00941 and ctg00002_00942 (Table 2). The predicted core peptides both belonged to class IIb bacteriocins and shared 99% sequence identity with plantaricin EF. In addition, bacteriocin-associated gene clusters were analyzed using BAGEL4, which mines and visualizes RiPPs and bacteriocin biosynthetic loci in prokaryotic genomes. As shown in Figure 4c, two putative bacteriocins were also predicted, consistent with the antiSMASH results. The predicted tertiary structures of the candidate bacteriocins from L. plantarum JH-N1 were subsequently modeled and are shown in Figures 4d,e.

Figure 4.

Panel a contains four schematic gene cluster diagrams with colored boxes representing various gene types, annotated by a legend below explaining color codes for core biosynthetic, regulatory, and immunity genes, among others; an annotation highlights “Plantaricin EF sequence identity 99%.” Panel b shows a bar graph comparing gene counts for T3PKS, RiPP, cyclic-lactone-autinducer, and terpene clusters, with T3PKS most abundant. Panel c displays a linear map of genes and predicted functions in the plantaricin gene cluster using boxes and labels. Panels d and e present ribbon diagrams of protein structural models colored by spectrum, with one structure curled and the other helical.

Mining of bacteriocins from L. plantarum JH-N1. (a) Prediction of secondary metabolite biosynthetic gene clusters in L. plantarum JH-N1 using antiSMASH. (b) Number and distribution of predicted secondary metabolite-related genes. (c) Major bacteriocin biosynthetic gene clusters identified using the BAGEL4 database. (d,e) Predicted tertiary structures of the putative bacteriocins.

Table 2.

Lactiplantibacillus plantarum JH-N1 bacteriocins prediction.

Gene ID Start End Sequence Relative molecular mass Theoretical PI
ctg00002_00941 109,969 110,139 MLQFEKLQYSRLPQKKLAKISGGFNRGGYNFGKSVRHVVDAIGSVAGIRGILKSIR 6191.30 11.11
ctg00002_00942 110,164 110,322 MKKFLVLRDRELNAISGGVFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG 5732.61 10.52

3.1.6. Mining of virulence and tolerance genes of L. plantarum JH-N1

The genome of L. plantarum JH-N1 was screened against VFDB to assess its potential pathogenicity. Only one putative virulence-associated gene, clpP, was identified (Supplementary Table S3). However, clpP is widely distributed among Gram-positive bacteria and is primarily involved in protein quality control, stress adaptation, and cellular homeostasis rather than direct virulence expression. No experimentally validated virulence determinants typically associated with pathogenic bacteria were detected, suggesting a favorable genomic safety profile for L. plantarum JH-N1. To further evaluate antimicrobial resistance potential, the genome was analyzed using CARD. Four putative resistance-associated genes were predicted, all mainly related to multidrug efflux systems (Supplementary Table S4). Such genes are commonly found in non-pathogenic lactic acid bacteria and may contribute to intrinsic resistance or environmental adaptation, although their functional significance in L. plantarum JH-N1 requires further verification. Genes associated with environmental tolerance and probiotic fitness were also identified. These included 10 universal stress protein genes, six heat tolerance-related genes, three cold tolerance-related genes, one bile salt tolerance-related gene, 13 pH resistance-related genes, and 16 antioxidant-related genes (Supplementary Table S5). The presence of these functional genes suggests that L. plantarum JH-N1 possesses strong adaptive capacity under gastrointestinal and environmental stresses. Overall, the absence of confirmed virulence determinants together with the presence of multiple tolerance-associated genes indicates that L. plantarum JH-N1 has a favorable safety profile and promising potential for probiotic application and industrial development.

3.2. In vitro evaluation of potential probiotic properties

3.2.1. Hemolytic activity

Green halos were observed around colonies of S. aureus grown on Columbia blood agar plates, indicating α-haemolytic activity. In contrast, L. plantarum JH-N1 exhibited no detectable haemolysis (Figure 5).

Figure 5.

Panel a shows a petri dish with bacterial colonies growing on a red and yellow medium, indicating hemolysis. Panel b displays a petri dish with bacterial colonies on a uniform red medium without visible hemolysis.

Haemolytic activity of L. plantarum JH-N1 on Columbia blood agar plates. (a) S. aureus (positive control). (b) L. plantarum JH-N1.

3.2.2. Mucin degradation

Zones of lysis surrounding colonies were considered indicative of mucolytic activity. A distinct halo of hydrolyzed mucin was observed around the fecal microbiota colonies. In contrast, no discolored halos were detected around L. plantarum JH-N1, indicating that this strain lacked detectable mucin-degrading activity (Figure 6).

Figure 6.

Circular blue petri dish showing three labeled points with red arrows and numbers; point 1 highlights an area consistent with the background, point 2 highlights an area around a colony consistent with the background, and point 3 indicates an area around a colony that is lighter in color.

Mucin degradation assay on agarose plates. (1) Culture medium control. (2) L. plantarum JH-N1. (3) Fecal microbiota (positive control).

3.2.3. Cytotoxic activity of candidate strain and CFS toward Caco-2 cells

Exposure of Caco-2 cells to L. plantarum JH-N1 at MOI of 10, 20, 50 and 100 did not significantly affect cell viability (Figure 7a). In addition, the effects of CFS on Caco-2 cells were evaluated at concentrations of 5, 10, 20 and 50% (v/v) for 12 h. Notably, CFS showed no cytotoxicity and significantly increased cell viability at the lower concentrations of 5 and 10% (Figure 7b). These findings further support the safety and probiotic potential of L. plantarum JH-N1, providing a basis for subsequent adhesion assays.

Figure 7.

Grouped bar graph with two panels labeled a and b, each showing cell viability as a percentage of control. Panel a displays five colored bars for ratios 0, 10:1, 20:1, 50:1, and 100:1, all near 100%. Panel b shows five colored bars for 0%, 5%, 10%, 20%, and 50%, with 5% and 10% bars marked by asterisks indicating statistical significance and slightly higher viability.

Viability of Caco-2 cells following exposure to L. plantarum JH-N1 or its CFS. (a) Cell viability after infection with L. plantarum JH-N1 at different MOI. (b) Cell viability in the presence of different concentrations of CFS. Untreated Caco-2 cells without bacterial/CFS were set as the baseline. *p < 0.05, ***p < 0.001.

3.2.4. Tolerance of acid and bile salts

The survival rates of L. plantarum JH-N1 after 4 h of incubation at pH 3.0 and pH 4.0 were 81 and 91%, respectively. Notably, the strain retained a survival rate of 54% even at pH 2.0 (Figure 8a). In addition, L. plantarum JH-N1 remained viable in the presence of 0.3, 0.5 and 1.0% (w/v) bile salts, with survival rates exceeding 60% after 4 h of incubation (86, 78, and 63%, respectively) (Figure 8b). These results indicate strong tolerance of the strain to simulated gastrointestinal stress conditions.

Figure 8.

Panel a shows a line graph comparing survival rates at pH2, pH3, and pH4 over four hours, with survival decreasing most quickly at pH2. Panel b displays survival rates for 0.3 percent, 0.5 percent, and 1 percent conditions, showing the largest decrease at 1 percent over the same time. Error bars are included in both graphs.

Survival rate of L. plantarum JH-N1 after incubation at 37 °C under different acid and bile salt conditions. (a) Survival rate at different pH values. (b) Survival rate in different bile salt concentrations.

3.2.5. Cell surface hydrophobicity

Cell surface hydrophobicity is widely regarded as an important factor associated with bacterial colonization and adhesion within the intestinal environment. L. plantarum JH-N1 exhibited a high hydrophobicity value of 94.29%, whereas S. typhimurium and E. coli showed moderate hydrophobicity values of 51.67 and 42.72%, respectively (Figure 9). These results suggest a strong adhesion potential of L. plantarum JH-N1.

Figure 9.

Bar graph comparing hydrophobicity percentage among JH-N1, S. Typhimurium, and E. coli, with JH-N1 in blue showing highest hydrophobicity near 95%, followed by S. Typhimurium in red at about 52%, and E. coli in green at about 43%.

Cell surface hydrophobicity of L. plantarum JH-N1. Hydrophobicity was determined by the xylene adhesion assay and compared with indicator strains.

3.2.6. Auto-aggregation and co-aggregation with pathogens

The auto-aggregation ability of L. plantarum JH-N1 was evaluated at 2, 4, 6, 10, and 24 h, as shown in Figure 10a. After 24 h, JH-N1 exhibited an auto-aggregation rate of 69.94%. Co-aggregation assays demonstrated that L. plantarum JH-N1 was able to aggregate with all four tested pathogens (Figure 10b). Among them, E. coli showed the highest co-aggregation rate (80.07%), whereas S. aureus exhibited the lowest value (62.20%). These findings indicate a strong capacity of L. plantarum JH-N1 to interact with and potentially inhibit pathogenic bacteria through aggregation-mediated exclusion mechanisms.

Figure 10.

Bar graph with two panels labeled a and b; panel a shows auto-aggregation percentages increasing from around 14 percent at 2 hours to above 70 percent at 24 hours, with colored bars representing each time point; panel b presents co-aggregation percentages with E. coli, S. Typhimurium, S. aureus, and L. monocytogenes, all approximately between 65 percent and 80 percent, each bacterial species represented by a different colored bar.

Auto-aggregation and co-aggregation properties of L. plantarum JH-N1. (a) Auto-aggregation (%) of L. plantarum JH-N1 measured at different time points. (b) Co-aggregation (%) of L. plantarum JH-N1 with pathogenic bacteria measured at different time points.

3.2.7. Adhesion assay to Caco-2 cells

Before the adhesion assay, L. plantarum JH-N1 and its CFS were separately incubated with Caco-2 cells for 12 h. No morphological alterations were observed during this period, indicating an absence of detectable cytotoxicity. According to the classification proposed by previous researcher (Reddy and Austin, 2017), the adhesive capacity of Lactiplantibacillus spp. is categorized as non-adhesive (NA, 0–10%), weakly adhesive (W, 10–20%), moderately adhesive (M, 20–50%), and strongly adhesive (S, >50%). L. plantarum JH-N1 exhibited strong adhesion, with an adhesion rate of 60.64% ± 4.27%. Attachment of L. plantarum JH-N1 to Caco-2 cells was further confirmed by microscopic observation (Figure 11).

Figure 11.

Microscope image showing two stained cell samples. The left panel labeled “Control” has large pink-stained cells with a uniform appearance, while the right panel labeled “JH-N1” displays scattered small dark structures, indicating increased bacterial presence.

Adhesion of L. plantarum JH-N1 to Caco-2 cells. Representative microscopic image showing attachment of strain JH-N1 to Caco-2 cells after incubation.

3.2.8. Susceptibility test

The antibiotic susceptibility profile of L. plantarum JH-N1 is presented in Supplementary Table S6. The results showed that L. plantarum JH-N1 was susceptible to most of the antibiotics tested, exhibited intermediate susceptibility to azithromycin, streptomycin, and gentamicin, and was resistant to polymyxin B, ciprofloxacin, and ofloxacin.

3.3. In vivo evaluation of its potential probiotic properties

3.3.1. Acute toxicity tests

After confirming the beneficial effects of probiotics, in vivo safety assessments are imperative to accelerate their practical application. During the acute toxicity tests, no pathological symptoms were observed. The hair appearance remained unaltered, and they maintained good health and activity levels. Significantly, no instances of animal mortality were recorded, even in the high-dose group that received 1 × 1011 CFU of L. plantarum JH-N1 in mice. Furthermore, the presence of L. plantarum JH-N1 was not detected in the bloodstream.

3.3.2. Subchronic toxicity tests

After confirming the beneficial effects of probiotics, in vivo safety assessments are imperative to facilitate their practical application. During the acute toxicity test, no pathological symptoms were observed. The coat appearance remained normal, and the animals maintained good health and activity throughout the study. Importantly, no mortality was recorded, even in the high-dose group receiving 1 × 1011 CFU of L. plantarum JH-N1. Furthermore, L. plantarum JH-N1 was not detected in the bloodstream of mice. Various clinical signs, including fur condition, eye appearance, behavioral patterns, tremors, twitches, lethargy, sleep, gait, and postural changes, were carefully monitored daily. Remarkably, no abnormalities were detected, and no mortality was recorded. In addition, the mice were weighed weekly. As shown in Figure 12, the body weight and daily weight gain of both male and female mice administered L. plantarum JH-N1 did not exhibit any significant changes. Importantly, no significant differences were observed in the organ indices or organ-to-body weight ratios of the heart, liver, spleen, lungs, and kidneys between the control and treated groups.

Figure 12.

Eight-panel scientific figure with data on body weight, organ weight, and organ to body weight ratio in male and female mice given varying doses of CFU. Panels a–d show line and bar graphs for body weight and daily gain over time; panels e–h show bar graphs of organ weights and organ-to-body-weight ratios for heart, liver, spleen, lung, and kidney. Control and three CFU dosage groups are color-coded.

Effects of L. plantarum JH-N1 on body weight, daily weight gain, organ index, and organ-to-body weight ratio. (a) Body weight gain of male mice. (b) Daily weight gain of male mice. (c) Body weight gain of female mice. (d) Daily weight gain of female mice. (e) Organ index of male mice. (f) Organ-to-body weight ratio of male mice. (g) Organ index of female mice. (h) Organ-to-body weight ratio of female mice.

Following euthanasia, the mice were subjected to cervical dislocation, and the heart, liver, spleen, lungs, and kidneys were collected and weighed. It is widely recognized that, even in the absence of gross morphological alterations between treated and control animals, differences in organ weight may occur; therefore, the organ index is an important parameter for evaluating strain safety. The organ weights obtained in the 28-day subchronic toxicity test are presented in Figure 12. Importantly, no significant differences were observed in the organ indices or organ-to-body weight ratios of the heart, liver, spleen, lungs, and kidneys between the control and treated groups. Cultures of the heart, liver, spleen, lungs, kidneys, and blood were negative for L. plantarum JH-N1. Furthermore, no significant alterations were observed in these organs, and no histopathological abnormalities were detected during the experimental period. These findings suggest that L. plantarum JH-N1 is safe for animal consumption at doses of up to 1 × 1011 CFU/animal/day. Examination of the intestinal tract revealed that the duodenum, jejunum, and ileum of both the control and treated groups exhibited well-preserved intestinal mucosal architecture, with villi arranged in an orderly and compact manner. L. plantarum JH-N1 significantly promoted villus growth in the jejunum and ileum, increased crypt depth in the duodenum and ileum, and resulted in significantly higher villus height-to-crypt depth ratios compared with the control group (Figure 13).

Figure 13.

Panel a presents histological images of duodenum, jejunum, and ileum tissue cross-sections from four groups: control, 10^7 CFU, 10^9 CFU, and 10^11 CFU, showing differences in villus morphology. Panel b displays a bar graph comparing villus height among these groups in each intestinal segment. Panel c shows a bar graph of crypt depth across the same groups and segments. Panel d presents a bar graph comparing the villus height to crypt depth ratio for each treatment group and gut segment. Significant changes between groups are indicated by asterisks.

Effects of L. plantarum JH-N1 on intestinal histomorphology in mice. (a) Representative H&E-stained intestinal sections (×100). (b) Villus height. (c) Crypt depth. (d) Villus height-to-crypt depth ratio. *p < 0.05, **p < 0.01, ***p < 0.001.

Supplementary Table S7 presents the hematological findings, including hemoglobin, white blood cell count, red blood cell count, mean corpuscular hemoglobin concentration, mean corpuscular volume, and mean corpuscular hemoglobin, with no significant differences observed between the control and probiotic-treated groups. Conversely, L. plantarum JH-N1 significantly reduced (p < 0.05) serum transaminase levels, including alanine aminotransferase and aspartate aminotransferase, compared with the control group (Figures 14a,b). However, no significant alterations were detected in total protein, total bilirubin, urea, total cholesterol, or alkaline phosphatase in animals administered probiotics compared with the control group (Figures 14c–g).

Figure 14.

Seven grouped bar graphs labeled a to g compare biochemical markers in male and female groups under four conditions: Control, one times ten to the seventh CFU, one times ten to the ninth CFU, and one times ten to the eleventh CFU. Markers measured include ALT, AST, TP, TBIL, UREA, TCHO, and ALP. Statistically significant differences are indicated with asterisks in graphs a and b. Each graph includes error bars and color legends.

Effects of L. plantarum JH-N1 on blood biochemical parameters in mice. (a) Alanine aminotransferase (ALT). (b) Aspartate aminotransferase (AST). (c) Total protein (TP). (d) Total bilirubin (TBIL). (e) Urea. (f) Total cholesterol (TCHO). (g) Alkaline phosphatase (ALP). *p < 0.05, **p < 0.01.

3.3.3. Intestinal flora sequencing results

The flower plot is mainly used to display the distribution of unique and common elements. The results were visualized in a flower plot, which facilitated comprehension of the ASV count within each sample and the number of ASVs shared among all samples. The control, 107 CFU, 109 CFU, and 1011 CFU groups exhibited 2,030, 1,913, 1,983, and 2,009 unique ASVs, respectively, with a total of 18 common ASVs among the four groups (Figure 15). The 18 shared ASVs are Muribaculaceae, Helicobacter, uncultured_bacterium, Alloprevotella, Prevotellaceae_UCG-001, Muribaculaceae, Muribaculaceae, Muribaculaceae, Bacteroides, Rikenella, Rikenellaceae_RC9_gut_group, Bacteroides, Parabacteroides, Muribaculaceae, Lactobacillus, Muribaculaceae, Lactobacillus, and Muribaculum.

Figure 15.

Venndiagram-style flower chart illustrating groupings of numbers of unique entities across four categories: Control (green), 10 to the 7 CFU (purple), 10 to the 9 CFU (orange), and 10 to the 11 CFU (blue), all overlapping at a shared “Core 18” set circled in the center.

Differences in the distribution of ASVs showed by the Flower plot. Petals represent unique ASVs in each group, and the center indicates 18 ASVs shared among the control, 107 CFU, 109 CFU, and 1011 CFU groups.

Alpha diversity analysis provides a quantitative assessment of species richness and diversity within microbial communities. The Simpson, Chao1, and Ace indices are commonly used to estimate community richness and diversity, with higher values generally indicating greater richness and ecological complexity. No significant differences in alpha diversity were observed between the experimental and control groups (Supplementary Figure S4). Furthermore, comparison among the four groups indicated no marked changes in overall bacterial diversity, although a trend toward increased richness and evenness was observed, supporting the reliability of the sequencing results.

Principal coordinate analysis (PCoA) was used to evaluate differences in microbial community structure among groups. Each point represents an individual sample, and samples from the same group are shown in the same color. Greater proximity among samples within a group, together with separation from other groups, indicates stronger clustering and intergroup dissimilarity. PCoA revealed substantial overlap among the four groups in multivariate space (Supplementary Figure S5), suggesting that there is no significant difference in species richness between the groups.

Statistical analyses were performed at multiple taxonomic levels, including phylum, family, genus, and species. Relative abundance boxplot analyses of the top differential taxa were conducted to identify dominant microbial changes within and between groups. The results showed that the relative abundance of Lactobacillus was significantly higher in mice receiving L. plantarum JH-N1 at 109 and 1011 CFU than in the control group. In addition, the relative abundance of Clostridia vadin BB60 was significantly increased in the 109 CFU group, whereas Alloprevotella was significantly enriched in the 107 CFU group compared with the control group (Figures 16a–c). Moreover, at higher doses of L. plantarum JH-N1, the relative abundance of Neisseria was reduced and was significantly lower than that in the control group (Figure 16d).

Figure 16.

Boxplot graphic with four panels labeled a, b, c, and d, each displaying relative abundance percentages for four groups: Control (green), 10^7 CFU (purple), 10^9 CFU (orange), and 10^11 CFU (blue). Significant differences between groups are indicated with asterisks and horizontal brackets. Data show varied distributions and statistical significance across groups in each panel. A legend on the right identifies color group assignments.

Differential species Boxplot. Relative abundance of representative differential taxa among groups. Enrichment of Lactobacillus (a), Clostridia vadin BB60 (b), and Alloprevotella (c) following L. plantarum JH-N1 administration. Reduced abundance of Neisseria (d) in the high-dose groups. *p < 0.05, **p < 0.01.

4. Discussion

The increasing prevalence of bacterial antibiotic resistance presents a significant challenge in the fight against infectious diseases (Chlebicz and Śliżewska, 2018; Nwobodo et al., 2022). In recent years, probiotics have emerged as a promising alternative to antibiotics for controlling infections in animals and enhancing animal production. Several studies have investigated LAB with remarkable functional attributes as potential probiotics (Vinayamohan et al., 2024). L. plantarum JH-N1 was isolated from sapropel in an agronomy experimental field and demonstrated the highest antibacterial activity. Previous research has indicated that LAB metabolites, specifically hydrogen peroxide and acid, can inhibit the growth of various microorganisms (Reid, 2012). Additionally, LAB secretes various antimicrobial substances, including organic acids, hydrogen peroxide, and bacteriocins (Özogul and Hamed, 2018). Our results indicated that after excluding acid and hydrogen peroxide, L. plantarum JH-N1 still exhibited antibacterial activity. This suggests a high possibility of bacteriocins in the extracellular secretion of L. plantarum JH-N1. This finding is similar to the study of bacteriocin-producing L. plantarum ZJ5 isolated by Song et al. (2014) and Wang et al. (2018). Moreover, the cell-free supernatant of L. plantarum JH-N1 exhibited higher antibacterial activity against pathogens than that reported in earlier studies (Jabbari et al., 2017; Cao et al., 2019; Bhushan et al., 2021). The CFS of L. plantarum JH-N1 exhibits stronger antibacterial activity against E. coli and S. typhimurium than the L. plantarum BBC32A, which was isolated by Bhushan et al. (2021). Its antibacterial activity was twice as strong as that of L. plantarum STDA10 isolated by Cao et al. The antibacterial activity of CFS from L. plantarum JH-N1 against S. typhimurium and S. aureus is twice that of L. plantarum FB003 isolated by Jabbari et al. Most importantly, antiSMASH was utilized to predict the secondary metabolites of L. plantarum JH-N1. A segment of its gene showed high similarity to the bacterial plantaricin E. Anderssen et al. have isolated and purified bacteriocin plantaricin E, demonstrating its antibacterial activity (Anderssen et al., 1998). This indicates that L. plantarum JH-N1 indeed contains antibacterial substances similar to bacteriocins. However, the present study failed to fully clarify the antibacterial properties of L. plantarum JH-1 as well as the molecular action mechanism of plantaricin EF. Further mechanistic investigations of the bacteriocins derived from this strain will be implemented in subsequent research.

Whole-genome analysis showed that JH-N1 possesses a typical L. plantarum genome architecture, with a chromosome size (~3.2 Mb) and GC content (44.5%) consistent with previously reported strains (Nikodinoska et al., 2022). The large and flexible genome of L. plantarum is thought to facilitate adaptation to diverse ecological niches, including fermented foods and animal gastrointestinal tracts (Iarusso et al., 2025). COG categorized all predicted proteins, with unknown/general function prediction dominating, followed by carbohydrate transport and metabolism (Supplementary Figure S6a). CAZy annotation targeting carbohydrate-active enzymes uncovered 73 relevant genes, dominated by glycosyltransferases then glycoside hydrolases (Supplementary Figure S6b). KEGG annotation results reveal that most enriched genes fall into metabolic pathways dominated by carbohydrate metabolism (Supplementary Figure S6c), followed by genetic information processing pathways. GO annotation results display that enriched genes primarily relate to metabolic and cellular processes in biological process, while catalytic activity ranks top among molecular function terms (Supplementary Figure S6d), followed by binding and transporter activity. Notably, JH-N1 harbored two putative class IIb bacteriocin genes with high sequence identity to plantaricin EF, suggesting a genetic basis for its strong antibacterial activity, as plantaricins are among the best-characterized antimicrobial peptides produced by L. plantarum (Heeney et al., 2019). Genome mining also detected no confirmed virulence determinants, prophages or genomic islands associated with pathogenicity. In addition, multiple genes related to acid, bile, oxidative and temperature stress tolerance were identified, consistent with the strong in vitro stress resistance of JH-N1. Together with its high hydrophobicity, auto-aggregation, co-aggregation and epithelial adhesion capacity, these traits suggest that JH-N1 is well adapted for gastrointestinal survival, transient colonization and competitive exclusion of pathogens.

Despite the generally recognized safety of LAB, evaluating the safety of this specific strain for its intended production and use is crucial. The primary criteria for assessing the strain’s safety involve examining its hemolytic and mucin-degrading activity (Palaniyandi et al., 2017). In the hemolysis experiment, L. plantarum JH-N1 did not exhibit hemolytic properties. LAB typically shows no hemolytic activity, which enhances the safety of the strain (Adimpong et al., 2012). During the mucin degradation assay, the absence of mucin degradation activity indicates that the strain does not harm the protective mucus layer in the gastrointestinal tract. This ensures the integrity of the body’s mucosal defense system, further reflecting the safety of the strain (Zhou et al., 2001). These results are consistent with the data reported in earlier studies (Abe et al., 2010; Aristimuño Ficoseco et al., 2018). To further evaluate safety, the viability of Caco-2 cells in the presence of L. plantarum JH-N1 and CFS was examined. L. plantarum JH-N1 infected cells at different MOIs with no significant change in cell viability. Similar results were observed for the non-toxic cell supernatant, which exhibited a promoting effect on cellular proliferation at concentrations of 5 and 10%. This confirms the safety of L. plantarum JH-N1 and supports subsequent adhesion tests of this strain to Caco-2 cells.

Lactiplantibacillus spp. can appreciably tolerate the adversities of the gastrointestinal tract, which is a prerequisite condition for the efficacy and viability of probiotics. The acid and bile salt tolerance to L. plantarum JH-N1 is stronger than that of other Lactiplantibacillus spp. reported in previous studies (Tang et al., 2018; Rastogi et al., 2020; Zheng et al., 2020). The survival rate of L. plantarum JH-N1 incubated at pH 2 for 4 h is 54%, while the survival rate of L. plantarum MA2 at pH 2.5, as reported by Tang et al. (2018), was completely lost. The survival rate of L. plantarum JH-N1 at a bile salt concentration of 0.3% is over 92%, which is stronger than L. mucosae SRV10, as reported by Rastogi et al. (2020). After 4 h at a 0.3% bile salt concentration, the survival rate of L. plantarum JH-N1 was 86%, while Tang et al. (2018) reported that L. plantarum MA2 had a survival rate of only 50%. Moreover, Zheng et al. (2020) reported that the survival rate of L. plantarum E680 after 3 h at a 0.3% bile salt concentration was 80%, indicating that its bile salt tolerance is lower than that of our strain. Additionally, L. plantarum JH-N1 has a survival rate of up to 63% at 1% bile salt concentration for 4 h. Subsequently, sequencing analysis was conducted on the complete genome of L. plantarum JH-N1, which revealed the presence of the bile salt resistance gene cbh and pH resistance-related genes, including clcA, ClcA, atpB, atpE, atpF, atpH, atpA, atpG, atpD, atpC, and nhaC_2. This finding is consistent with earlier reports on the analysis of probiotic resistance genes (Wang et al., 2023). This does not fully explain why L. plantarum JH-N1 shows greater tolerance to acid and bile salts than these LAB strains. Future work will focus on elucidating this mechanism.

Current evidence suggests that the cell surface hydrophobicity is related to bacterial adhesion (Salas-Tovar et al., 2021). The study by Doyle et al. also has indicated that the hydrophobicity of bacterial surfaces promotes bacteria colonization in intestinal epithelial tissue (Doyle, 2000). The cell surface hydrophobicity of L. plantarum JH-N1 was superior to that of two intestinal pathogenic bacteria. These research results are consistent with findings from earlier studies (Rastogi et al., 2020). In addition to cell surface hydrophobicity, assessing the auto-aggregation and copolymerization capabilities of LAB strains with high adhesion capacity is essential. The ability to aggregate is a crucial characteristic of probiotics, contributing to the host’s defense against pathogen colonization (Barzegar et al., 2021). The auto-aggregation ability of L. plantarum JH-N1 and co-aggregation ability against four common pathogenic bacteria were both above 60%, which is consistent with previous findings (Xu et al., 2009). In the adhesion assay, L. plantarum JH-N1 exhibited strong adhesion ability to Caco-2 cells, recording a percentage of 60.64% ± 4.27%. This result is stronger than that reported in a previous study (Jabbari et al., 2017). Jabbari et al. (2017) determined the adhesion rate of L. plantarum FB003 to Caco-2 as 35%. In light of the experimental data on hydrophobicity, auto-aggregation, co-aggregation, and adhesion, this suggests that L. plantarum JH-N1 possesses exceptional adhesion capabilities. Its complete genome was analyzed and found to contain the epsh gene (Xiao et al., 2023), an adhesion-related gene, but the exact relationship remains to be investigated. L. plantarum JH-N1 exhibited susceptibility to most antibiotics, moderate susceptibility to aminoglycosides, and resistance to polypeptides and quinolones, aligning with findings from the antibiotic sensitivity test conducted on L. plantarum ZDY 2013 (Huang et al., 2015). Moreover, our preliminary findings indicate that L. plantarum JH-N1 can effectively inhibit infection by multiple viruses in vitro, including PEDV, PDCoV, and feline infectious peritonitis virus (data not shown). Xing et al. (2022) reported that L. plantarum 0111 confers significant protection against H9N2 influenza virus infection by enhancing antiviral immunity and modulating the gut microbiota, further supporting the broad antiviral potential of L. plantarum. Similarly, Lu et al. (2024) showed that L. plantarum GUANKE protects mice against influenza infection by reducing viral load and enhancing dendritic cell-mediated antiviral immunity, further underscoring the antiviral capacity of L. plantarum. Further investigations into the underlying antiviral mechanisms and translational potential of L. plantarum JH-N1 are currently underway.

The strain demonstrated exceptional antimicrobial activity and probiotic properties during in vitro tests, along with preliminary safety assessments. However, to fully ascertain its immunogenicity, toxicity, and practical significance, in vivo safety evaluations are essential (Sahoo et al., 2017). Consequently, acute and subacute toxicity tests on mice were conducted to assess the safety of orally administered L. plantarum JH-N1. Consistent with previously published data, the acute toxicity test showed that mice exposed to various doses of the strain did not exhibit any disease symptoms or detectable levels of L. plantarum JH-N1 in blood (Zhou et al., 2000). During the subchronic toxicity study, no abnormal clinical symptoms or deaths were observed. There was no significant difference in weight and organ index among the different groups. L. plantarum JH-N1 is not detected in mouse blood and organs, further confirming the safety of this strain. Surprisingly, L. plantarum JH-N1 significantly promoted the growth of jejunal and ileal villi, deepened the depth of crypts in the duodenum and ileum, and resulted in significantly higher ratios of intestinal villus lengths to crypt depths compared to those of the control group. Hematological parameters are commonly used to assess inflammatory responses and hematologic disorders, while blood biochemistry evaluations help identify organ-related issues (Petterino and Argentino-Storino, 2006). During the subacute toxicity experiment, no significant changes in hematological parameters were observed between the experimental group and the control group. These findings are consistent with previous studies on L. plantarum MTCC 5690 and L. fermentum MTCC 5689 (Pradhan et al., 2019). Blood biochemistry experiments on mice revealed a significant decrease in serum transaminases, which can be attributed to the specific dosage effect of probiotics. This finding aligns with the results of Samtiya et al. (2020). These results further confirm that L. plantarum JH-N1 is not only safe but also has probiotic effects, which are consistent with previous safety assessments of probiotics (Kim et al., 2017; Wang et al., 2019; Zulkhairi Amin et al., 2023).

The intestinal flora, consisting of beneficial, harmful, and neutral bacteria, constitutes the most extensive micro-ecosystem within the human body (Ma et al., 2019). After administering L. plantarum JH-N1 to mice and analyzing their fecal samples through Alpha and Beta Diversity analysis, it was observed that there was no significant difference between the control and experimental groups, suggesting that L. plantarum JH-N1 has a limited impact on the diversity of the mice’s intestinal flora. The results of the species analysis of inter-group differences in mouse gut microbiota indicated that L. plantarum JH-N1 caused a significant increase in the relative abundance of beneficial bacteria (Lactobacillus, Allopreivotella, and Clostridia vadin BB60) and a significant decrease in the relative abundance of deleterious bacteria (Neisseria) in the mice gut microbiota (Song et al., 2023; Zhu et al., 2021). The 18 shared ASVs indicates that oral administration of L. plantarum JH-N1 does not disrupt the foundational intestinal microbial homeostasis in mice. The majority of these taxa fall within the carbohydrate-degrading phylum Bacteroidota, with multiple ASVs assigned to Muribaculaceae and Muribaculum dominating the core microbiota. These microbes are specialized in fermenting dietary fiber and intestinal mucin to generate propionate and acetate, which in turn sustain intestinal barrier integrity and confer resistance against pathogen colonization. Bacteroides, Parabacteroides, Rikenellaceae RC9 gut group, Alloprevotella, and Prevotellaceae UCG-001 act synergistically to stabilize carbohydrate metabolism and sustain basal immune homeostasis. Two shared Lactobacillus ASVs represent native murine autochthonous lactobacilli, forming a baseline beneficial pool alongside exogenous JH-N1. The single shared Helicobacter ASV represents a low-abundance commensal strain that exhibits no pathogenic traits in healthy mice. Collectively, this fixed core flora maintains basal gut metabolic and immune function regardless of L. plantarum JH-N1 dosage variation.

In conclusion, the L. plantarum JH-N1 isolated from crop soil in the field of agriculture possesses various antibacterial properties and demonstrates good safety as well as significant probiotic potential in vitro and in vivo. Based on the results obtained, the in vivo mechanism of action of L. plantarum JH-N1 was predicted; it can colonize the intestinal tract due to its excellent environmental tolerance, adhesion, and cell surface hydrophobicity. It also utilizes copolymerization to bind pathogenic bacteria or secrete antibacterial substance to kill pathogenic bacteria, thereby preventing their colonization in the intestine. The absence of hemolytic activity and mucin-degrading activity ensures the integrity of the intestinal barrier and promotes the growth of intestinal villi (Supplementary Figure S7).

5. Conclusion

In summary, L. plantarum JH-N1 is a novel sapropel-derived strain that exhibits antimicrobial activity, favorable genomic safety characteristics, strong gastrointestinal stress tolerance, and excellent adhesion-related probiotic traits. In vitro and in vivo evaluations confirmed its safety, with no evidence of cytotoxicity, haemolysis, or adverse effects in mice. Importantly, oral administration of JH-N1 improved intestinal morphology and beneficially modulated the gut microbiota. Collectively, these findings identify JH-N1 as a promising probiotic candidate for veterinary and biomedical applications, although further studies are needed to elucidate its molecular mechanisms and translational potential.

Acknowledgments

The authors acknowledge the constructive guidance and academic support provided by Xiangchao Cheng during the preliminary phase of this research.

Funding Statement

The author(s) declared that financial support was received for this work and/or its publication. This research was supported by Heluo Youth Talent Lift Project (2024HLTJ20), Programs for Science and Technology Development of Henan Province (262102110005), Luoyang Public Welfare Industry Research Program Project (2602026A), Luoyang Polytechnic Key Research and Development project (2026A06), International Cultivation of Henan Advanced Talents (20250126), Natural Science Foundation of Henan Province (242300421107), and International Science and Technology Cooperation Program of Henan Province (262102521073).

Edited by: Shengwei Ji, Yanbian University, China

Reviewed by: Shucheng Chen, Harvard Medical School, United States

Keerthi T. R., Mahatma Gandhi University, India

Data availability statement

The datasets presented in this study can be found in online repositories. The names of the repository/repositories and accession number(s) can be found in the article/Supplementary material.

Ethics statement

The animal study was approved by Laboratory Animal Welfare and Ethical Committee of the Henan University of Science and Technology. The study was conducted in accordance with the local legislation and institutional requirements.

Author contributions

CZ: Writing – original draft, Software, Visualization, Validation, Data curation, Supervision, Conceptualization, Writing – review & editing, Methodology. JN: Data curation, Methodology, Software, Writing – original draft. QQ: Writing – review & editing, Writing – original draft, Data curation. HZ: Project administration, Validation, Writing – review & editing. FM: Methodology, Writing – review & editing. CL: Supervision, Formal analysis, Writing – review & editing, Conceptualization, Project administration, Investigation, Funding acquisition, Validation. ZL: Investigation, Writing – review & editing, Formal analysis, Funding acquisition, Validation.

Conflict of interest

The author(s) declared that this work was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Generative AI statement

The author(s) declared that Generative AI was not used in the creation of this manuscript.

Any alternative text (alt text) provided alongside figures in this article has been generated by Frontiers with the support of artificial intelligence and reasonable efforts have been made to ensure accuracy, including review by the authors wherever possible. If you identify any issues, please contact us.

Publisher’s note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

Supplementary material

The Supplementary material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fmicb.2026.1881881/full#supplementary-material

Data_Sheet_1.DOCX (8MB, DOCX)

References

  1. Abate T. A., Birhanu A. G. (2025). Antibiotic use in livestock and environmental antibiotic resistance: a narrative review. Environ. Health Insights 19:11786302251357775. doi: 10.1177/11786302251357775, [DOI] [PMC free article] [PubMed] [Google Scholar]
  2. Abe F., Muto M., Yaeshima T., Iwatsuki K., Aihara H., Ohashi Y., et al. (2010). Safety evaluation of probiotic bifidobacteria by analysis of mucin degradation activity and translocation ability. Anaerobe 16, 131–136. doi: 10.1016/j.anaerobe.2009.07.006, [DOI] [PubMed] [Google Scholar]
  3. Adimpong D. B., Nielsen D. S., Sørensen K. I., Derkx P. M. F., Jespersen L. (2012). Genotypic characterization and safety assessment of lactic acid bacteria from indigenous African fermented food products. BMC Microbiol. 12:75. doi: 10.1186/1471-2180-12-75, [DOI] [PMC free article] [PubMed] [Google Scholar]
  4. Amoranto M. B. C., Balolong M. P. (2020). Immunomodulation in lactic acid bacteria: exploring prospects for adjunct functional food therapy. Philipp. J. Health Res. Dev. 24, 64–76. doi: 10.4103/pjhrd_2020243_64 [DOI] [Google Scholar]
  5. Anderssen E. L., Diep D. B., Nes I. F., Eijsink V. G. H., Nissen-Meyer J. (1998). Antagonistic activity of Lactobacillus plantarum C11: two new two-peptide bacteriocins, plantaricins EF and JK, and the induction factor plantaricin a. Appl. Environ. Microbiol. 64, 2269–2272. doi: 10.1128/AEM.64.6.2269-2272.1998, [DOI] [PMC free article] [PubMed] [Google Scholar]
  6. Arena M. P., Capozzi V., Russo P., Drider D., Spano G., Fiocco D. (2018). Immunobiosis and probiosis: antimicrobial activity of lactic acid bacteria with a focus on their antiviral and antifungal properties. Appl. Microbiol. Biotechnol. 102, 9949–9958. doi: 10.1007/s00253-018-9403-9, [DOI] [PubMed] [Google Scholar]
  7. Aristimuño Ficoseco C., Mansilla F. I., Maldonado N. C., Miranda H., Nader-Macias M. E. F. (2018). Safety and growth optimization of lactic acid bacteria isolated from feedlot cattle for probiotic formula design. Front. Microbiol. 9:2220. doi: 10.3389/fmicb.2018.02220 [DOI] [PMC free article] [PubMed] [Google Scholar]
  8. Barone R., Rappa F., Macaluso F., Bavisotto C. C., Sangiorgi C., Di Paola G., et al. (2016). Alcoholic liver disease: a mouse model reveals protection by Lactobacillus fermentum. Clin. Transl. Gastroenterol. 7:e138. doi: 10.1038/ctg.2015.66, [DOI] [PMC free article] [PubMed] [Google Scholar]
  9. Barzegar H., Alizadeh Behbahani B., Falah F. (2021). Safety, probiotic properties, antimicrobial activity, and technological performance of Lactobacillus strains isolated from Iranian raw milk cheeses. Food Sci. Nutr. 9, 4094–4107. doi: 10.1002/fsn3.2365, [DOI] [PMC free article] [PubMed] [Google Scholar]
  10. Bhushan B., Sakhare S. M., Narayan K. S., Kumari M., Mishra V., Dicks L. M. T. (2021). Characterization of riboflavin-producing strains of Lactobacillus plantarum as potential probiotic candidate through in vitro assessment and principal component analysis. Probiotics Antimicrob. Proteins 13, 453–467. doi: 10.1007/s12602-020-09696-x, [DOI] [PubMed] [Google Scholar]
  11. Cao Z., Pan H., Li S., Shi C., Wang S., Wang F., et al. (2019). In vitro evaluation of probiotic potential of lactic acid bacteria isolated from Yunnan De’ ang pickled tea. Probiotics Antimicrob. Proteins 11, 103–112. doi: 10.1007/s12602-018-9395-x, [DOI] [PubMed] [Google Scholar]
  12. Chen X., Bai H., Mo W., Zheng X., Chen H., Yin Y., et al. (2025). Lactic acid bacteria bacteriocins: safe and effective antimicrobial agents. Int. J. Mol. Sci. 26:4124. doi: 10.3390/ijms26094124, [DOI] [PMC free article] [PubMed] [Google Scholar]
  13. Chlebicz A., Śliżewska K. (2018). Campylobacteriosis, salmonellosis, yersiniosis, and listeriosis as zoonotic foodborne diseases: a review. Int. J. Environ. Res. Public Health 15:863. doi: 10.3390/ijerph15050863, [DOI] [PMC free article] [PubMed] [Google Scholar]
  14. Deng S., Aga E. B., Xie H., Xiong H., Ye B. (2023). Evaluation of the acute toxicity and 28-days subacute toxicity of the alcoholic extract from Ganoderma leucocontextum. Food Sci. Nutr. 11, 434–442. doi: 10.1002/fsn3.3075, [DOI] [PMC free article] [PubMed] [Google Scholar]
  15. Doyle R. J. (2000). Contribution of the hydrophobic effect to microbial infection. Microbes Infect. 2, 391–400. doi: 10.1016/S1286-4579(00)00328-2, [DOI] [PubMed] [Google Scholar]
  16. Farahmandi F., Parhizgar P., Komesh Tape P. M., Bizhannia F., Rohani F. S., Bizhanzadeh M., et al. (2023). Implications and mechanisms of antiviral effects of lactic acid bacteria: a systematic review. Int. J. Microbiol.:9298363. doi: 10.1155/2023/9298363 [DOI] [PMC free article] [PubMed] [Google Scholar]
  17. Fernández M. F., Boris S., Barbés C. (2005). Safety evaluation of Lactobacillus delbrueckii subsp. lactis UO 004, a probiotic bacterium. Res. Microbiol. 156, 154–160. doi: 10.1016/j.resmic.2004.09.006, [DOI] [PubMed] [Google Scholar]
  18. Fontana L., Bermudez-Brito M., Plaza-Diaz J., Munoz-Quezada S., Gil A. (2013). Sources, isolation, characterisation and evaluation of probiotics. Br. J. Nutr. 109, S35–S50. doi: 10.1017/S0007114512004011, [DOI] [PubMed] [Google Scholar]
  19. Garbacz K. (2022). Anticancer activity of lactic acid bacteria. Semin. Cancer Biol. 86, 356–366. doi: 10.1016/j.semcancer.2021.12.013, [DOI] [PubMed] [Google Scholar]
  20. Heeney D. D., Yarov-Yarovoy V., Marco M. L. (2019). Sensitivity to the two-peptide bacteriocin plantaricin EF is dependent on CorC, a membrane-bound magnesium/cobalt efflux protein. MicrobiologyOpen 8:e827. doi: 10.1002/mbo3.827 [DOI] [PMC free article] [PubMed] [Google Scholar]
  21. Huang R., Tao X., Wan C., Li S., Xu H., Xu F., et al. (2015). In vitro probiotic characteristics of Lactobacillus plantarum ZDY 2013 and its modulatory effect on gut microbiota of mice. J. Dairy Sci. 98, 5850–5861. doi: 10.3168/jds.2014-9153, [DOI] [PubMed] [Google Scholar]
  22. Iarusso I., Mahony J., Pannella G., Lombardi S. J., Gagliardi R., Coppola F., et al. (2025). Diversity of Lactiplantibacillus plantarum in wild fermented food niches. Foods 14:1765. doi: 10.3390/foods14101765, [DOI] [PMC free article] [PubMed] [Google Scholar]
  23. Jabbari V., Khiabani M. S., Mokarram R. R., Hassanzadeh A. M., Ahmadi E., Gharenaghadeh S., et al. (2017). Lactobacillus plantarum as a probiotic potential from kouzeh cheese (traditional Iranian cheese) and its antimicrobial activity. Probiotics Antimicrob. Proteins 9, 189–193. doi: 10.1007/s12602-017-9255-0, [DOI] [PubMed] [Google Scholar]
  24. Jeong J. H., Lee C. Y., Chung D. K. (2016). Probiotic lactic acid bacteria and skin health. Crit. Rev. Food Sci. Nutr. 56, 2331–2337. doi: 10.1080/10408398.2013.834874, [DOI] [PubMed] [Google Scholar]
  25. Kandasamy S., Lee K. H., Yoo J., Yun J., Kang H. B., Kim J. E., et al. (2024). Whole genome sequencing of Lacticaseibacillus casei KACC92338 strain with strong antioxidant activity reveals genes and gene clusters of probiotic and antimicrobial potential. Front. Microbiol. 15:1458221. doi: 10.3389/fmicb.2024.1458221, [DOI] [PMC free article] [PubMed] [Google Scholar]
  26. Keith J. W., Pamer E. G. (2019). Enlisting commensal microbes to resist antibiotic-resistant pathogens. J. Exp. Med. 216, 10–19. doi: 10.1084/jem.20180399, [DOI] [PMC free article] [PubMed] [Google Scholar]
  27. Kim J. S., Hosseindoust A., Lee S. H., Choi Y. H., Kim M. J., Lee J. H., et al. (2017). Bacteriophage cocktail and multi-strain probiotics in the feed for weanling pigs: effects on intestine morphology and targeted intestinal coliforms and Clostridium. Animal 11, 45–53. doi: 10.1017/S1751731116001166, [DOI] [PubMed] [Google Scholar]
  28. Lobanovska M., Pilla G. (2017). Penicillin’s discovery and antibiotic resistance: lessons for the future? Yale J. Biol. Med. 90, 135–145. [PMC free article] [PubMed] [Google Scholar]
  29. Lu S., He S., Yue K., Mi J., Huang Y., Song L., et al. (2024). Lactobacillus plantarum GUANKE modulates antiviral function of dendritic cells in mice. Int. Immunopharmacol. 134:112169. doi: 10.1016/j.intimp.2024.112169 [DOI] [PubMed] [Google Scholar]
  30. Ma Q., Li Y., Li P., Wang M., Wang J., Tang Z., et al. (2019). Research progress in the relationship between type 2 diabetes mellitus and intestinal flora. Biomed. Pharmacother. 117:109138. doi: 10.1016/j.biopha.2019.109138, [DOI] [PubMed] [Google Scholar]
  31. Malfa P., Brambilla L., Giardina S., Masciarelli M., Squarzanti D. F., Carlomagno F., et al. (2023). Evaluation of antimicrobial, antiadhesive and co-aggregation activity of a multi-strain probiotic composition against different urogenital pathogens. Int. J. Mol. Sci. 24:1323. doi: 10.3390/ijms24021323, [DOI] [PMC free article] [PubMed] [Google Scholar]
  32. Moon A., Sun Y., Wang Y., Huang J., Khan M. U. Z., Qiu H. J. (2022). Lactic acid bacteria as mucosal immunity enhancers and antivirals through oral delivery. Appl. Microbiol. 2, 837–854. doi: 10.3390/applmicrobiol2040064 [DOI] [Google Scholar]
  33. Mulaw G., Tessema T. S., Muleta D., Tesfaye A. (2019). In vitro evaluation of probiotic properties of lactic acid bacteria isolated from some traditionally fermented Ethiopian food products. Int. J. Microbiol.:7179514. doi: 10.1155/2019/7179514 [DOI] [PMC free article] [PubMed] [Google Scholar]
  34. Niederle M. V., Bosch J., Ale C. E., Nader-Macías M. E., Aristimuño Ficoseco C., Toledo L. F., et al. (2019). Skin-associated lactic acid bacteria from north American bullfrogs as potential control agents of Batrachochytrium dendrobatidis. PLoS One 14:e0223020. doi: 10.1371/journal.pone.0223020, [DOI] [PMC free article] [PubMed] [Google Scholar]
  35. Nikodinoska I., Makkonen J., Blande D., Moran C. (2022). Genome sequence data of Lactiplantibacillus plantarum IMI 507028. Data Brief 42:108190. doi: 10.1016/j.dib.2022.108190, [DOI] [PMC free article] [PubMed] [Google Scholar]
  36. Nwobodo D. C., Ugwu M. C., Anie C. O., Al-Ouqaili M. T. S., Ikem J. C., Chigozie U. V., et al. (2022). Antibiotic resistance: the challenges and some emerging strategies for tackling a global menace. J. Clin. Lab. Anal. 36:e24655. doi: 10.1002/jcla.24655, [DOI] [PMC free article] [PubMed] [Google Scholar]
  37. Özogul F., Hamed I. (2018). The importance of lactic acid bacteria for the prevention of bacterial growth and their biogenic amines formation: a review. Crit. Rev. Food Sci. Nutr. 58, 1660–1670. doi: 10.1080/10408398.2016.1277972, [DOI] [PubMed] [Google Scholar]
  38. Palaniyandi S. A., Damodharan K., Suh J. W., Yang S. H. (2017). In vitro characterization of Lactobacillus plantarum strains with inhibitory activity on enteropathogens for use as potential animal probiotics. Indian J. Microbiol. 57, 201–210. doi: 10.1007/s12088-017-0646-4, [DOI] [PMC free article] [PubMed] [Google Scholar]
  39. Peng G. C., Hsu C. H. (2005). The efficacy and safety of heat-killed Lactobacillus paracasei for treatment of perennial allergic rhinitis induced by house-dust mite. Pediatr. Allergy Immunol. 16, 433–438. doi: 10.1111/j.1399-3038.2005.00284.x, [DOI] [PubMed] [Google Scholar]
  40. Petterino C., Argentino-Storino A. (2006). Clinical chemistry and haematology historical data in control Sprague-Dawley rats from pre-clinical toxicity studies. Exp. Toxicol. Pathol. 57, 213–219. doi: 10.1016/j.etp.2005.10.002, [DOI] [PubMed] [Google Scholar]
  41. Pradhan D., Singh R., Tyagi A., Rashmi H. M., Batish V. K., Grover S. (2019). Assessing safety of Lactobacillus plantarum MTCC 5690 and Lactobacillus fermentum MTCC 5689 using in vitro approaches and an in vivo murine model. Regul. Toxicol. Pharmacol. 101, 1–11. doi: 10.1016/j.yrtph.2018.10.011, [DOI] [PubMed] [Google Scholar]
  42. Rastogi S., Mittal V., Singh A. (2020). In vitro evaluation of probiotic potential and safety assessment of Lactobacillus mucosae strains isolated from donkey’s lactation. Probiotics Antimicrob. Proteins 12, 1045–1056. doi: 10.1007/s12602-019-09610-0, [DOI] [PubMed] [Google Scholar]
  43. Reddy S., Austin F. (2017). Adhesion and invasion assay procedure using Caco-2 cells for Listeria monocytogenes. Bio Protoc. 7:e2267. doi: 10.21769/BioProtoc.2267 [DOI] [PMC free article] [PubMed] [Google Scholar]
  44. Reid G. (2012). Probiotic and prebiotic applications for vaginal health. J. AOAC Int. 95, 31–34. doi: 10.5740/jaoacint.SGE_Reid, [DOI] [PubMed] [Google Scholar]
  45. Reuben R. C., Roy P. C., Sarkar S. L., Alam R. U., Jahid I. K. (2019). Isolation, characterization, and assessment of lactic acid bacteria toward their selection as poultry probiotics. BMC Microbiol. 19:253. doi: 10.1186/s12866-019-1626-0, [DOI] [PMC free article] [PubMed] [Google Scholar]
  46. Rönnqvist D., Forsgren-Brusk U., Husmark U., Grahn-Håkansson E. (2007). Lactobacillus fermentum Ess-1 with unique growth inhibition of vulvo-vaginal candidiasis pathogens. J. Med. Microbiol. 56, 1500–1504. doi: 10.1099/jmm.0.47226-0, [DOI] [PubMed] [Google Scholar]
  47. Rozman V., Mohar Lorbeg P., Treven P., Accetto T., Golob M., Zdovc I., et al. (2022). Lactic acid bacteria and bifidobacteria deliberately introduced into the agro-food chain do not significantly increase the antimicrobial resistance gene pool. Gut Microbes 14:2127438. doi: 10.1080/19490976.2022.2127438, [DOI] [PMC free article] [PubMed] [Google Scholar]
  48. Sahoo T. K., Jena P. K., Prajapati B., Gehlot L., Patel A. K., Seshadri S. (2017). In vivo assessment of immunogenicity and toxicity of the bacteriocin TSU4 in BALB/c mice. Probiotics Antimicrob. Proteins 9, 345–354. doi: 10.1007/s12602-016-9249-3, [DOI] [PubMed] [Google Scholar]
  49. Salas-Tovar J. A., Escobedo-García S., Olivas G. I., Acosta-Muñiz C. H., Harte F., Sepulveda D. R. (2021). Method-induced variation in the bacterial cell surface hydrophobicity MATH test. J. Microbiol. Methods 185:106234. doi: 10.1016/j.mimet.2021.106234, [DOI] [PubMed] [Google Scholar]
  50. Samtiya M., Bhat M. I., Gupta T., Kapila S., Kapila R. (2020). Safety assessment of potential probiotic Lactobacillus fermentum MTCC-5898 in murine model after repetitive dose for 28 days (sub-acute exposure). Probiotics Antimicrob. Proteins 12, 259–270. doi: 10.1007/s12602-019-09529-6, [DOI] [PubMed] [Google Scholar]
  51. Shi S., Shen T., Liu Y., Chen L., Wang C., Liao C. (2021). Porcine myeloid antimicrobial peptides: a review of the activity and latest advances. Front. Vet. Sci. 8:664139. doi: 10.3389/fvets.2021.664139, [DOI] [PMC free article] [PubMed] [Google Scholar]
  52. Śliżewska K., Chlebicz-Wójcik A., Nowak A. (2021). Probiotic properties of new Lactobacillus strains intended to be used as feed additives for monogastric animals. Probiotics Antimicrob. Proteins 13, 146–162. doi: 10.1007/s12602-020-09674-3, [DOI] [PMC free article] [PubMed] [Google Scholar]
  53. Song W., Wang Y., Li G., Xue S., Zhang G., Dang Y., et al. (2023). Modulating the gut microbiota is involved in the effect of low-molecular-weight Glycyrrhiza polysaccharide on immune function. Gut Microbes 15:2276814. doi: 10.1080/19490976.2023.2276814, [DOI] [PMC free article] [PubMed] [Google Scholar]
  54. Song D. F., Zhu M. Y., Gu Q. (2014). Purification and characterization of plantaricin ZJ5, a new bacteriocin produced by Lactobacillus plantarum ZJ5. PLoS One 9:e105549. doi: 10.1371/journal.pone.0105549, [DOI] [PMC free article] [PubMed] [Google Scholar]
  55. Tang W., Li C., He Z., Pan F., Pan S., Wang Y. (2018). Probiotic properties and cellular antioxidant activity of Lactobacillus plantarum MA2 isolated from Tibetan kefir grains. Probiotics Antimicrob. Proteins 10, 523–533. doi: 10.1007/s12602-017-9349-8, [DOI] [PubMed] [Google Scholar]
  56. Vinayamohan P., Joseph D., Viju L. S., Baskaran S. A., Venkitanarayanan K. (2024). Efficacy of probiotics in reducing pathogenic potential of infectious agents. Fermentation 10:599. doi: 10.3390/fermentation10120599 [DOI] [Google Scholar]
  57. Wang K., Cao G., Zhang H., Li Q., Yang C. (2019). Effects of Clostridium butyricum and Enterococcus faecalis on growth performance, immune function, intestinal morphology, volatile fatty acids, and intestinal flora in a piglet model. Food Funct. 10, 7844–7854. doi: 10.1039/C9FO01650C, [DOI] [PubMed] [Google Scholar]
  58. Wang P., Chen S., Liao C., Jia Y., Li J., Shang K., et al. (2022). Probiotic properties of chicken-derived highly adherent lactic acid bacteria and inhibition of enteropathogenic bacteria in Caco-2 cells. Microorganisms 10:2515. doi: 10.3390/microorganisms10122515, [DOI] [PMC free article] [PubMed] [Google Scholar]
  59. Wang M., Hu T., Lin X., Liang H., Li W., Zhao S., et al. (2023). Probiotic characteristics of Lactobacillus gasseri TF08-1: a cholesterol-lowering bacterium, isolated from human gut. Enzym. Microb. Technol. 169:110276. doi: 10.1016/j.enzmictec.2023.110276, [DOI] [PubMed] [Google Scholar]
  60. Wang Y., Qin Y., Xie Q., Zhang Y., Hu J., Li P. (2018). Purification and characterization of plantaricin LPL-1, a novel class IIa bacteriocin produced by Lactobacillus plantarum LPL-1 isolated from fermented fish. Front. Microbiol. 9:2276. doi: 10.3389/fmicb.2018.02276, [DOI] [PMC free article] [PubMed] [Google Scholar]
  61. Wiredu Ocansey D. K., Hang S., Yuan X., Qian H., Zhou M., Olovo C. V., et al. (2023). The diagnostic and prognostic potential of gut bacteria in inflammatory bowel disease. Gut Microbes 15:2176118. doi: 10.1080/19490976.2023.2176118, [DOI] [PMC free article] [PubMed] [Google Scholar]
  62. Xiao L., Yang Y., Han S., Rui X., Ma K., Zhang C., et al. (2023). Effects of genes required for exopolysaccharides biosynthesis in Lacticaseibacillus paracasei S-NB on cell surface characteristics and probiotic properties. Int. J. Biol. Macromol. 224, 292–305. doi: 10.1016/j.ijbiomac.2022.10.124, [DOI] [PubMed] [Google Scholar]
  63. Xing J. H., Shi C. W., Sun M. J., Gu W., Zhang R. R., Chen H. L., et al. (2022). Lactiplantibacillus plantarum 0111 protects against influenza virus by modulating intestinal microbial-mediated immune responses. Front. Microbiol. 13:820484. doi: 10.3389/fmicb.2022.820484, [DOI] [PMC free article] [PubMed] [Google Scholar]
  64. Xu H., Jeong H. S., Lee H. Y., Ahn J. (2009). Assessment of cell surface properties and adhesion potential of selected probiotic strains. Lett. Appl. Microbiol. 49, 434–442. doi: 10.1111/j.1472-765X.2009.02684.x, [DOI] [PubMed] [Google Scholar]
  65. Zheng Z. Y., Cao F. W., Wang W. J., Yu J., Chen C., Chen B., et al. (2020). Probiotic characteristics of Lactobacillus plantarum E680 and its effect on hypercholesterolemic mice. BMC Microbiol. 20:239. doi: 10.1186/s12866-020-01922-4, [DOI] [PMC free article] [PubMed] [Google Scholar]
  66. Zhou J. S., Gopal P. K., Gill H. S. (2001). Potential probiotic lactic acid bacteria Lactobacillus rhamnosus (HN001), Lactobacillus acidophilus (HN017) and Bifidobacterium lactis (HN019) do not degrade gastric mucin in vitro. Int. J. Food Microbiol. 63, 81–90. doi: 10.1016/S0168-1605(00)00398-6, [DOI] [PubMed] [Google Scholar]
  67. Zhou J. S., Shu Q., Rutherfurd K. J., Prasad J., Gopal P. K., Gill H. S. (2000). Acute oral toxicity and bacterial translocation studies on potentially probiotic strains of lactic acid bacteria. Food Chem. Toxicol. 38, 153–161. doi: 10.1016/S0278-6915(99)00154-4, [DOI] [PubMed] [Google Scholar]
  68. Zhu H., Cao C., Wu Z., Zhang H., Sun Z., Wang M., et al. (2021). The probiotic L. casei Zhang slows the progression of acute and chronic kidney disease. Cell Metab. 33, 1926–1942.e8. doi: 10.1016/j.cmet.2021.06.014, [DOI] [PubMed] [Google Scholar]
  69. Zulkhairi Amin F. A., Cheng M. Z. S., Sabri S., Ismail N., Chan K. W., Esa N. M., et al. (2023). In vivo toxicity assessment of the probiotic Bacillus amyloliquefaciens HTI-19 isolated from stingless bee (Heterotrigona itama) honey. Nutrients 15:2390. doi: 10.3390/nu15102390, [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Data_Sheet_1.DOCX (8MB, DOCX)

Data Availability Statement

The datasets presented in this study can be found in online repositories. The names of the repository/repositories and accession number(s) can be found in the article/Supplementary material.


Articles from Frontiers in Microbiology are provided here courtesy of Frontiers Media SA

RESOURCES