Abstract
Atypical chemokine receptors (ACKRs) indirectly mediate cell migration through chemokine scavenging, which generally requires phosphorylation by G protein–coupled receptor kinases (GRKs) to efficiently control chemokine levels. Despite not coupling to G proteins, ACKR4 is preferentially modified by GRK3, a kinase dependent on active G protein subunits for membrane translocation and phosphorylation activity. How ACKR4 circumvents G protein dependency to engage GRK3 is unclear. To resolve the underlying mechanism, we used live-cell bioluminescence resonance energy transfer assays to measure GRK3 and phosphorylation-dependent arrestin recruitment and tracked the impact of fluorescent chemokine uptake by flow cytometry. We demonstrate that ACKR4 engages arrestin preferentially downstream of GRK2/3 phosphorylation fully independent of G protein coordination. Instead, the kinases are recruited directly to the atypical receptor via a unique acidic-rich motif in the proximal receptor C terminus. Mutations in this region severely impaired kinase and arrestin recruitment, as well as chemokine scavenging. Productive phosphorylation also plays a substantial role in G protein-independent GRK3 translocation to ACKR4, and recruitment of kinase-dead GRK3 is severely impaired. Together, these findings suggest that ACKR4 directly coordinates GRK3 coupling, highlighting a uniquely evolved atypical mechanism to use GRK2/3 while bypassing G protein activation and thereby supporting efficient chemokine scavenging by the atypical receptor.
Significance Statement
Cell migration and positioning is efficiently regulated by atypical chemokine receptors (ACKR) through chemokine scavenging, often upon GRK phosphorylation. GRK3 dominates the phosphorylation of ACKR4, despite ACKR4 not activating G proteins needed to promote the kinase activity. This study resolved that ACKR4 is directly modified by GRK3 without G protein involvement. Instead, specific acidic residues coordinate the phosphorylation reaction. While seemingly unique to ACKR4, similar mechanisms for GRK2/3 action may contribute to kinase modification of other atypical and canonical GPCRs.
Key words: Chemokine, Chemokine receptor, GPCR, GRK, Atypical Chemokine Receptor, ACKR4
Graphical abstract

1. Introduction
Chemokine receptors are class A G protein–coupled receptors (GPCRs) that regulate cell migration and contribute to immune homeostasis, inflammation, and development.1 Canonical chemokine receptors (CCKRs) activate G protein signaling pathways, which drive cell movement along localized chemokine gradients toward higher chemokine concentrations. These gradients are generated and maintained by specialized atypical chemokine receptors (ACKRs), which regulate agonist availability through chemokine scavenging.2,3 Unlike CCKRs, ACKRs do not couple G proteins, yet receptor activation still induces GPCR kinase (GRK)-mediated phosphorylation and arrestin recruitment. As a result, ACKRs are often considered β-arrestin-biased.4
ACKR4, previously C-C chemokine receptor (CCR)11,5 CCRL1,6 and CCX-CKR,7 regulates chemokine levels by scavenging the chemokines C-C chemokine (CCL)19, CCL20, CCL21, CCL22, and CCL25, thereby limiting ligand availability for CCKRs CCR4, CCR6, CCR7, and CCR9, respectively.8, 9, 10, 11 ACKR4 is primarily expressed in lymphatic and thymic endothelial cells,12,13 which are located adjacent to CCR7- and CCR9-expressing cells such as dendritic cells, T cells, and thymocytes.14, 15, 16 Chemokine scavenging by ACKR4 facilitates the migration of immune cells by crafting gradients of chemokines shared with the canonical receptors. Like other ACKRs, ACKR4 does not activate heterotrimeric G proteins, and chemokine binding leads to phosphorylation by primarily GRK3.17 Arrestins are recruited by the phosphorylated receptor that supports, but is not essential for, chemokine uptake.
Phosphorylation of GPCRs is primarily coordinated by 7 kinases (GRK1–7). While other second messenger kinases, such as protein kinase A and protein kinase C, can also phosphorylate GPCRs depending cellular or signaling context, GRKs are key contributors to GPCR-specific regulation.18 GRK1 and GRK7 are expressed solely in the retina, while GRK4 expression is restricted to the testes and brain.19 The remaining kinases, GRK2, GRK3, GRK5, and GRK6, are ubiquitously expressed but differ in their subcellular localization. GRK5 and GRK6 are constitutively membrane associated and anchored by basic residue–lipid interactions or palmitoylation, respectively.20,21 GRK2 and GRK3, in contrast, are cytosolic and are recruited to the membrane via complexing with lipidated G⍺q and Gβγ subunits liberated following heterotrimer activation.18 Modification of GPCRs by specific kinases is reported to produce distinct phosphorylation patterns.22 Therefore, the expression profile of different GRKs can result in cell type specific responses and receptor regulation.23
GPCRs are preferentially phosphorylated by different GRKs and can be generally divided into 3 main categories: GRK2/3, GRK5/6, or GRK2/3/5/6 dependent.18 Receptors that couple G proteins, such as CCKRs, are GRK2/3 dependent or GRK2/3/5/6 dependent, reflecting the importance of GRK2/3 phosphorylation when G protein activation is present. β-Arrestin-biased receptors, such as ACKRs, typically rely on GRK5/6 phosphorylation, since these proteins are unable to activate G proteins themselves and thus are unable to recruit GRK2/3.23,24 For example, ACKR3 is dominantly phosphorylated by GRK5/625,26 but can borrow Gβγ from coactivated CXC receptor (CXCR)4, which facilitates GRK2/3 phosphorylation of the atypical receptor in some cellular contexts.26 Recently GRK3 and to a lesser extent GRK2 were identified as the primary kinases recruited to ACKR4.17 Given that GRK2/3 phosphorylation is typically G protein dependent, ACKR4’s preference for GRK2/3 is unexpected.
In this study, we show that ACKR4 does not require G protein coordination for GRK2/3 coupling. Instead, an acidic-rich motif in the C terminus of ACKR4 directly facilitates GRK2/3 recruitment and activity. Recruitment of the kinases to ACKR4 is nearly eliminated when the kinase activity is lost, which is not the case for G protein dependent GPCRs. These findings suggests that the acidic C terminus directly coordinates GRK2/3 recruitment by serving as a substrate for modification, representing a novel mechanism by which ACKRs can circumvent canonical GRK dependency on G protein activation.
2. Materials and methods
2.1. Materials
All chemicals and reagents were obtained from Melford or Sigma-Aldrich, unless otherwise specified. HEK293 ΔGRK2/3, HEK293 ΔGRK2/3, HEK293 ΔQ, and corresponding parental HEK293 cell lines were kindly gifted by C. Hoffmann (Friedrich-Schiller-Universität Jena).27
2.2. DNA constructs and site-directed mutagenesis
Human ACKR4 (1–350), FLAG-ACKR3 (2–362), CXCR4 (1–352), and CCR9 (1–369) were inserted into a pcDNA3.1 expression vector, either alone or C terminally fused to Renilla luciferase (Rluc)II. β-Arrestin2-GFP10 (kindly provided by N. Heveker, Université de Montréal), GRK3-CT26 (bovine, residues 547–688, kindly provided by N. Lambert, Augusta University), Gβ1 and Gγ228 (kindly provided by A. Inoue, Tohoku University), GRK3-Nluc17 (kindly provided by D. Legler, Biotechnology Institute Thurgau), mV-CAAX29 (kindly provided by M. Bouvier, Université de Montréal), GRK3, and GRK3_K220R27 (kindly provided by C. Hoffmann, Friedrich-Schiller-Universität Jena) were described previously. FLAG-ACKR3(2-315)_CT(ACKR4)(314-350) followed by a C-terminal RlucII was ordered from Genscript. ACKR4 DE/A, ACKR4 ST/A, and GRK3-Nluc RK/A mutants were generated using the Q5 Site-Directed Mutagenesis Kit (New England Biolabs) and validated by Sanger sequencing.
2.3. Chemokine purification from Escherichia coli
Expression and purification of CCL25 and C-X-C chemokine (CXCL)12 in Escherichia coli were performed as previously described.30,31 In short, chemokine sequences were inserted into a pET21 vector N terminally fused to 8His-tag and enterokinase cleavage site. The synthesized plasmid was introduced into the BL21(DE3)pLysS cells, and expression was induced by IPTG. Chemokine-containing inclusion bodies were isolated via sonication and solubilized in a buffer consisting of 50 mM Tris, 6 M guanidine-HCl, and 300 mM NaCl at pH 8.0. Purification was done using a nickel-nitrilotriacetic acid column, washed with 50 mM Mes, 6 M guanidine-HCl, 300 mM NaCl, pH 6.0 and followed by elution with 50 mM acetate, 6 M guanidine-HCl, 300 mM NaCl (pH 4.0). The purified chemokine was reduced using 4 mM DTT and subsequently refolded in 50 mM Tris, 700 mM arginine-HCl, 1 mM EDTA, 200 mM glutamine, 0.1% Triton-X, and 1 mM GSSG at pH 7.5 by dropwise addition. After refolding, the chemokine was dialyzed in 20 mM Tris (pH 8.0) with 150 mM NaCl. The 8His-tag was cleaved of using enterokinase (New England Biolabs) and verified by SDS-PAGE and LC-MS analysis. The cleaved product was further refined on a Ni-nitrilotriacetic acid column, with washes in 50 mM Tris (pH 8.0) and elution in 6 M guanidine-HCl with 50 mM MES (pH 6.0) or 50 mM acetate (pH 4.0) as 2 separate fractions. The fractions were purified by reverse-phase high-performance liquid chromatography using a Gemini C18 110A column (Phenomex), using a linear gradient of 5%–95% acetonitrile in 0.1% trifluoroacetic acid. The purified chemokines were collected, lyophilized and stored at −80 °C.
2.4. Transfection HEK293 cells in suspension
HEK293 were maintained in Dulbecco’s modified Eagle’s medium (Thermo Fisher Scientific) with 10% FBS (Bodinco) and 1% penicillin and streptomycin (Gibco) and incubated at 37 °C in a humidified 5% CO2 environment. Transfection was performed with a total of 2 μg plasmid DNA per 1 × 106 cells using 6 μg polyethyleneimine (PEI; Polysciences) in 150 mM NaCl. DNA–PEI complexes were allowed to form by incubation for 15 minute at room temperature. In the meantime, cells were harvested with trypsin-EDTA (Thermo Fisher Scientific) and counted before addition to the DNA–PEI complexes. Cells were plated at 30,000/well in a white 96-well plate (Greiner) and incubated for 48 hours. Routine testing confirmed the absence of mycoplasma contamination.
2.5. β-Arrestin2 recruitment by bioluminescence resonance energy transfer
HEK293, including ΔGRK2/3, ΔGRK5/6, and ΔQ knockout lines, were transiently transfected with 50 ng of ACKR4-RlucII/ACKR3-RlucII/CXCR4-RlucII/CCR9-RlucII/ACKR3_CT4-RlucII and 1 μg of GFP10-β-arrestin2. As indicated, cells were cotransfected with 950 ng of GRK3-CT, 450 ng of Gβ1 and Gγ2, or 100 ng of GRK2 wild type (WT), GRK2 R587Q, GRK2 R587Q/D110A, GRK3 WT, GRK3 R587Q, or GRK3 R587Q/D110A. Total of 2 μg DNA per condition was reached by supplementing with empty pcDNA3.1 plasmid. Transfections were carried out using standard methods described previously.30 After 48 hours, cells were gently rinsed once with PBS and maintained in Hanks’ balanced salt solution supplemented with 0.1% BSA (Fraction V; PanReac AppliChem). Next, cells were incubated with 5 μM Prolume Purple (Prolume) for 5 minutes at room temperature to allow substrate diffusion and stabilization of luminescence. Three baseline readings were acquired prior to stimulation. Subsequently, cells were stimulated with increasing concentrations of CCL25 or CXCL12. Bioluminescence was quantified using a PHERAstar plate reader equipped with a dual emission filter (410–480 nm and 515–530 nm) for 40 minutes at 37 °C. Bioluminescence resonance energy transfer (BRET) ratio was calculated by the intensity at 515–530 nm, divided by the intensity at 410–480 nm. Results are from 3 independent experiments reported as area under the curve (AUC) of the kinetic ΔBRET trace normalized to WT response. The AUC was selected as a measure since the kinetic profiles (over 40 minutes) of the various chemokine receptors differed, making a comparison at a single time point potentially misleading.
2.6. Evaluation of GRK protein expression by western blot
HEK293 ΔQ cells were transiently transfected with 100 ng of GRK2 WT, GRK2 R587Q, GRK2 R587Q/D110A, GRK3 WT, GRK3 R587Q, or GRK3 R587Q/D110A. Total of 2 μg DNA per condition was reached by supplementing with empty pcDNA3.1 plasmid. Transfections were carried out using standard methods described previously. Cells were plated at 150,000/well in a transparent 24-well plate (Greiner) and incubated for 48 hours. The media was removed, and cells were washed with ice-cold PBS. Sample buffer (20 mM Tris pH 6.8, 12.5 mM EDTA, 20% glycerol, 1% SDS, 0.01% bromophenol blue, 100 mM DTT) was preheated at 90 °C. Next, cells were harvested with hot sample buffer, sonicated, boiled at 95 °C for 5 minutes, and centrifuged at 20,000g for 1 minute. Samples were run on a 10% SDS gel and then transferred to a Trans-Blot Turbo Mini-Size Nitrocellulose membrane (Bio-Rad) using the Mixed MW preset (1.3 A, 25 V, 7 minutes) on a Trans-Blot Turbo Transfer System (Bio-Rad). Membranes were blocked for at least 1 hour in 5% BSA Tris-buffered saline/Tween 20. Protein expression was detected by probing with mouse anti-GRK2 (sc-13143, 1:500; Santa Cruz), rabbit anti-GRK3 (80362, 1:1000; Cell Signaling Technology), or mouse anti-βactin (A5441, 1:1000; Sigma-Aldrich), and secondary antibodies goat antimouse IgG (H+L)-horseradish peroxidase conjugate (1706516, 1:2000; Bio-Rad) or goat anti-rabbit IgG (H+L)-horseradish peroxidase conjugate (1706515, 1:2000; Bio-Rad). Bands were detected with enhanced chemiluminescence detection reagent (RPN2106; Amersham) and intensity was quantified using ImageJ software (NIH). Intensities were adjusted to the corresponding β-actin control to correct for variations in loading and staining.
2.7. Bystander GRK3 recruitment by BRET
HEK293 cells were transiently transfected with 100 ng ACKR4/FLAG-ACKR3/CXCR4/CCR9, 50 ng of GRK3-Nluc, and 200 ng of mV-CAAX. If indicated, cells were cotransfected with 950 ng GRK3-CT. Total of 2 μg DNA per condition was reached by supplementing with empty pcDNA3.1 plasmid. Transfections were carried out using standard methods described previously. After 48 hours, cells were gently rinsed once with PBS and maintained in Hanks’ balanced salt solution supplemented with 0.1% BSA. Next, cells were incubated with 2.5 μM Furimazine (Promega) for 5 minutes at room temperature to allow substrate diffusion and stabilization of luminescence. Three baseline readings were acquired prior to stimulation. Subsequently, cells were stimulated with 100 nM of CCL25 or CXCL12. Bioluminescence was quantified using a PHERAstar plate reader equipped with a dual emission filter (475–430 and 535–530 nm) for 40 minutes at 37 °C. BRET ratio was calculated by the intensity at 535–530 nm, divided by the intensity at 475–430 nm. Results are from 3 independent experiments reported as ΔBRET trace. AUC of this kinetic trace was used for comparison between conditions.
2.8. CCL25 uptake by flow cytometry
HEK293 cells were transiently transfected with 100 ng ACKR4 to a total of 2 μg DNA per condition by supplementing with empty pcDNA3.1, following previously described procedures. After 48 hours, cells were harvested using Accutase (Thermo Fisher Scientific) and transferred to a Guava-compatible 96-well conical plate (Greiner). Between each step, cells were centrifuged at 350g for 3 minutes, and supernatant was decanted. Cells were washed twice with flow cytometry (FC) buffer (PBS supplemented with 0.5% BSA). Next, cells were incubated with 100 nM CCL25-AZ488 (Protein Foundry) for 1.5 hours at 37 °C while gently shaking. After incubation, cells were washed once with FC buffer, twice with acidic citrate buffer (50 mM citric acid, 150 mM NaCl, pH 4.5) to wash of residual surface-bound and noninternalized chemokine. Following 3 washes with FC buffer, cells were resuspended in the same buffer before analysis on a Guava easyCyte flow cytometer (Cytek). Mean green fluorescence intensities were recorded for at least 5000 cells and normalized to WT and pcDNA3.1 control levels.
2.9. Surface expression by flow cytometry
HEK293 cells were transiently transfected with 100 ng ACKR4 to a total of 2 μg DNA per condition by supplementing with empty pcDNA3.1 following previously described procedures. After 48 hours, cells were harvested using Accutase (Thermo Fisher Scientific) and transferred to a Guava-compatible 96-well conical plate (Greiner). All subsequent steps were performed at 4 °C and centrifuged at 350g for 3 minutes between washing or incubation step. Cells were washed twice with filtered FC buffer and incubated with anti-hACKR4 mouse antibody (1:500 dilution, MAB-13E11; Biolegend) for 1 hour. After washing, samples were stained with antimouse PE-conjugated secondary antibody (F0102B; R&D Systems) for 1 hour in the dark. Next, cells were washed 3 times before being resuspended in FC buffer. Mean yellow fluorescence intensities were recorded and normalized to WT and pcDNA3.1 control levels.
2.10. AlphaFold3 model building
Structural models of the CCL25:ACKR4:GRK3 complex were predicted using AlphaFold3.0 with default parameters32 and the following amino acid sequences.
CCL25: QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
ACKR4: MALEQNQSTDYYYEENEMNGTYDYSQYELICIKEDVREFAKVFLPVFLTIVFVIGLAGNSMVVAIYAYYKKQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGKIMCKITSALYTLNFVSGMQFLACISIDRYV AVTKVPSQSGVGKPCWIICFCVWMAAILLSIPQLVFYTVNDNARCIPIFP RYLGTSMKALIQMLEICIGFVVPFLIMGVCYFITARTLMKMPNIKISRPLK VLLTVVIVFIVTQLPYNIVKFCRAIDIIYSLITSCNMSKRMDIAIQVTESIAL FHSCLNPILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSEGP TEPTSTFSI
GRK3: MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFNQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQ VTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNVELNIHLTMNE FSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALN ERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHG VFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLG LACDFSKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLL RGHSPFRQHKTKDKHEIDRMTLTVNVELPDTFSPELKSLLEGLLQRDVS KRLGCHGGGSQEVKEHSFFKGVDWQHVYLQKYPPPLIPPRGEVNAAD AFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVTETVYEAVNA DTDKIEARKRAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQR RYFYLFPNRLEWRGEGESRQNLLTMEQILSVEETQIKDKKCILFRIKGGK QFVLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPRSGTVELPK PSLCHRNSNGL
Models were analyzed in ChimeraX-1.6.1, including generation of pLDDT plots. PAE plots were generated and analyzed using PAE viewer.33
2.11. Statistical analysis
All statistical analysis were conducted using GraphPad Prism 10 (GraphPad Software). Data representation in figures, including bar plots, symbols, and error bars are specified in the corresponding figure legends. For scatter plots, the values are the mean from 3 independent experiments, with each experiment performed in triplicate. For bar charts, the bars indicate the mean of the 3 independent experiments, while the individual points represent the means of each experiment measured in triplicate. All error bars correspond to the SD. For kinetic traces, the SD is depicted as the colored area around the data points. Dose–response curves were fitted using a 3-parameter sigmoidal model (log[agonist] vs response) in GraphPad Prism 10, described by the following equation:
For the AUC analysis, the baseline was set at 0. Statistical significance for the dose-response curves was assessed by using the extra sum-of-squares F test using the top value for comparison. All other comparisons were done by 1-way Brown–Forsythe and Welch ANOVA, followed by a Dunnett’s T3 post hoc test. This study is designed as exploratory rather than to test a prespecified statistical null hypothesis. Therefore, P values should not be interpreted as hypothesis testing but only as descriptive. All experiments were performed at least with n = 3 independent biological replicates, defined as experiments performed on separate days with independently transfected cells and freshly prepared reagents. Each biological replicate was measured in triplicate.
3. Results
3.1. Arrestin recruitment to ACKR4 is primarily dependent on GRK2/3 phosphorylation
While ACKR4 recruits GRK2/3, it is not clear yet how the 4 ubiquitously expressed GRKs contribute to receptor phosphorylation. To assess the relative importance of the different GRKs, we monitored BRET between a C terminally tagged ACKR4 (ACKR4-RlucII) and GFP10-tagged β-arrestin2 (GFP10-βarr2) (Fig. 1A) in cells where GRK2/3 (ΔGRK2/3), GRK5/6 (ΔGRK5/6), or GRK2/3/5/6 (ΔQ) were knocked out by CRISPR.27 Arrestins are recruited to the receptor following C-terminal phosphorylation by GRKs and changes to the recruitment signal reflects altered receptor phosphorylation. While we will interpret these changes to BRET efficiency as correlating the amount of phosphorylation throughout this article, it is important to acknowledge that specific phosphorylation sites can have different degrees of impact on arrestin engagement and can even reduce apparent binding of the effector. In WT cells, CCL25-stimulation induced a gradually increasing BRET signal, representing an accumulation of arrestin:ACKR4 complexes (Fig. 1B). Arrestin recruitment was moderately reduced in GRK5/6-deficient cells, whereas ΔGRK2/3 cells showed a substantially lower response (∼30% of the maximal WT response) (Fig. 1C; Supplemental Table 1). In ΔQ cells, where no GRK phosphorylation is possible, no arrestin recruitment was observed with chemokine stimulation. While ACKR4 expression was slightly lower in the knocked out cells (Supplemental Fig. 1), it did not correlate with the relative decreased arrestin engagement. These results indicate that ACKR4 is primarily dependent on GRK2/3 for arrestin engagement, consistent with previous recruitment observations.17 This is particularly unusual for an atypical receptor, since GRK2/3 recruitment to the plasma membrane (PM) is typically G protein dependent,23,34,35 suggesting ACKR4 may be regulated by GRK2/3 via a G protein-independent mechanism.
Fig. 1.

β-Arrestin2 recruitment to ACKR4 is primarily mediated by GRK2/3 phosphorylation. (A) Schematic illustration of BRET pairs ACKR4-RlucII and GFP10-βarr2. βarr2 recruitment following stimulation with 100 nM CCL25 over time (B) or across a titration of CCL25 concentrations (C) toward ACKR4. Values represent the mean ± SD of 3 independent experiments performed in triplicate, normalized to maximal HEK response. Statistical significance at the top of the sigmoidal curve was determined by using the extra sum-of-squares F test. ∗P < .0001.
3.2. GRK2/3 acts on ACKR4 independent of G protein interactions
GRK2/3 localization to the PM is coordinated by Gβγ subunits released from the G protein heterotrimer upon G protein activation and is an essential regulatory step for phosphorylation by these kinases.34,36,37 To determine whether the GRK2/3 recruitment to ACKR4 still requires Gβγ interactions, we assessed GRK3 translocation to the membrane and phosphorylation (by arrestin interactions) of ACKR4 in the presence of GRK3-CT. GRK3-CT consists of the Gβγ interaction domain of GRK3 and its overexpression inhibits GRK2/3 activity by competing for freed Gβγ (Fig. 2A).23,37, 38, 39 The effects were compared with receptors known to use the canonical G protein dependent GRK2/3 mechanism, including the chemokine receptors ACKR3 and CXCR4, an atypical and canonical pair sharing the chemokine CXCL12, and the canonical CCL25-binding sibling receptor of ACKR4, CCR9.26 The CCKRs CXCR4 and CCR9 are phosphorylated by both GRK2/3 and GRK5/6,30,40 while ACKR3 is preferentially phosphorylated by GRK5/6 but can be modified by GRK2/3 when supplied with Gβγ from CXCR4 coactivation.26 The recruitment of GRK3 to native C termini receptors (untagged) was tracked by bystander BRET between GRK3-nanoluciferase (GRK3-Nluc) and monomeric venus fluorescent protein (mV) anchored to the PM by a CAAX motif (mV-CAAX). Upon addition of CCL25, ACKR4 shows a quick recruitment of GRK3 toward the membrane, which peaks at ∼5 minutes and then gradually decreases over time (Fig. 2B). Coexpression with GRK3-CT does not significantly affect kinase recruitment by ACKR4, suggesting a Gβγ-independent recruitment. ACKR3 stimulation shows limited recruitment of GRK3 toward the membrane that quickly returns to baseline (Fig. 2C), in line with the receptor’s established dependency on GRK5/6 and inability to generate its own Gβγ for GRK3 recruitment.23,26,41 The minimal translocation of GRK3 to ACKR3 is eliminated with coexpression of GRK3-CT confirming Gβγ dependency. Both CXCR4 (Fig. 2D) and CCR9 (Fig. 2E) show robust GRK3 recruitment, which is significantly reduced when coexpressed with GRK3-CT. Compared with the other receptors, GRK3 recruitment to ACKR4 is much slower and may suggest unassisted translocation from the cytosol.
Fig. 2.

ACKR4 recruits GRK2/3 independent of Gβγ. (A) Schematic illustration of GRK3-CT as an effective competitor for the GRK2/3:Gβγ interaction. GRK3 localization is measured by bystander BRET between GRK3-Nluc and mV-CAAX with or without coexpression of GRK3-CT after stimulation with 100 nM chemokine of untagged ACKR4 (B, left), ACKR3 (C, left), CXCR4 (D, left), or CCR9 (E, left) measured over time. Recruitment of GFP10-βarrestin2 to ACKR4-RlucII (B, right), ACKR3-RlucII (C, right), CXCR4-RlucII (D, right), or CCR9-RlucII (E, right) across a titration of chemokine concentrations with coexpression of GRK3-CT or Gβγ as indicated. Values represent the mean ± SD of 3 independent experiments performed in triplicate. Statistical significance at the top of the sigmoidal curve was determined by using the extra sum-of-squares F test or by an unpaired t test compared at the peak (GRK3 bystander recruitment). ∗P < .05; ∗∗P < .0001.
Next, the impact of Gβγ on the receptor phosphorylation state was assessed by BRET-based β-arrestin2 recruitment (Fig. 1A). Coexpression of GRK3-CT had no effect on the chemokine-induced arrestin recruitment to ACKR4 (Fig. 2B) but showed a significant decrease for ACKR3, CXCR4, and CCR9 (Fig. 2, C, D, and E), mirroring the impact of GRK3-CT on GRK3 recruitment. We have previously shown the coexpression of the Gβγ subunits can bypass the need for G protein activation for GRK2/3 phosphorylation of atypical GPCRs.26 Circumventing the G proteins had no effect on ACKR4 arrestin recruitment (Fig. 2B), further supporting a Gβγ-independent mechanism for ACKR4. In contrast, Gβγ coexpression enhanced arrestin recruitment to ACKR3 (Fig. 2C), consistent with previous findings that the receptor relies on Gβγ for GRK2/3 phosphorylation despite not producing its own.26 No significant changes were observed for CXCR4 and CCR9 (Fig. 2, D and E), likely because these receptors produce sufficient Gβγ through G protein activation to achieve maximal arrestin recruitment. Together, this shows that ACKR4, but not ACKR3, CXCR4, and CCR9, can recruit GRK3 independent of Gβγ.
To confirm that GRK2/3 indeed do not require G protein interactions to phosphorylate ACKR4, we tested the ability of GRK2 and GRK3 mutants with impaired Gβγ interactions to phosphorylate the panel of receptors. The mutation R587Q (same numbering in both kinases) is located in the pleckstrin homology domain at the Gβγ-binding interface and disrupts complex formation (Fig. 3A).23,41 WT and mutant GRK2 and GRK3 were expressed in cells lacking endogenous GRKs (ΔQ) and their impact on arrestin recruitment was determined by BRET.27 The reintroduced GRKs and mutants showed comparable expression levels (Supplemental Fig. 2). Reintroduction of WT GRK2/3 lead to a marked increase in basal BRET values between ACKR4 and arrestin (Fig. 3B) consistent with previously documented constitutive activity.17 Basal arrestin interactions in the presence of GRK2 R587Q and GRK3 R587Q expression was still observed, albeit much less than compared with the WT GRKs. Receptor activation by CCL25 resulted in increased arrestin recruitment by GRK2/3 R587Q compared with the WT GRKs, suggesting that the CCL25-induced arrestin recruitment by ACKR4 does not require the GRK2/3:Gβγ interaction (Fig. 3B). In fact, blocking this interaction slightly increased the efficacy of chemokine-induced arrestin recruitment, which may indicate that more GRK2/3 R587Q are available to phosphorylate ACKR4 as canonical receptors cannot effectively use these GRKs. Alternatively, the greater basal arrestin interaction with WT GRK coexpression may limit how large of a change can be promoted by chemokine addition, leading to a greater change in BRET with the mutant GRKs. ACKR3 is constitutively active42, 43, 44 and recruits arrestins constitutively in the presence of WT GRKs, but this interaction is abolished with the Gβγ-deficient mutant kinases (Fig. 3C). The CXCL12-induced effect shows impaired arrestin recruitment to ACKR3 for the mutated GRKs compared with WT. No basal arrestin interaction was observed for CXCR4 (Fig. 3D), and chemokine-promoted arrestin recruitment was significantly lower for the GRK mutants than WT GRK2/3. These results are consistent with ACKR3 and CXCR4, requiring the GRK2/3:Gβγ interaction for GRK2/3 phosphorylation, while ACKR4 is phosphorylated by an independent mechanism.
Fig. 3.

ACKR4 does not need GRK2/3:Gβγ or GRK2/3:G⍺q interactions, unlike ACKR3, CXCR4, and CCR9. (A) Schematic illustration of point mutation R587Q that impairs the interaction of GRK2/3 with Gβγ. Constitutive (left) and chemokine-induced (right) arrestin recruitment measured by BRET between GFP10-βarr2 and ACKR4-RlucII (B), ACKR3-RlucII (C), and CXCR4-RlucII (D) in ΔQ across a titration of chemokine concentrations. Coexpression in ΔQ cells with WT GRK2/3 or GRK2/3 R587Q if indicated. (E) Schematic illustration of double mutant of GRK2/3 that lowers the affinity for both Gβγ and G⍺q. Constitutive (left) and chemokine-induced (right) arrestin recruitment measured by BRET between GFP10-βarr2 and ACKR4-RlucII (F) and CCR9-RlucII (G) in ΔQ cells across a titration of chemokine concentrations. Coexpression in ΔQ cells with WT GRK2/3 or GRK2/3 D110A/R587Q if indicated. Values represent the mean ± SD of 3 independent experiments performed in triplicate. Statistical significance at the top of the sigmoidal curve was determined by using the extra sum-of-squares F test, whereas significance for bar graphs was determined using Welch ANOVA, followed by a Dunnett’s T3 multiple comparisons test (basal). ∗P < .05; ∗∗P < .001; and ∗∗∗P < .0001.
The GRK2/3 translocation to the membrane can also be stabilized by interaction with G⍺q.45 This interaction can be effectively impaired by a specific point mutation (D110A) in the G protein signaling homology domain of GRK2/346 (Fig. 3E). The contribution of G⍺q to GRK2/3 recruitment to ACKR4 was thus assessed by introduction of double mutant (D110A/R587Q) GRKs into ΔQ cells and evaluated by arrestin recruitment. Here, CCR9, a G⍺i and G⍺q-coupled CCKR, was taken as a positive control.30 Constitutive arrestin recruitment with coexpression of the double GRK mutants showed a similar pattern as with the GRK R587Q mutants for ACKR4 (Fig. 3F), while CCL25 induced similar arrestin recruitment with both WT and mutant GRKs. Similar to CXCR4, CCR9 showed no constitutive arrestin interaction (Fig. 3G). The CCL25-induced arrestin recruitment to CCR9 was significantly impaired in the mutant GRKs compared with the WT kinases, similar to the effect of R587Q GRKs on ACKR3 and CXCR4. Together these results suggest that phosphorylation of ACKR4 by GRK2/3 is independent of both Gβγ and G⍺q membrane targeting interactions, unlike ACKR3, CXCR4, and CCR9.
3.3. The determinants of Gβγ-independent GRK2/3 phosphorylation are contained in the ACKR4 C terminus
With canonical GRK2/3 mechanisms coordinated by Gβγ and G⍺q excluded, we hypothesized that ACKR4 may directly facilitate GRK2/3 recruitment to the PM, leading to receptor phosphorylation. The receptor C terminus is a key regulatory domain for most GPCRs and a primary target for GRK phosphorylation. Thus, we predicted that the determinants for direct GRK2/3 interactions may be contained within the ACKR4 C terminus, and these could be transferred to another GPCR. To test this hypothesis, we replaced the C terminus of ACKR3 with that of ACKR4 following the structurally conserved NPXXY motif at the end of TM7 to preserve all elements of the ACKR4 C-terminal tail (Fig. 4A). ACKR3 was chosen because it also does not couple G proteins and thus would predominantly rely on the transferred features of the ACKR4 C terminus for GRK2/3 recruitment. Arrestin association to the chimeric ACKR3 [ACKR3_CT(ACKR4)] was assessed by BRET with the same addback experiments as presented in Fig. 3. The basal arrestin interaction for the C-terminal substitution is identical to WT ACKR3 with only WT GRKs promoting an increase, suggesting the constitutive activity of ACKR3 is unaffected by domain swap (Fig. 4B). Arrestin recruitment promoted by CXCL12 to the chimera mimicked the profile of ACKR4, with an elimination of the differences between the WT and mutant GRKs (Fig. 4C). These results suggest that specific features of the ACKR4 C terminus facilitate noncanonical GRK2/3 recruitment and phosphorylation.
Fig. 4.

ACKR3-ACKR4 C terminus chimera makes arrestin recruitment independent of Gβγ. (A) Schematic illustration of the chimeric ACKR3 receptor in which the C-terminal tail of ACKR3 was replaced by that of ACKR4 [ACKR3_CT(ACKR4)] after the NPXXY motif. Constitutive (B) and chemokine-induced (C) arrestin recruitment measured as BRET between GFP10-βarr2 and ACKR3_CT(ACKR4)-RlucII in ΔQ cells across a titration of chemokine concentrations. Coexpression in ΔQ cells with WT GRK2/3 or GRK2/3 R587Q as indicated. Values represent the mean ± SD of 3 independent experiments performed in triplicate. Statistical significance at the top of the sigmoidal curve was determined by using the extra sum-of-squares F test, whereas significance for bar graphs was determined using Welch ANOVA, followed by a Dunnett’s T3 multiple comparisons test (basal). ∗P < .001.
3.4. Unique acidic-rich proximal C terminus is responsible for direct GRK3:ACKR4 interaction
The ACKR3-CT(ACKR4) results (Fig. 4) suggest that specific motifs in the ACKR4 C terminus coordinate G protein-independent GRK2/3 phosphorylation. Therefore, we looked for unique patterns in the C-terminal sequence of ACKR4 compared to other chemokine receptors. We found that ACKR4 has a uniquely acidic-rich proximal C terminus which features a series of negatively charged amino acids (EEXXXDXEXXXE) immediately following the putative end of helix 8 and followed by a high density of potential phosphosites (Fig. 5).46
Fig. 5.

ACKR4 has a unique acidic-rich proximal C terminus, compared with other chemokine receptors. (A) Sequence alignment of helix 8 and the C terminus of all chemokine receptors. Percentage of acidic residues within the C terminus of all chemokine receptors with a rolling analysis window of 5 residues are indicated, from the conserved aromatic residue at position 8.50. Sequence information was obtained from GPCRdb.46 (B) A sliding-window analysis (window size = 5 amino acids) was used to quantify the local density of acidic residues (Asp and Glu) in the C termini of each chemokine receptor, reported in percentages. Higher values indicate short sequence segments that are enriched with negatively charged residues. ACKR4 is highlighted in red.
Acidic residues N-terminal to the target serines or threonines are necessary for GRK2/3 phosphorylation of peptide substrates.47,48 Therefore, we postulated that the uniquely dense acidic region preceding the majority of the ACKR4 phosphorylation sites may mediate the G protein-independent GRK2/3 activity. The identified glutamate and aspartate residues were mutated into alanines in pairs (E332A/E333A, D337A/E339A), in clusters (Proximal: E332A/E333A/D337A, Distal: E339A/E343A), or in their entirety (Acidic_All: E332A/E333A/D337A/E339A/E343A) (Fig. 6A). First, the effect of these mutations was assessed by measuring the arrestin recruitment by BRET. Constitutive arrestin engagement was reduced for all mutants to ∼60% of WT ACKR4 (Fig. 6B). Moreover, CCL25-mediated arrestin recruitment was nearly abolished when all five acidic sites were mutated (Fig. 6C). The proximal sites had the next largest impact with ∼50% WT ACKR4 recruitment levels, while the distal cluster substitution alone had no effect on arrestin engagement. No pair or cluster of residues was fully responsible for the impaired recruitment observed with the Acidic_All mutant. While these results are suggestive a role for the acidic motifs in mediating GRK2/3 recruitment and phosphorylation, an alternate explanation is that the residues impact the engagement of arrestin with ACKR4 directly. To test that the mutational impact is on GRK2/3 recruitment, Gβγ was coexpressed to provide an alternate mechanism for membrane recruitment and bypass our proposed ACKR4 specific one. When Gβγ was included in the assay, arrestin recruitment of Acidic_All ACKR4 increased from <20% of WT to ∼50%, consistent with the interpretation that these residues are playing a role in coordinating GRK2/3 recruitment to the receptor rather than strictly impairing arrestin engagement (Fig 6D). The lack of full recovery could be partially explained by lower expression of the Acidic_All mutant relative to WT ACKR4 (Supplemental Fig. 3). We next tested the effect of the DE/A mutations on ACKR4-mediated GRK3 recruitment directly by bystander BRET between the kinase and mV-CAAX. Consistent with arrestin recruitment, GRK3 recruitment was severely reduced for the Acidic_All construct (Fig. 6, E and F). The trend between the mutants was also similar to the arrestin recruitment, with the small exception that the proximal substitution was as impaired as the Acidic_All rather than the next most impacted. Indeed, quantitative comparison revealed a strong correlation between assays, indicating that mutants with reduced GRK3 recruitment in response to CCL25 also showed proportionally reduced chemokine-mediated arrestin recruitment (Supplemental Fig. 4A). While surface expression of all mutants was less than WT ACKR4, these differences did not correlate with GRK3 or arrestin recruitment and thus cannot explain the effects on effector recruitment observed here (Supplemental Fig. 5).
Fig. 6.

Acidic residues of ACKR4 facilitate GRK3 recruitment toward the membrane. (A) Schematic illustration of the C terminus of ACKR4 with annotated acidic residues. Constitutive (B) and chemokine-induced (C) arrestin recruitment of GFP10-βarr2 toward ACKR4-RlucII, with coexpression of Gβγ (D), across a range of chemokine concentrations. (E, left) GRK3 localization measured as bystander BRET between GRK3-Nluc and mV-CAAX with coexpression of untagged ACKR4 over time after stimulation with 100 nM chemokine at time zero. (E, right) Quantified by AUC from €. (F) Uptake of CCL25-AZ488 by ACKR4 measured by flow cytometry. Values represent the mean ± SD of 3 independent experiments performed in triplicate. Statistical significance at the top of the sigmoidal curve was determined by using the extra sum-of-squares F test, whereas significance for bar graphs (excluding C) was determined using Welch ANOVA, followed by a Dunnett’s T3 multiple comparisons test (basal). ∗P < .05; ∗∗P < .001; and ∗∗∗P < .0001.
The role of ACKR4 is primarily to remove chemokines and sequester these ligands inside of cells.8,9 To quantify the effects of the acidic substitutions on CCL25 uptake, we measured the accumulation of fluorescent CCL25 into HEK293 cells and quantified the intensity of fluorescent emission after 1.5 h incubation by flow cytometry. Chemokine uptake by all of the DE/A mutants was significantly reduced compared to WT ACKR4 (Fig. 6G), matching the effects on GRK3 (Supplemental Fig. 4B) and arrestin recruitment (Supplemental Fig. 4C) for all but one substitution. The decrease in uptake for the distal construct matches the change in basal arrestin association (Supplemental Fig. 4D), but not ligand-induced, which suggests a role for receptor constitutive activity in chemokine scavenging. Like with GRK3 recruitment, the proximal and Acidic_all substitutions had the greatest effects. Taken together, these results suggests that the acidic-rich motif in the proximal ACKR4 C terminus mediates GRK2/3 recruitment and chemokine scavenging functions.
3.5. Basic residues in the GRK3 kinase domain coordinate recruitment to activated GPCRs
The noncanonical recruitment of GRK3 by ACKR4 appears to be coordinated by the acidic-rich C terminus of the receptor (Fig. 6). This suggests that this unique motif may make distinct, ACKR4-specific interactions with the kinase. To explore this postulate, a model of the CCL25–ACKR4–GRK3 complex was generated with AlphaFold3 (Fig. 7A). In this model, the negatively charged ACKR4 C terminus is predicted near a series of basic residues along the kinase large lobe, which may support coordinating the C terminus in the kinase domain for phosphate modification. Since the predicted positioning of the ACKR4 C terminus with respect to the kinase is of low confidence, specific interactions were not predicted (Supplemental Fig. 6). Seven lysine and arginine residues on GRK3 were mutated individually to alanines (R226A, K230A, R316A, K319A, K345A, K364A, and K383A) to eliminate potential electrostatic interactions with the acidic residues of the ACKR4 C terminus and the recruitment of GRK3 to the membrane was measured by bystander BRET (Fig. 7B). While many of the mutations impaired GRK3 localization to ACKR4, these perturbations also similarly diminish GRK3 recruitment to the CCKRs CCR9 and CXCR4, suggesting that these putative interactions are not the unique, G protein-independent mechanism of ACKR4, but rather are generally involved for all GPCRs. Total expression of some of GRK mutants was slightly lower than that of WT; however, the observed effects are not explained by less kinase (Supplemental Fig. 7). This suggests the role of the basic residues on the GRK3 large lobe may play similar roles for coordinating GRK recruitment to ACKR4 as well as the G protein dependent GPCRs. Based on the predicted positioning in the model, this would imply that the GPCR C-terminal interactions with GRK3 contribute to the recruitment of the kinase even under G protein dependent conditions.
Fig. 7.

Mutating basic residues near the GRK3 active site has similar impact on kinase recruitment to ACKR4 as to the canonical receptors CXCR4 and CCR9. (A) Alphafold3.0 model of ACKR4 with GRK3 with potential interacting basic residues highlighted: R226, black; K230, green; R316, cyan; K319, blue; K345, pink; K364, gold; and K383, purple. The C-terminal acidic residues on ACKR4 are colored red. (B) GRK3 localization (GRK3-Nluc) toward the membrane (mV-CAAX) quantified by AUC. Values represent the mean ± SD of 3 independent experiments performed in triplicate. Statistical significance was determined by 1-way Brown–Forsythe and Welch ANOVA, followed by a Dunnett’s T3 multiple comparisons test.
The model (Fig. 7A) suggests that the acidic residues may play a role in orienting the C terminus for phosphate addition. Thus, another key component to this interaction would be the catalytic site of the kinase with the to-be-modified serine or threonine residue. Contacts during the enzymatic reaction may contribute to the GRK recruitment to ACKR4. While these interactions would be present for all GPCRs, they may be relatively minor than canonical G protein–mediated translocation of GRK2/3 and would represent a larger source of binding energy for the ACKR4 mechanism. To interrogate the role of these interactions on GRK recruitment, a point mutation was added to GRK3 within the ATP-binding pocket, K220R, which renders the kinase “kinase-dead (KD)” and unable to phosphorylate substrates.49 Recruitment of the KD-GRK3 was tracked by membrane translocation by bystander BRET between GRK3-Nluc and mV-CAAX. Following stimulation with CCL25, the recruitment of KD-GRK3 to ACKR4 is only ∼25% compared with the WT GRK3 (Fig. 8A). None of the receptors that depend on G proteins for GRK3 recruitment, ACKR3, CXCR4, or CCR9, showed significant differences between WT and KD kinase recruitment (Fig. 8, B, C, and D). Total expression of the KD-GRK3-Nluc, measured by luminescence counts, was similar compared with that of WT GRK3 (Supplemental Fig. 8). The contribution of functional phosphorylation on ACKR4 is further supported by ∼40% GRK3 recruitment to an ACKR4 construct, with all potentially phosphorylated serine and threonine residues substituted by alanine (Supplemental Fig. 9, A and B). Surface expression of the ST/A mutant was slightly less than WT ACKR4 (Supplemental Fig. 9C). This suggests that, when GRK2/3 recruitment is independent of G protein interactions, kinase recruitment is governed by the interactions responsible for positioning and facilitating the phosphorylation reaction.
Fig. 8.

Functional kinase is required for ACKR4 recruitment of GRK3. GRK3 localization toward the membrane measured as bystander BRET between GRK3-Nluc and mV-CAAX with coexpression of untagged ACKR4 (A), ACKR3 (B), CXCR4 (C), or CCR9 (D) following stimulation with 100 nM CCL25 (ACKR4 and CCR9) or CXCL12 (ACKR3 and CXCR.4). Quantification (right) by AUC. Values represent the mean ± SD of 3 independent experiments performed in triplicate. Statistical significance was determined by an unpaired t test. ∗P < .001.
4. Discussion
ACKR4 plays a crucial role in modulating chemokine gradients by scavenging the chemokines CCL19, CCL20, CCL21, and CCL25 to regulate the migration of CCR6-, CCR7-, and CCR9-expressing immune cells. This activity is mediated by arrestin coupling and GRK phosphorylation. Specifically, GRK2/3 dominate ACKR4 phosphomodification, creating a paradox. GRK2/3 require interactions with activated G proteins to translocate to the PM and phosphorylate GPCRs, however, ACKR4 does not activate G proteins. In fact, ACKR4 does not need G proteins to recruit the G protein dependent kinases but rather coordinates the enzymes through a uniquely acidic-rich proximal C terminus. Interactions with these residues, along with specific sites for phosphorylation, provide sufficient binding energy to bypass the need for canonical G protein interactions. These findings highlight a unique mechanism by which an atypical GPCR has evolved to use an efficient regulation system despite its atypical function (Fig. 9).
Fig. 9.

ACKR4 coordinates GRK2/3 recruitment by interactions between the acidic-rich C terminus and kinase catalytic domain. (A) Phosphorylation of GPCRs by GRK2/3 is coordinated by protein–protein interactions, which promote PM localization by complexing with the activated Gβγ (PH-domain, green) and/or Gaq (RH-domain, yellow) subunits. Active receptors are identified by the kinases through the GRK N terminus (orange). The GRK catalytic domain (blue) then binds the substrate C terminus and modifies specific serine and/or threonine residues. (B) Most GPCRs require the G protein interactions to relocate the GRKs to the PM for the GPCR-specific interactions and phosphorylation. ACKR4 can use GRK2/3 without G protein coordination and only requires interactions with the receptor core (GRK N terminus) and C-terminal tail (GRK catalytic domain).
The preference of GRK2/3 to phosphorylate serine and threonine residues C-terminal following acidic motifs is well documented.47 For example, mutation of a glutamate to a lysine before the terminal phosphosites in CXCR4 impairs phosphorylation of these positions and protects the receptor from desensitization.50 Similarly, GRK2 readily phosphorylates peptides derived from phosphorylation motifs within the ⍺2-adrenergic receptor but only when the target serine or threonine is preceded by an acidic residue.48 A single glutamate is sufficient for GRK2 activity, with charges 2 or 3 residues before the phosphosite being the most efficiently phosphorylated sequences.48 Many of the putative phosphorylation sites on ACKR4 are within 3 residues of an N-terminal acidic residue, suggesting the receptor may have evolved these acidic motifs to allow the C terminus to act as an efficient substrate for GRK2/3 to remove the G protein dependency.
Despite efficient coupling of the kinase domain to the substrate’s C terminus, GRK2/3 action at ACKR4 is ultimately still dependent on receptor activation. This observation is consistent with earlier reports, showing a 200-fold increase in efficiency of free peptide phosphorylation by GRK2 when an activated GPCR, either light-activated rhodopsin or agonist-activated β2AR, was included.51 Thus, even in the absence of G protein dependency, receptor activation coordinates phosphorylation with chemokine detection. Although the explicit role of phosphorylation in chemokine uptake is not fully understood, arrestins play a clear role in efficient chemokine clearance by ACKR4.17 Therefore, the detection of the active ACKR4 state by GRK2/3 allows for synchronization of chemokine binding with arrestin coupling despite lacking the second level of regulation through G proteins.
While 7 GRKs are expressed in the human genome, the vast majority of GPCR regulation is performed by the 4 ubiquitously expressed kinases, GRK2/3/5/6. The expression levels of these kinases can vary drastically by cell and provide cell type specific signaling responses from different GPCRs. ACKR4 is expressed on a variety of cell types including lymphatic endothelial cells,52 thymic epithelial cells,53 and subpopulations of gut-derived mesenchymal stem cells.54 In each environment, the atypical receptor functions to regulate the surrounding chemokine gradients and immune cell positioning and responses. Phosphorylation and arrestin coupling contribute to chemokine scavenging by ACKR417; thus, the evolved GRK2/3 phosphorylation mechanism would allow the receptor to use all ubiquitously expressed GRKs and efficiently regulate chemokine availability across an array of cellular backgrounds.
Five ACKRs have been identified that have evolved to function independently of G proteins. ACKR1 functions independent of canonical effects such as G protein or arrestins and shows no discernable recruitment of any effectors, including GRKs, upon chemokine stimulation.55 The distal C terminus of ACKR2 is similarly rich with acidic residues interspersed with putative phosphorylation sites. The positioning of these motifs could facilitate similar G protein-independent GRK2/3 phosphorylation as described in this study for ACKR4. Deletion of these residues eliminates agonist-induced arrestin recruitment and internalization.56 ACKR3 phosphorylation is primarily dependent on GRK5/6 but can borrow Gβγ from other sources, such as coactivation of CXCR4, to drive GRK2/3-mediated phosphorylation.26 ACKR5 is solely dependent on GRK5/6 for its ligand-induced regulation and knocking out GRK2/3 had no effect on ligand-induced receptor internalization and uptake.57 As described in this study, ACKR4 has evolved a C terminus to be an efficient enough substrate for GRK2/3 phosphorylation to overcome G protein dependency for membrane targeting. These distinct mechanisms allow for ACKRs to circumvent the need for G protein activation while still using the evolved GRK regulatory mechanisms.
Taking the putative phosphorylation sites alone, ACKR4 lacks a known arrestin-binding motif, despite being an arrestin-biased, atypical receptor. Neither the simplified PXPP motif58 nor the extended PX1–2PXXP motif,59 where P is a phosphorylated serine or threonine and X is any amino acid, are present in the sequence. Clear arrestin-binding sequences become apparent only when the glutamates and aspartates of the acidic-rich proximal C terminus are treated as phosphomimetics. By replacing 1 or more of the P’s from the binding sequence with a negatively charged residue, it would effectively render part of the binding barcode always on and reduce the needed modifications for arrestin recruitment. These primed sequences could respond quicker to chemokine stimulation, perhaps allowing for rapid changes in chemokine concentration to be efficiently rectified.
Treating the acidic motifs as phosphomimetics also suggests that phosphorylation along the C terminus could similarly promote further phosphorylation of downstream sites. Peptide phosphorylation experiments indicate that phosphorylated serines N-terminal to the target residue enhance the rate and efficiency of further GRK2 phosphorylation.51 Many examples of hierarchal phosphorylation have also been reported. CXCR4,50 C5a anaphylatoxin receptor,60 rhodopsin,61 and β1/β2AR,62 all show sequential and ordered phosphate incorporation. Phosphorylation of the μ-opioid receptor at S375 is required before either T376 or T379 can be modified.63 This subsequent phosphorylation is selectively mediated by GRK2/3, consistent with the kinase preference for N-terminal negative charges. Our results suggest that the G protein dependence of GRK2/3 could become less as more phosphates are transferred to the receptors, which may allow for rapid saturation of the GPCR C terminus and efficient signal termination.
In conclusion, ACKR4 noncanonically recruits the GRK2/3 family that is driven by its acidic proximal C terminus. The acidic residues coordinate the kinase domain to orient the target serine or threonine residues for phosphorylation-driven regulation, and these interactions are sufficient to overcome the lack of G protein coupling and coordination. This unique feature allows the atypical receptor to exploit the efficient regulation by GRK2/3 without triggering G protein signaling cascades. Such a mechanism may be more broadly applicable to other GPCRs as a secondary regulatory motif after G proteins and provides important insights into ACKR4 regulation.
Conflict of interest
The authors declare no conflicts of interest.
Acknowledgments
We thank C. Hoffmann (Friedrich-Schiller-Universität), N. Heveker (Université de Montréal), N. Lambert (Augusta University), A. Inoue (Tohoku University), D. Legler (Biotechnology Institute Thurgau), and M. Bouvier (Université de Montréal) for the BRET constructs and cell lines used in this study.
Financial support
This publication is part of the TRANSLATION project with file number OCENW.M.24.006, which is partly financed by the Dutch Research Council (NWO) [grant ID: https://doi.org/10.61686/YKUZU08217].
Data availability
The authors declare that all data supporting the findings of this study are available within the paper and its supplemental data.
CRediT authorship contribution statement
Thomas Lamme: Conceptualization, Formal Analysis, Investigation, Methodology, Validation, Visualization, Writing – Original Draft, Writing – Review and Editing. Isabel Sánchez Arroyo: Investigation, Writing – Review and Editing. Martine J. Smit: Funding acquisition, Resources, Writing – Review and Editing. Christopher T. Schafer: Conceptualization, Formal Analysis, Funding Acquisition, Investigation, Methodology, Project Administration, Supervision, Validation, Visualization, Writing – Original Draft, Writing – Review and Editing.
Footnotes
This article has supplemental material available at molpharm.aspetjournals.org.
Supplemental Material
References
- 1.Griffith J.W., Sokol C.L., Luster A.D. Chemokines and chemokine receptors: positioning cells for host defense and immunity. Annu Rev Immunol. 2014;32:659–702. doi: 10.1146/annurev-immunol-032713-120145. [DOI] [PubMed] [Google Scholar]
- 2.Bonecchi R., Graham G.J. Atypical chemokine receptors and their roles in the resolution of the inflammatory response. Front Immunol. 2016;7 doi: 10.3389/fimmu.2016.00224. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Nibbs R.J.B., Graham G.J. Immune regulation by atypical chemokine receptors. Nat Rev Immunol. 2013;13(10):815–829. doi: 10.1038/s41577-024-01025-5. [DOI] [PubMed] [Google Scholar]
- 4.Rajagopal S., Kim J., Ahn S., et al. Beta-arrestin- but not G protein-mediated signaling by the ‘decoy’ receptor CXCR7. Proc Natl Acad Sci U S A. 2010;107(2):628–632. doi: 10.1073/pnas.0912852107. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Schweickart V.L., Epp A., Raport C.J., Gray P.W. CCR11 is a functional receptor for the monocyte chemoattractant protein family of chemokines. J Biol Chem. 2000;275(13):9550–9556. doi: 10.1074/jbc.275.13.9550. [DOI] [PubMed] [Google Scholar]
- 6.Khoja H., Wang G., Ng C.T., et al. Cloning of CCRL1, an orphan seven transmembrane receptor related to chemokine receptors, expressed abundantly in the heart. Gene. 2000;246(1–2):229–238. doi: 10.1016/s0378-1119(00)00076-7. [DOI] [PubMed] [Google Scholar]
- 7.Gosling J., Dairaghi D.J., Wang Y., et al. Cutting edge: identification of a novel chemokine receptor that binds dendritic cell- and T cell-active chemokines including ELC, SLC, and TECK. J Immunol. 2000;164(6):2851–2856. doi: 10.4049/jimmunol.164.6.2851. [DOI] [PubMed] [Google Scholar]
- 8.Comerford I., Milasta S., Morrow V., Milligan G., Nibbs R. The chemokine receptor CCX-CKR mediates effective scavenging of CCL19 in vitro. Eur J Immunol. 2006;36(7):1904–1916. doi: 10.1002/eji.200535716. [DOI] [PubMed] [Google Scholar]
- 9.Comerford I., Nibbs R.J.B., Litchfield W., et al. The atypical chemokine receptor CCX-CKR scavenges homeostatic chemokines in circulation and tissues and suppresses Th17 responses. Blood. 2010;116(20):4130–4140. doi: 10.1182/blood-2010-01-264390. [DOI] [PubMed] [Google Scholar]
- 10.Matti C., D’Uonnolo G., Artinger M., et al. CCL20 is a novel ligand for the scavenging atypical chemokine receptor 4. J Leukoc Biol. 2020;107(6):1137–1154. doi: 10.1002/JLB.2MA0420-295RRR. [DOI] [PubMed] [Google Scholar]
- 11.Meyrath M., Reynders N., Uchański T., Chevigné A., Szpakowska M. Systematic reassessment of chemokine-receptor pairings confirms CCL20 but not CXCL13 and extends the spectrum of ACKR4 agonists to CCL22. J Leukoc Biol. 2021;109(2):373–376. doi: 10.1002/JLB.2AB0520-275R. [DOI] [PubMed] [Google Scholar]
- 12.Melgrati S., Gerken O.J., Artinger M., et al. Atlas of the anatomical localization of atypical chemokine receptors in healthy mice. PLoS Biol. 2023;21(5) doi: 10.1371/journal.pbio.3002111. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 13.Bryce S.A., Wilson R.A.M., Tiplady E.M., et al. ACKR4 on stromal cells scavenges CCL19 to enable CCR7-dependent trafficking of APCs from inflamed skin to lymph nodes. J Immunol. 2016;196(8):3341–3353. doi: 10.4049/jimmunol.1501542. [DOI] [PubMed] [Google Scholar]
- 14.Zaballos A., Gutiérrez J., Varona R., Ardavín C., Márquez G. Cutting edge: identification of the orphan chemokine receptor GPR-9-6 as CCR9, the receptor for the chemokine TECK. J Immunol. 1999;162(10):5671–5675. [PubMed] [Google Scholar]
- 15.Papadakis K.A., Prehn J., Nelson V., et al. The role of thymus-expressed chemokine and its receptor CCR9 on lymphocytes in the regional specialization of the mucosal immune system. J Immunol. 2000;165(9):5069–5076. doi: 10.4049/jimmunol.165.9.5069. [DOI] [PubMed] [Google Scholar]
- 16.Worbs T., Mempel T.R., Bölter J., Von Andrian U.H., Förster R. CCR7 ligands stimulate the intranodal motility of T lymphocytes in vivo. J Exp Med. 2007;204(3):489–495. doi: 10.1084/jem.20061706. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Matti C., Salnikov A., Artinger M., et al. ACKR4 recruits GRK3 prior to β-arrestins but can scavenge chemokines in the absence of β-arrestins. Front Immunol. 2020;11:720. doi: 10.3389/fimmu.2020.00720. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Matthees E.S.F., Haider R.S., Hoffmann C., Drube J. Differential regulation of GPCRs—are grk expression levels the key? Front Cell Dev Biol. 2021;9 doi: 10.3389/fcell.2021.687489. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Yang J., Hall J.E., Jose P.A., Chen K., Zeng C. Comprehensive insights in GRK4 and hypertension: from mechanisms to potential therapeutics. Pharmacol Ther. 2022;239 doi: 10.1016/j.pharmthera.2022.108194. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Pronin A.N., Benovic J.L. Regulation of the G protein-coupled receptor kinase GRK5 by protein kinase C. J Biol Chem. 1997;272(6):3806–3812. doi: 10.1074/jbc.272.6.3806. [DOI] [PubMed] [Google Scholar]
- 21.Tao L., Liu Y., Fan G., et al. GRK6 palmitoylation increasing its membrance translocation promotes LPS-induced inflammation by PI3K/ AKT pathway in kuppfer cells. Int Immunopharmacol. 2023;117 doi: 10.1016/j.intimp.2023.109933. [DOI] [PubMed] [Google Scholar]
- 22.Chen Q., Schafer C.T., Mukherjee S., et al. Effect of phosphorylation barcodes on arrestin binding to a chemokine receptor. Nature. 2025;643(8070):280–287. doi: 10.1038/s41586-025-09024-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23.Matthees E.S.F., Filor J.C., Jaiswal N., et al. GRK specificity and Gβγ dependency determines the potential of a GPCR for arrestin-biased agonism. Commun Biol. 2024;7(1):802. doi: 10.1038/s42003-024-06490-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Pandey S., Kumari P., Baidya M., et al. Intrinsic bias at non-canonical, β-arrestin-coupled seven transmembrane receptors. Mol Cell. 2021;81(22):4605–4621.e11. doi: 10.1016/j.molcel.2021.09.007. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Sarma P., Carino C.M.C., Seetharama D., et al. Molecular insights into intrinsic transducer-coupling bias in the CXCR4-CXCR7 system. Nat Commun. 2023;14(1):4808. doi: 10.1038/s41467-023-40482-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26.Schafer C.T., Chen Q., Tesmer J.J.G., Handel T.M. Atypical chemokine receptor 3 ‘senses’ CXC chemokine receptor 4 activation through GPCR kinase phosphorylation. Mol Pharmacol. 2023;104(4):174–186. doi: 10.1124/molpharm.123.000710. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27.Drube J., Haider R.S., Matthees E.S.F., et al. GPCR kinase knockout cells reveal the impact of individual GRKs on arrestin binding and GPCR regulation. Nat Commun. 2022;13(1):540. doi: 10.1038/s41467-022-28152-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Inoue A., Raimondi F., Kadji F.M.N., et al. Illuminating G-protein-coupling selectivity of GPCRs. Cell. 2019;177(7):1933–1947.e25. doi: 10.1016/j.cell.2019.04.044. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Namkung Y., Le Gouill C., Lukashova V., et al. Monitoring G protein-coupled receptor and β-arrestin trafficking in live cells using enhanced bystander BRET. Nat Commun. 2016;7 doi: 10.1038/ncomms12178. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Lamme T.D., Smit M.J., Schafer C.T. Signal termination of the chemokine receptor CCR9 is governed by an arrestin-independent phosphorylation mechanism. J Biol Chem. 2025;301(5) doi: 10.1016/j.jbc.2025.108462. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.Gustavsson M., Zheng Y., Handel T.M. Production of chemokine/chemokine receptor complexes for structural biophysical studies. Methods Enzymol. 2016;570:233–260. doi: 10.1016/bs.mie.2015.10.003. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.Abramson J., Adler J., Dunger J., et al. Accurate structure prediction of biomolecular interactions with AlphaFold 3. Nature. 2024;630(8016):493–500. doi: 10.1038/s41586-024-07487-w. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Elfmann C., Stülke J. PAE viewer: a webserver for the interactive visualization of the predicted aligned error for multimer structure predictions and crosslinks. Nucleic Acids Res. 2023;51(W1):W404–W410. doi: 10.1093/nar/gkad350. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 34.Pitcher J.A., Touhara K., Payne E.S., Lefkowitz R.J. Pleckstrin homology domain-mediated membrane association and activation of the β-adrenergic receptor kinase requires coordinate interaction with Gβγ subunits and lipid. J Biol Chem. 1995;270(20):11707–11710. doi: 10.1074/jbc.270.20.11707. [DOI] [PubMed] [Google Scholar]
- 35.Pitcher J.A., Inglese J., Higgins J.B., et al. Role of beta gamma subunits of G proteins in targeting the beta-adrenergic receptor kinase to membrane-bound receptors. Science. 1992;257(5074):1264–1267. doi: 10.1126/science.1325672. [DOI] [PubMed] [Google Scholar]
- 36.Lodowski D.T., Pitcher J.A., Capel W.D., Lefkowitz R.J., Tesmer J.J.G. Keeping G proteins at bay: a complex between G protein-coupled receptor kinase 2 and Gbetagamma. Science. 2003;300(5623):1256–1262. doi: 10.1126/science.1082348. [DOI] [PubMed] [Google Scholar]
- 37.Koch W.J., Inglese J., Stone W.C., Lefkowitz R.J. The binding site for the beta gamma subunits of heterotrimeric G proteins on the beta-adrenergic receptor kinase. J Biol Chem. 1993;268(11):8256–8260. [PubMed] [Google Scholar]
- 38.Koch W.J., Hawes B.E., Inglese J., Luttrell L.M., Lefkowitz R.J. Cellular expression of the carboxyl terminus of a G protein-coupled receptor kinase attenuates G beta gamma-mediated signaling. J Biol Chem. 1994;269(8):6193–6197. [PubMed] [Google Scholar]
- 39.Smrcka A.V. G protein βγ subunits: central mediators of G protein-coupled receptor signaling. Cell Mol Life Sci. 2008;65(14):2191–2214. doi: 10.1007/s00018-008-8006-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40.Busillo J.M., Armando S., Sengupta R., Meucci O., Bouvier M., Benovic J.L. Site-specific phosphorylation of CXCR4 is dynamically regulated by multiple kinases and results in differential modulation of CXCR4 signaling. J Biol Chem. 2010;285(10):7805–7817. doi: 10.1074/jbc.M109.091173. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Carman C.V., Barak L.S., Chen C., et al. Mutational analysis of Gβγ and phospholipid interaction with G protein-coupled receptor kinase 2. J Biol Chem. 2000;275(14):10443–10452. doi: 10.1074/jbc.275.14.10443. [DOI] [PubMed] [Google Scholar]
- 42.Yen Y.C., et al. Structures of atypical chemokine receptor 3 reveal the basis for its promiscuity and signaling bias. Sci Adv. 2022;8(28) doi: 10.1126/sciadv.abn8063. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Schafer C.T., Pauszek R.F., Gustavsson M., Handel T.M., Millar D.P. Distinct activation mechanisms of CXCR4 and ACKR3 revealed by single-molecule analysis of their conformational landscapes. Elife. 2025;13 doi: 10.7554/eLife.100098. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44.Perez Almeria C.V., Otun O., Schlimgen R., et al. Constitutive activity of an atypical chemokine receptor revealed by inverse agonistic nanobodies. bioRxiv. Preprint. Posted online November 4, 2024 doi: 10.1101/2024.11.04.621790. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Sterne-Marr R., Tesmer J.J., Day P.W., et al. G protein-coupled receptor kinase 2/Gαq/11 interaction: a novel surface on a regulator of G protein signaling homology domain for binding Gα subunits. J Biol Chem. 2003;278(8):6050–6058. doi: 10.1074/jbc.M208787200. [DOI] [PubMed] [Google Scholar]
- 46.Isberg V., Vroling B., van der Kant R., Li K., Vriend G., Gloriam D. GPCRDB: an information system for G protein-coupled receptors. Nucleic Acids Res. 2014;42(Database issue):D422–D425. doi: 10.1093/nar/gkt1255. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 47.Pitcher J.A., Freedman N.J., Lefkowitz R.J. G protein-coupled receptor kinases. Annu Rev Biocem. 1998;16:653–692. doi: 10.1146/annurev.biochem.67.1.653. [DOI] [PubMed] [Google Scholar]
- 48.Onorato J.J., Palczewski K., Regan J.W., Caron M.G., Lefkowitz R.J., Benovic J.L. Role of acidic amino acids in peptide substrates of the beta-adrenergic receptor kinase and rhodopsin kinase. Biochemistry. 1991;30(21):5118–5125. doi: 10.1021/bi00235a002. [DOI] [PubMed] [Google Scholar]
- 49.Kong G., Penn R., Benovic J.L. A beta-adrenergic receptor kinase dominant negative mutant attenuates desensitization of the beta 2-adrenergic receptor. J Biol Chem. 1994;269(18):13084–13087. [PubMed] [Google Scholar]
- 50.Mueller W., Schütz D., Nagel F., Schulz S., Stumm R. Hierarchical organization of multi-site phosphorylation at the CXCR4 C terminus. PLoS One. 2013;8(5) doi: 10.1371/journal.pone.0064975. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 51.Chen C.Y., Dion S.B., Kim C.M., Benovic J.L. Beta-adrenergic receptor kinase. Agonist-dependent receptor binding promotes kinase activation. J Biol Chem. 1993;268(11):7825–7831. [PubMed] [Google Scholar]
- 52.Ulvmar M.H., Werth K., Braun A., et al. The atypical chemokine receptor CCRL1 shapes functional CCL21 gradients in lymph nodes. Nat Immunol. 2014;15(7):623–630. doi: 10.1038/ni.2889. [DOI] [PubMed] [Google Scholar]
- 53.Heinzel K., Benz C., Bleul C.C. A silent chemokine receptor regulates steady-state leukocyte homing in vivo. Proc Natl Acad Sci U S A. 2007;104(20):8421–8426. doi: 10.1073/pnas.0608274104. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54.Thomson C.A., van de Pavert S.A., Stakenborg M., et al. Expression of the atypical chemokine receptor ACKR4 identifies a novel population of intestinal submucosal fibroblasts that preferentially expresses endothelial cell regulators. J Immunol. 2018;201(1):215–229. doi: 10.4049/jimmunol.1700967. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 55.Saha S., Khanppnavar B., Maharana J., et al. Molecular mechanism of distinct chemokine engagement and functional divergence of the human Duffy antigen receptor. Cell. 2024;187(17):4751–4769.e25. doi: 10.1016/j.cell.2024.07.005. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 56.Galliera E., Jala V.R., Trent J.O., et al. β-arrestin-dependent constitutive internalization of the human chemokine decoy receptor D6. J Biol Chem. 2004;279(24):25590–25597. doi: 10.1074/jbc.M400363200. [DOI] [PubMed] [Google Scholar]
- 57.Melgrati S., Gerken O.J., Artinger M., et al. GPR182 is a broadly scavenging atypical chemokine receptor influencing T-independent immunity. Front Immunol. 2023;14 doi: 10.3389/fimmu.2023.1242531. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 58.Maharana J., Sarma P., Yadav M.K., et al. Structural snapshots uncover a key phosphorylation motif in GPCRs driving β-arrestin activation. Mol Cell. 2023;83(12):2091–2107.e7. doi: 10.1016/j.molcel.2023.04.025. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 59.Zhou X.E., He Y., de Waal P.W., et al. Identification of phosphorylation codes for arrestin recruitment by G protein-coupled receptors. Cell. 2017;170(3):457–469.e13. doi: 10.1016/j.cell.2017.07.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 60.Giannini E., Brouchon L., Boulay F. Identification of the major phosphorylation sites in human C5a anaphylatoxin receptor in vivo. J Biol Chem. 1995;270(32):19166–19172. doi: 10.1074/jbc.270.32.19166. [DOI] [PubMed] [Google Scholar]
- 61.Ohguro H., Palczewski K., Ericsson L.H., Walsh K.A., Johnson R.S. Sequential phosphorylation of rhodopsin at multiple sites. Biochemistry. 1993;32(21):5718–5724. doi: 10.1021/bi00072a030. [DOI] [PubMed] [Google Scholar]
- 62.Löbbert A., Lorz N., Matthees E.S.F., Rößler P., Hoffmann C., Gossert A.D. GPCR kinases phosphorylate GPCR C-terminal peptides in a hierarchical manner. Commun Biol. 2025;8:899. doi: 10.1038/s42003-025-08301-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 63.Underwood O., Fritzwanker S., Glenn J., et al. Key phosphorylation sites for robust β-arrestin2 binding at the MOR revisited. Commun Biol. 2024;7(1):933. doi: 10.1038/s42003-024-06571-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Supplementary Materials
Data Availability Statement
The authors declare that all data supporting the findings of this study are available within the paper and its supplemental data.
