Skip to main content
BMC Evolutionary Biology logoLink to BMC Evolutionary Biology
. 2008 Apr 30;8:127. doi: 10.1186/1471-2148-8-127

Gene Structure Evolution of the Na+-Ca2+ Exchanger (NCX) Family

Caly On 1,2,3,#, Christian R Marshall 1,2,5,#, Nansheng Chen 2, Christopher D Moyes 4, Glen F Tibbits 1,2,3,✉
PMCID: PMC2408596  PMID: 18447948

Abstract

Background

The Na+-Ca2+ exchanger (NCX) is an important regulator of cytosolic Ca2+ levels. Many of its structural features are highly conserved across a wide range of species. Invertebrates have a single NCX gene, whereas vertebrate species have multiple NCX genes as a result of at least two duplication events. To examine the molecular evolution of NCX genes and understand the role of duplicated genes in the evolution of the vertebrate NCX gene family, we carried out phylogenetic analyses of NCX genes and compared NCX gene structures from sequenced genomes and individual clones.

Results

A single NCX in invertebrates and the protochordate Ciona, and the presence of at least four NCX genes in the genomes of teleosts, an amphibian, and a reptile suggest that a four member gene family arose in a basal vertebrate. Extensive examination of mammalian and avian genomes and synteny analysis argue that NCX4 may be lost in these lineages. Duplicates for NCX1, NCX2, and NCX4 were found in all sequenced teleost genomes. The presence of seven genes encoding NCX homologs may provide teleosts with the functional specialization analogous to the alternate splicing strategy seen with the three NCX mammalian homologs.

Conclusion

We have demonstrated that NCX4 is present in teleost, amphibian and reptilian species but has been secondarily and independently lost in mammals and birds. Comparative studies on conserved vertebrate homologs have provided a possible evolutionary route taken by gene duplicates subfunctionalization by minimizing homolog number.

Background

The Na+-Ca2+ exchanger (NCX) is an integral membrane protein belonging to the Ca2+/cation: antiporter (CaCA) superfamily of protein transporters [1]. Catalyzing the reversible counter-transport of three Na+ for one Ca2+, NCX plays a major role in maintaining Ca2+ homeostasis in many tissue types [2] although its role is best understood in the heart [3]. In cardiomyocytes, the exchanger extrudes Ca2+ from the cytosol thereby allowing relaxation to occur but it may also function in Ca2+ influx mode under certain physiological conditions, thereby contributing to cardiomyocyte contraction [4]. There is growing body of evidence that the role of NCX in cardiac excitation-contraction coupling differs with developmental and physiological states as well as between species. In the adult mammalian heart, NCX expression levels increase during heart failure and arrhythmias as an intrinsic mechanism of cardiac functional compensation, though with potentially negative side-effects [5]. The expression of NCX in cardiomyocytes is elevated in neonates, suggesting a greater role for the exchanger in early developmental stages [6]. NCX expression also differs among species. For example, NCX expression in teleosts fish cardiomyocytes appears higher than other vertebrates [7]. Interpretation of expression dynamics in physiological, developmental and evolutionary comparisons is complicated by the diversity in NCX homologs arising from both splice variants and gene/genome duplications.

NCX is expressed in virtually all tissues across a phylogenetically diverse group of species. Invertebrates appear to express a single NCX ortholog based upon analyses in arthropods (fruitfly [8]) and molluscs (squid [9]). The analysis of vertebrate NCX homologs has focused mainly on mammals. To date, three NCX genes (NCX1, NCX2 and NCX3) have been cloned and functionally characterized from several mammals including mouse [10], rabbit [11], guinea pig [12] and dog [13]. NCX1 is expressed ubiquitously [14], whereas NCX2 [15] and NCX3 [16] are found exclusively in the brain and skeletal muscle. Expression levels generally correlate with the perceived importance of transmembrane Ca2+ flux in a particular cell type (i.e., high in cardiac, neuronal, and kidney tissue but relatively low in liver tissue). An NCX1 homolog has been cloned and characterized in several teleosts including trout [17], tilapia [18], and zebrafish [19]. We recently discovered a NCX gene (NCX4) that has been found only in fish species [20]. Although it has been shown to play a critical role in zebrafish cardiovascular development [21], its functionality and transport phenotype are not known.

The protein products of mammalian NCX paralogs range in size from ~800 – 990 residues and show an overall identity of ~66%. Identity is especially high in the N- and C-terminal transmembrane (TM) domains, consisting of 5 and 4 transmembrane segments (TMS), respectively [22,23]. Within each domain, the α-repeats have been suggested to be involved in ion translocation. A large (~550 residues) intracellular loop, which separates the TM domains, contains components important for NCX regulation, such as exchange inactivation by the XIP site and Ca2+ binding by the Ca2+ binding domains (CBDs). The C-terminal portion of the loop of NCX1 is subject to extensive alternative splicing in which differential combinations of six exons (A, B, C, D, E and F) produce five well-documented and abundant splice variants expressed in a tissue-specific fashion, although other variants may be expressed at low levels in certain tissues out of a total of thirty-two possible splice variant exon combinations [24]. The physiological significance of NCX alternative splicing remains controversial. Schulze et al. [25] observed distinct voltage dependences between NCX1.1 versus NCX1.3 isoforms whereas Dyck et al. [26] and Hurtado et al. [27] identified differences between isoforms in Na+-dependent inactivation induced by an increase in intracellular Ca2+. Therefore a comprehensive evolutionary analysis of NCX alternative splicing is needed.

The origin of many vertebrate gene families can be attributed to whole genome duplications (WGD) early in vertebrate evolution [28]. Superimposed on these genomic events are gene and segmental duplications. The relative importance of these genomic and gene duplications in diversity of NCX paralogs is not yet established. Reports of three NCX paralogs in mammals are consistent with two rounds of WGD, followed by loss of one paralog. NCX4 has been suggested to be a product of gene/genome duplication after teleost divergence from tetrapods [20]. However, the lack of sequence information from a breadth of vertebrates has made it difficult to determine the origin of the vertebrate paralogs. Of particular interest is the origin of the NCX4 paralog, which to this point had not been identified in species other than teleosts.

In the current study we build on previous work and present a clearer picture of NCX molecular evolution. In addition to protein sequence analysis, closer examination of NCX gene structure provides insight into the evolutionary origins of the NCX gene family. Since the TMS and specific motifs within the regulatory loop are well conserved among species, examination of the exon-intron boundaries, gene length, intron density, and alternative splice variation provide opportunities for distinctions between possible evolutionary trajectories. Through a combination of existing [20] and newly found NCX genomic sequences, a more complete phylogenetic tree can be drawn leading to a new hypothesis of NCX gene evolution. These data are consistent with the 1R/2R/3R hypotheses for WGD, generating four NCX paralogs in basal vertebrates, and additional paralogs in teleosts. One of these genes, NCX4, is present in the genomes of teleost, amphibian and reptilian organisms but has likely been secondarily and independently lost in the mammalian and avian lineages. In addition, certain features of the NCX genes have been identified to differ among orthologs and paralogs.

Results and Discussion

As for most genes, the vast amount of NCX genomic data and the speed with which it is expanding far surpasses the availability of cloned and phenotyped NCX cDNAs. In this study, therefore, we exploit this by making use of bioinformatics tools to search for NCX sequences in all of the genomes currently available including those from the Ensembl browser. Most sequences used in this article are complete but sequences with > 10% of the amino acids missing were not used for phylogenetic analyses. NCX searches were performed in genomes from invertebrates and vertebrates, augmented by individual clones from select species (see Table 1).

Table 1.

Eukaryote NCX Homologs List

Scientific Name Common Name NCX
Mammals

Bos taurus cow 1*,2,3*
Canis familiaris dog 1*,2*,3*
Cavia porcellus guinea pig 1*,2*,3*
Felis catus cat 1*
Homo sapiens human 1*,2*,3*
Macaca mulatta macaque 1*,2*,3*
Monodelphis domestica opossum 1*,2,3*
Mus musculus mouse 1,2*,3*
Ornithorhynchus anatinus platypus 1*
Oryctolagus cuniculus rabbit 1*
Pan troglodytes chimpanzee 1*,2*,3*
Rattus norvegicus rat 1*,2*,3*
Spermophilus tridecemlineatus squirrel 1,3

Aves and Reptiles

Gallus gallus chicken 1*,3
Anolis carolinensis green anole 1,2,3,4

Amphibians and Fish

Xenopus laevis clawed frog 1,2,3,4
Danio rerio zebrafish 1a*,1b*,2a,2b,3,4a*,4b
Gasterosteus aculeatus stickleback 1b,2a,2b,3,4a,4b
Oncorhynchus mykiss rainbow trout 1b*
Oreochromis mossambicus tilapia 1b*
Oryzias latipes medaka 1a,1b,2a,2b,3,4a,4b
Takifugu rubripes fugu 1a,1b,2a,2b,3,4a,4b
Tetraodon nigroviridis green pufferfish 1a,1b,2a,2b,3,4a,4b
Squalus acanthias spiny dogfish 1

Protochordates and Invertebrates

Ciona intestinalis sea squirt 1
Ciona savignyi sea squirt 1
Aedes aegypti mosquito 1
Anopheles gambiae mosquito 1
Apis mellifera honeybee 1*
Caenorhabditis briggsae roundworm 1*,2*
Caenorhabditis elegans roundworm 1*,2*
Drosophila melanogaster fruitfly 1*
Loligo opalescens squid 1*
Strongylocentrotus purpuratus sea urchin 1*

* Represents complete transcripts available in GenBank. a and b represent teleost NCX duplicates

Gene families in animals arise through gene duplications, but amongst vertebrates the defining events are a series of WGD. Within the chordate lineage, the first WGD (1R) occurred early in vertebrate evolution, around the time of the divergence of the lamprey and hagfish lineages, though the exact timing is not yet clear. A second WGD (2R) occurred prior to the divergence of chondrichthians and osteichthians. Thus, many genes present as single copies in protochordates occur as four copies in chondrichthians and osteichthians, including the sarcopterygian lineage that gave rise to tetrapods. Within the osteichthian lineage, a third WGD (3R) occurred prior to the emergence of teleosts. Thus, an actinopterygian ancestor basal to most teleost fish (including pufferfish, zebrafish, sticklebacks, and medaka) likely possessed four copies of each gene. Additional WGDs occurred more recently in specific vertebrate lineages, such as salmonids [28]. In many cases, gene family sizes in chordates deviate from the predicted 1, 2, 4, or 8 members as a result of duplication or loss of individual genes either before or after WGDs. Based on our analyses, NCX gene radiation in chordates is generally consistent with the 1R/2R/3R hypotheses. However, these studies also call into question the conclusions from previous work that hypothesized about the evolutionary origins and phylogenetic distribution of NCX4 in fish and tetrapods.

Invertebrate NCX diversity

Most invertebrate species such as fruitfly, honeybee and mosquito have only one NCX gene present in their genomes. A few invertebrate genomes contain several genes with some similarity to NCX family motifs, but only one gene found in the genomic sequence appears ancestral to vertebrate NCX genes with at least 40% identity to mammalian NCX protein sequences. Multiple NCX genes found in invertebrate genomes are most similar to each other with no obvious paralog distinction. C. elegans has various putative NCX genes but two [GenBank:C10G8.5, Y113G7A.4] have about 45% identity to vertebrate NCX. Although in Table 1 we label these gene products as C. elegans1 and C. elegans2 (according to NCBI annotation), it should be noted that this system does not correspond to our annotation for vertebrate NCX paralogs. Other putative NCX ESTs (not listed) demonstrated only 15 – 33% protein identity to mammalian NCX sequences. Similarly, in the sea urchin (Stongylocentrotus purpuratus), three putative NCX genomic sequences were found but only one transcript [GenBank:XM_001184049] displays high identity (~55%) with the vertebrate NCX (others had < 35% identity). Based on the presence/absence of critical motifs, we predict that most of the putative NCX genes found in various invertebrate species lack NCX functionality. We conclude that these genes likely arose from lineage-specific duplications after their divergence from chordates because they have: 1) low sequence identity to vertebrate sequences, 2) a lack of conservation in specific amino acids/motifs critical for Na+/Ca2+ exchange [3] and 3) weak identity with vertebrate homologs.

Chordate NCX genes

To better determine the timing of NCX duplication events, we searched the protochordate sea squirt (Ciona intestinalis) genome for the presence of NCX genes. The distinctive evolutionary position of Ciona as an invertebrate chordate has been suggested to contain an approximation to the ancestral match of non-duplicated chordate genes; hence it may provide insights into vertebrate evolutionary origins [29]. The Ciona NCX genomic sequence is positioned in all of our phylogenetic trees in a manner that provides a clear separation of the invertebrate and vertebrate NCX sequences (Figure 1 and see Additional Files 1 and 2). The presence of a single copy of an NCX gene in Ciona with high percent identity to the various NCX genes found in vertebrates is consistent with previous findings that indicate that the Ciona genome contains every gene that corresponds to a paralogous family in vertebrates for many signalling molecules, transcription factors and channels [29,30]. The Ciona NCX genomic sequence displays ~56% overall identity among vertebrate NCX homologs. Even though other genes annotated as NCX were found in Ciona genome, it is hypothesized that these genes evolved after the divergence of Ciona from other vertebrates as evidenced by their lower sequence identity (~33%) to vertebrate NCX sequences.

Figure 1.

Figure 1

Maximum Likelihood NCX Phylogenetic Tree. The ML phylogenetic tree was generated with the PHYML program with 500 replicates using all known and postulated NCX protein sequences. Pirellula bacterial strain (Rhodopirellula baltica) was used to root this tree. The five-point stars (Inline graphic) indicate NCX duplication after Ciona intestinalis divergence and the four-point stars (Inline graphic) indicate teleost-specific NCX duplication. Branches are colour coded for vertebrate species, in which red designates mammals, purple indicates birds/aves, teal branches are for reptiles, green are amphibians, and blue are teleosts/fish. The dashed branch (---) indicates the division between invertebrate and vertebrate NCX sequences. The asterisk (*) indicates complete transcripts and those without an asterisk are genomic sequences. The letters 'a' and 'b' correspond to the teleost duplicate versions of NCX1, NCX2 and NCX4. Underlined species are new NCX sequences added in comparison to a previous paper [20].

Very little useful NCX sequence data are available in cyclostomes (lamprey and hagfish) and chondrichthians. In the lamprey (Petromyzon marinus), three partial NCX sequences exhibit a high protein sequence identity to NCX paralogs with a wide range (51 – 82%) of identity. One shares high sequence identity with NCX1, another with NCX4 and the third with both NCX2 and NCX3. However, the limited data prevent definitive assignment as specific NCX orthologs and thus the nature of the cyclostome NCX gene family remains unclear. The first extant group to branch from the vertebrate lineage after the 2R WGD is the chondrichthians. Unfortunately, sequence available at this time from the elephant shark (Callorynchus milli) was not useful; we found only partial NCX genomic sequences with large gaps [31]. However, there is a spiny dogfish (S. acanthias) clone that corresponds to NCX1 [GenBank:DQ068478].

Analysis of NCX gene family members in osteichthians and tetrapods is, for the most part, consistent with the 1R/2R/3R hypotheses. The NJ phylogenetic tree shown in Figure 1s supports the notion that the duplication events giving rise to NCX paralogs in vertebrates occurred after the divergence of the urochordates, which is estimated to be 520 mya [32]. Therefore, from the existence of one NCX gene in invertebrates, duplication events brought about four NCX paralogs in basal vertebrates. Hence, the finding of one NCX gene in Ciona's genome and its positioning in the phylogenetic tree dividing vertebrate from invertebrate branches correlates with previous evolutionary studies [20]. The structures of the Maximum Likelihood (ML) (Figure 1) and Maximum Parsimony (MP) (see Additional File 1) phylogenetic trees indicate two parallel duplications (Figure 2B), which matches the theory of dual genome duplication (2R) which is postulated to have occurred early in the vertebrate lineage [33]. These analyses are consistent with double genome duplication, as observed in the ML/MP phylogenetic trees which show a symmetric topology resulting in four orthologs. However, the phylogenetic tree generated using the Neighbour Joining (NJ) algorithm (see Additional File 2) is consistent with serial NCX duplication (Figure 2A). The serial duplication could also be the result of two genome duplications followed by independent gene duplication and loss [34]. However, the bulk of the evidence supports the hypothesis that four NCX genes would be expected due to the 2R WGD. Thus, remaining questions concern (1) the anomalous NCX4 pattern within tetrapods and (2) the diversification of NCX genes in teleosts subsequent to the 3R WGD.

Figure 2.

Figure 2

Summaries of Phylogeny Trees. Non-scaled, simplified representations of NCX evolution, rooted with a bacterial sequence is demonstrated with two manners of duplication: A. serial (Neighbour Joining) and B. parallel (Maximum Parsimony) duplication.

Evolutionary history of NCX4 genes

Previous studies found a fourth vertebrate NCX (NCX4) in genomes of fugu, tetraodon and zebrafish [20]. In zebrafish, the predicted sequence of NCX4 on chromosome 7 shows high level of nucleotide identity (> 98%) with two ESTs [GenBank:BQ263135 and BI875890] and a cDNA [GenBank:EF470289[21]]. Likewise, the predicted NCX4 sequence in stickleback is identical to an EST encoding the NCX4 start coding region up to the XIP site [GenBank:DT993818] and an EST that contains 876 nucleotides from the alternative splice site to the partial last exon [GenBank:DT978254]. There are also two partial sequences from rainbow trout that are similar to fish NCX4 orthologs (85–92% identity), including an N-terminal region and a C-terminal comprising 159 amino acids (478 bp) [35]. In this study in which more teleost genomes were available for examination, NCX4 orthologs were found in green puffer fish, medaka, and stickleback. Although the best evidence to date is that NCX4 occurs widely within teleost fish, its function remains uncertain. Knockdown studies with zebrafish NCX4 suggest it is important during development, playing a role in left-right patterning [21].

Previous studies suggested that NCX4 occurred in teleosts but not tetrapods [20]. Thus, it appeared most likely that teleost NCX4 was a product of either the 3R WGD, or a duplication of NCX1 in a basal actinopterygian [20]. When the X. tropicalis genome was searched using the Ensembl browser (v31), NCX tBLASTn searches identified only three scaffolds with sequences with the highest identity to NCX. The NCX genomic sequences found in scaffolds 684, 572, and 218 were tentatively identified as NCX1, 2 and 3, respectively. However, a second search in a later Ensembl version (v32) revealed a fourth NCX sequence in scaffold 41. We recognized that NCX1 is actually located in scaffold 41 while scaffold 684 contains NCX4 based on protein sequence alignment (see Additional File 3). Furthermore, the genome of a lizard (Anolis carolinensis) also possesses four complete NCX genomic sequences, orthologous to the four sequences found in amphibian and teleosts. The presence of NCX4 in these tetrapod genomes argues that NCX4 arose during the 2R WGD, rather than in a teleost-specific gene or genome duplication (3R), as previously proposed [20]. With clear evidence of NCX4 in basal vertebrates, the apparent absence of the gene in birds and mammals demanded further investigation.

After extensive searches in all available mammalian genomes for the NCX4 gene, it was concluded that this gene is not present. For verification, the Evolutionary Conserved Regions (ECR) Browser [36] was used to find syntenic links among the teleost and amphibian NCX4 loci with mammalian counterparts. Syntenic alignments were consistent among the teleost and amphibian NCX4 surrounding genes, but high syntenic alignment with the mammalian genomic DNA confirmed that NCX4 was completely eliminated in mammals (Figure 3). Mammals arose from the synapsid reptiles very early in reptilian evolutionary history. Thus, the presence of NCX4 in a derived reptile (anole) but not mammals suggests that the mammalian homolog was lost in the synapsid reptilian ancestors of mammals, in cynodonts, or in a basal mammal. Note that no evidence of NCX4 is found in any mammals studied, including monotremes.

Figure 3.

Figure 3

Synteny Alignment Diagram at NCX4 Loci. Synteny diagram among zebrafish, fugu, frog, tetraodon and human. NCX4 (a or b) gene is represented as a circle and all other surrounding genes are represented as ovals and orthologs are associated with a line.

We also failed to find evidence of NCX4 orthologs in birds. In our search for NCX genes in the available chicken genome (Ensembl v34), only NCX1 and NCX3 genomic sequences were found in their entirety. Synteny analysis of the complete chicken NCX and neighbouring genes confirmed their identity as NCX1 (on chromosome 3) and NCX3 (on chromosome 5). Partial high identity NCX exons were found in three separate unidentified chromosomes. Synteny analysis for the partial chicken NCX genes located in an unknown chromosome resulted in alignment with segments corresponding to NCX2 genes in other organisms. However, the other partial segments of chicken NCX gene resulted in insignificant synteny alignments probably due to the extensive sequence gaps. Therefore, the result is still inconclusive and refinement of the chicken genome will be required to confirm the presence or absence of NCX4 in avian species. If NCX4 was lost in birds (as in mammals), it must have occurred after the split between lepidosauromorphs (lizards and snakes) and archosauromorphs (crocodiles and bird ancestors). Establishing the exact timing of the NCX4 loss would benefit from analysis of a crocodilian genome.

Gene and genome duplication has long been recognized as an important factor in the evolution of the complexity of organismal function and species diversity. The first two vertebrate WGDs provided species with four sets of homologous genes upon which evolutionary processes could act. In many cases, one or more gene became redundant and was/were lost early in lineages, leading to gene families of three or fewer members in tetrapods. The distribution of NCX4 in vertebrates is unusual in many respects. First, all four family members were preserved throughout much of vertebrate evolution. NCX is vital in the excitation-contraction coupling in cardiomyocytes. Physiologically, Na+/Ca2+ exchangers may differ in electrochemical sensitivity, tissue localization and physiological phenotype. Small differences among each NCX could provide specific needs to different tissues to species that are constantly exposed to fast changing and extreme environments. Thus the preservation of all four family members in most vertebrates would argue that selection acted to preserve the distinct homologs. Thus, the loss of NCX4 in mammals, and possibly in birds, might suggest a loss of potential for functional specialization. This is surprising because birds and mammals share the traits of endothermy and high metabolic rate, traits where elevated rates of ion transport occur, particularly in excitable tissues. Further studies of NCX4 expression and tissue specificity would aid in understanding the retention of this gene in teleost, amphibian, and reptile genomes, as well as the independent losses in birds and mammals.

3R Whole Genome Duplication (WGD) and teleost NCX

Superimposed on diversity in NCX genes as a result of the 2R WGD is the appearance of additional NCX genes in fish, likely as a result of the 3R WGD in teleosts [37]. When we searched for other putative NCX paralogs in fish, duplicates were found for all NCX genes except for NCX3, bringing the number of potential NCX genes in teleost species to seven overall (Figure 1, Figure 4 and Figure 5). Each duplicate pair shows high conservation patterns in known TMS, functional regions including α-1 and α-2 repeats, XIP site, Ca2+ binding sites, and exon-intron boundaries.

Figure 4.

Figure 4

Sample Species of NCX Homologs Exon Splicing Pattern. Three sample organisms for mammalian (Homo sapiens), reptilian (Anolis carolinensis), amphibian (Xenopus tropicalis) and teleost (Danio rerio) are shown aligned at exon A (blue)/B (orange). Light blue rectangles belong to NCX N-terminus before the alternative spliced exons and yellow rectangles represent the C-terminus after the alternative spliced region. Cassette exons (C-F) are indicated in light green, purple, red and dark green where it is applicable and respectively. Distances between exons are scaled as indicated on the legend but not the length of the exons.

Figure 5.

Figure 5

NCX Gene Homologs and Localization. Teleost, amphibian and aves list of NCX genes and localization with scaled distances in between exons. Open rectangles represent the exons at the N-terminus located before the alternative spliced exons and the dashed rectangles represent the exons after the alternative spliced exons at the C-terminus. Alternative exons A (black), B (light grey) and the rest of the cassette exons (dark grey) are shown where it is applicable. NCX duplicate genes are separated with NCXa and NCXb at the top and bottom of the list, respectively.

It is not yet known if the duplicated genes have diverged sufficiently to acquire distinct functions. Langenbacher et al. [19] found that the two NCX1 genes in the zebrafish demonstrated distinct tissue specificities and effects. They named the NCX1 gene duplicates based on their localization in the developing embryo. NCX1n was predominantly expressed in the brain and neural tube whereas NCX1h was expressed in heart and played a role in its rhythmic contraction. An NCX1h knockout causes cardiac fibrillation. In this report, we redefined the distinction between teleost NCX duplicate sequences in which "a" is added to the sequences with the highest identity with mammalian NCX homologs and "b" to the most distant. Based upon sequence homologies, NCX1n corresponds to NCX1a, whereas NCXh is NCX1b.

Our previous studies on the function of NCX homologs focused on trout because of its importance as a model in physiological studies. However, salmonids experienced a lineage-specific WGD [28], and thus there is potential to have duplicates of genes that were duplicated as a result of the 3R WGD. We have cloned and characterized a rainbow trout NCX1 that appears most similar to NCX1b of other teleosts (see Figure 1). There are ESTs from the rainbow trout in Genbank that are tentatively identified as NCX1 [GenBank: CX255655, CX255654], but the protein sequence has too low identity (71%) to correspond to our NCX1b. However, this EST still has the highest percentage alignment with NCX1 genes in comparison to the other three paralogs from other species. It remains to be established if this EST is NCX1a or a salmonid duplicated and diverged NCX1b variant.

Organization of NCX genes: central variable segment

In addition to using sequence similarities, we examined NCX gene structure (number of exons, intron density range, gene length) to further define the evolution of the NCX gene family. All vertebrate NCX genes possess similarities in exon structure in both N-terminal and C-terminal regions, and a central segment of the gene that varies more widely among homologs.

In mammalian paralogs, the central variable segment (involved in alternative splicing) of NCX genes consists of as many as six exons; NCX1 possesses all six exons, whereas NCX2 possesses two (BC), and NCX3 four (ABCE). Superimposed on the variation in the genetic organization is alternative utilization of the exons in the formation of splice variants, which are thought to be important in conferring tissue-specific functional differences in NCX. When comparing the variable central segment of vertebrate paralogs, all NCX genes possess at least one exon that is homologous to either exon A or exon B. Indeed, exons A and B have considerable sequence homology (e.g. a central acidic region), suggesting that they arose through a duplication event early in vertebrate evolution. Based on the sequence similarity (i.e., the maximum likelihood tree), the first WGD event gave rise to the common ancestor of NCX1 and NCX4 and the common ancestor of NCX2 and NCX3 (Figure 1). Since both exons (A and B) occur in both mammalian NCX1 and NCX3 (Table 2), it is likely that the regions were duplicated in a basal vertebrate prior to the 2R WGD. Furthermore, since both exon A and exon B are present in the mammalian, amphibian, reptilian and teleost orthologs of NCX1, it argues against a more limited duplication of this segment in selected lineages. In mammals (where it is best studied), splice variants of transcripts possess either exon A or exon B, but not both. The significance of the mutual exclusivity of exon A and B to construct NCX is not known, although in general exon A appears in excitable cells such as cardiomyocytes and exon B is expressed in non-excitable cells such as kidney [25].

Table 2.

General Sequence of Alternative Splice Exons from all NCX Homologs

Species NCX A B C D E F
Teleost 4all KLLNVKIIDDEEYEKNKTFTIVLEEPILLEVGQKH
Amphibian 4 RFIEIQVIDDEEYEKNKNFYVELGEPEMQRSGKKS
Reptile 4 KYIEIKIIDDEEYEKNKNFHLELGPPVLLDTGPRH

Teleost 2all QSFQVRIIDDEEYEKHENFFIVLEEPRWLKRGIS ALLLNQE
Amphibian 2 KTLQVKIVDDEEYEKQENFFIILEEPRWMKRGIS ALLLNQG
Reptile 2 KSLYVKIIDVEEYEKKDSFFIELGQPRWLKRGIS ALLLNQD
Mammals 2 KTLQVKIVDDEEYEKKDNFFIELGQPQWLKRGIS ALLLNQG

Teleost 3 KFIHVKIIDDEEYEKNKNFFLELAEPRMVDMSLQK
Amphibian 3 KTIQIKIFDDEEYEKNKTFFIELREPHLVDLSVQK KTIRVKIIDEEEYERQESFFIALGEPKWMKRGIS ALLLNQG
Reptile 3 KTVHIKVIDDEEYEKNKTFFIELMPPRMVDMSLHK KTIRVKIVDEEEYERQENFFIALGEPKWMERGIS AILLNQL
Aves 3 KTIHIKVIDDEEYEKNKSFFIELMSPRMVDMSLQK
Mammals 3 KTIHIKVIDDEAYEKNKNYFIEMMGPRMVDMSFQK KTIRVKIVDEEEYERQENFFIALGEPKWMERGIS ALLLSPG GKTSY

Teleost 1 KTIQINIIDDEEYEKNKNFFLEIGEPQLLEMSERK KTIKVKILDHEEYDKHANFFIELQEPEWRRRGWT
Amphibian 1 KIISVKIIDDEEYEKNKTFFLEVGEPRLVEMSEKK KCITLKILDREEYDKESNFFLVLQEPIWIRRGMK ALLLNEL GDFTIT GKILY GKPVLRKVQVRDHPIPSTVIILT
Reptile 1 KTISIKVIDDEEYEKNKTFYIEIGEPRLVEMSEKK KSITLRILDREEYEKECNFYLVLEEPIWIRRRTK ALLLNEL GGFTIT GKPVYRKVHARDHPFPSTVINIQ
Aves 1 KTISIKVIDDEEYEKNKTFYLEIGEPRLVEMSEKK KFITLRILDREEYEKECSFFLVLGDPVWLRRGVK ALLLNEL GGFTIT GKLWK GKPVFRKVQARERPLPCTVVTIR
Mammals 1 KTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKK KIITIRIFDREEYEKECSFSLVLEEPKWIRRGMK ALLLNEL GGFTIT GKYLF GQPVFRKVHAREHPILSTVITIA

Teleost exceptions
Pufferfish 1d KTIQVNIIDDEEYEKNKNFFIELGDPRLLEMSERK ARLLQEV GRDMYRKVQEWHPSAAMINIPGM
Medaka 1d KTIRINIIDDEEYEKNKNFFLEMGEPLLLEMSERK KTIALRIMDREEYDKKASFCVELQEPFWNSRWTG AVLLQEV
Green pufferfish 1d KSLHIRIVDDGEFGQDKNFLLELGEPRLLDPSQS DRDVYRKLQGWNLPDAVINITGM
Trout 1d KSIQINIIDDEEYEKNKNFFLEMGEPQLLEMSERK AVLLQEI GGFVKT GRDVYRKVQGRDNPVPATIISLA
Tilapia 1d KTIRINIIDDEEYEKNKNFFLEIGEPRLLEMSERK AVLLQEV GGFVKT GRDIYRKVQGREHPVPSNIISIA
Dogfish 1 KTIEIKVIDDEEYEKNKNFFIEIGEPRLVEMSEKK ALLLNEL GPFTKT AKYFN GHAIYRKVHFRDNPIPSTVICIA
Zebrafish 1d KTIQINIIDDEEYEKNKNFFLEIGEPQLVEMSERK AMLLHEC GGFVKT DKQLY GRDVYRKVQGRDKPIPSTIISIS
Stickleback 1d KTIQINIIDDEEYEKNKNFFLEIGEPQLLEMSERK KTIAVRVIDRDEYDKQASFYIELQEPYRNQRRWT AVLLQEV GGFVKT GRDVYRKVQGRDHPAPSAVISIT

The phylogenetic distribution of the remaining exons (C, D, E, and F) is much more variable, though there is a general conservation in the number of exons in the central variable segment of NCX orthologs (Table 2). For example, NCX4 from teleosts, amphibians, and reptiles possess only exon A; NCX2 from fish, amphibians, reptiles, and mammals possess only exons B and C. The exon collection for NCX3 orthologs is more variable, with a single exon (A) in teleosts and birds, and additional exons in amphibians and reptiles (ABC) and mammals (ABCE). Exons D and F are present only in NCX1 orthologs, but they occur in all vertebrates, suggesting these exons arose in the ancestral NCX1 gene shortly after the appearance of the four member gene family.

In general, alternative splicing of exons is an important mechanism to create variation from a single gene. Alternative splicing of exons in the central variable region of NCX genes is employed to different extents among paralogs and orthologs. No splice variants are possible for NCX4 where only a single alternative splicing exon occurs (Table 2). There are only two exons in this region of NCX2 (BC) and no splice variants have been detected in mammals [24]. In the case of NCX3, teleosts possess only a single alternative splicing exon, but mammals possess 4 exons (ABDE) and demonstrate multiple splice variants [24]. There is some evidence of alternative splicing for teleost variants of NCX1. For example, a cloned rainbow trout NCX1b cDNA identified as TR-NCX1.0 [17] possessed sequence corresponding to exons ACDF, but a second clone (TR-NCX1.1) also contained exon E (unpublished). While it remains possible that alternatively spliced variants of teleost NCX1 have simply escaped detection, it appears that splice variants of NCX1 are uncommon in fish. This is in contrast to the situation that appears to be seen in mammals, in which splice variants of NCX1 are common [24]. Thus, in the case of both NCX1 and NCX3, splice variants are much more common in mammals than in fish homologs. In the case of NCX1, this difference may be related to the duplicate copies of NCX 1, however in the case of NCX3, fish did not retain the duplicated NCX3 gene [38].

Organization of NCX genes: N-terminus

Outside of the central variable segment, vertebrate NCX paralogs are more highly conserved. It has been reported that exon boundaries of NCX1 and NCX3 are identical, each with 5 exons (1 N-terminal, 4 C-terminal) [39]. When comparing across vertebrates, the organization of the C-terminal exons is highly conserved, with 4 exons in all NCX genes. In contrast, the N-terminus is more variable, and potentially useful for assessing the evolution of the NCX family. Amongst the tetrapods, the predominate pattern is a single N-terminal exon. This is seen in NCX1 and NCX3 of mammals (though NCX2 has 3 exons), and all four NCX genes in amphibians (Figure 4). In contrast to the conservation seen in tetrapods, the pattern seen in teleosts in much more variable. Although the N terminus of NCX1b and NCX3 possess a single exon, NCX1a and NCX4a have 1–3 exons, NCX2a has 4 to 8 exons, and NCX4b has 3 to 10 exons. Danio NCX homologs generally have fewer exons in the N-terminus than do the other teleost NCX sequences (Figure 4 and Figure 5).

Based on these limited analyses, it is difficult to determine the factors that drive the variation in N-terminal gene structure in fish. The conservation seen in the gene organization of NCX3 is unusual, with a ubiquitous single N-terminal exon seen across fish, or for that matter, across vertebrates. It is also the only member of the NCX gene family that lacks a duplicate version in fish. In contrast, the three members that were duplicated in fish each demonstrate variation among orthologs and duplicates. Thus, it appears that the 3R duplication of ancestral genes (each with single N-terminal exons) created a tolerance for genetic rearrangements in this region of the NCX genes in the resultant duplicates.

Organization of NCX genes: gene lengths and intron density

Without accounting for the 5' and 3' untranslated regions (which are mostly unknown), mammalian and reptilian NCX1 and NCX3 genes average 290 and 135 kb in length in their genomes, respectively, and represent the longest NCX genes across species while mammalian NCX2 average 30 kb. However, the teleost, amphibian and reptilian genes exhibit the same length patterns but on a smaller scale as expected due to their smaller genome size in comparison to mammalian genomes. A notable exception to this is that of the lizard with a ~94 kb long NCX2. The teleost and amphibian NCX2 gene duplicates, which are not much smaller than the mammalian homolog, average 22 kb close to the NCX4a gene and NCX4b at 30 kb. However the avian, amphibian and teleost NCX1 and NCX3 are greatly reduced in length in comparison to mammalian versions averaging 103 and 65 kb, respectively. Only NCX1b demonstrates a shorter gene length pattern in comparison to NCX1a across teleost species with an average of 10 kb. Invertebrate NCX gene lengths ranged from 7 to 90 kb.

To quantify the evolution of introns, the intron density equation (number of introns per kb of coding sequence) was used to measure the number of introns per NCX gene [40]. As shown in Table 3, all teleost NCX2 exhibit 2 – 4 introns per kb and NCX4 has 2 – 5 introns per kb and all species demonstrate a wide range in intron density. Meanwhile, intron density among all mammals, bird, amphibian, reptile and zebrafish NCX1a maintain a consistent value of 1 intron per kb and the rest of the teleost NCX1a intron density is consistent at 2 – 3 introns per kb. Also, NCX3 gene intron density is preserved among all species at 1 intron per kb. As for the frog, lizard and chicken, all known NCX genes within these species contain an average of 1 intron per kb.

Table 3.

NCX Intron Density

Organism NCX1a NCX1b NCX2a NCX2b NCX3 NCX4a NCX4b
H. sapiens 1.32 2.17 1.38
C. familiaris 1.36 2.67 1.38
M. musculus 1.33 2.53 1.38
R. novergicus 1.33 2.17 1.38
G. gallus 1.30 1.44
A. carolinensis 1.44 1.40 1.37 1.00
X. tropicalis 1.33 1.56 1.39 1.48
D. rerio 1.36 3.10 3.14 1.42 1.77 2.16
T. nigroviiridis 2.82 1.66 3.42 1.45 2.15 4.66
T. rubripes 2.72 1.55 3.86 3.32 1.45 1.81 4.76
O. latipes 2.84 1.40 3.75 3.35 1.45 1.76 4.43
G. aculaeatus 1.45 4.12 3.33 1.45 1.76 4.35

* Units = introns per kb of coding sequence (10-6)

(a) or (b) applicable for teleost only

The results from both NCX gene lengths and intron density demonstrate a correlation of similarities of NCX2 with NCX4 that differentiate them from NCX1 and NCX3. Exon-intron boundary and intron density high variations could indicate that NCX2 and NCX4 are genes with a higher rate of mutation in comparison to NCX1 and NCX3, which are more conserved and consistent. Gene length comparisons showed more compactness in NCX2 and NCX4, similar to sea squirt and most invertebrate NCX genes. These differences noted in NCX gene structure may shed light about their adaptation and evolutionary patterns.

Conclusion

Rapid growth in the number of sequenced genomes has made it possible to identify a large number of NCX genes in many species. Although most NCX expression and function has been characterized from mammalian organisms, NCX gene presence and conservation is seen among a great variety of animal sequenced genomes. NCX presence in all species' sequenced genomes has allowed the construction of a phylogenetic tree that correlated to animal evolution and revealed that the origin of NCX duplication was initiated at the emergence of vertebrate organisms. From this duplication, at least four paralogs are hypothesized to have resulted and these have been found in teleost, amphibian and reptilian genomes, however we postulate that only three endured in mammalian genomes. Also, duplicate forms of these NCX genes have been found only in teleost genomes that correlate with the isolated genome duplication in ray-finned fish [38].

The presence of the NCX4 gene, found only in teleost, reptile and amphibian genomes, indicates that NCX duplicated at least three times after the tunicates (i.e.: Ciona) and before the emergence of teleosts. The maintenance of NCX4 in teleosts may indicate specific demands significant for efficient and different Na+/Ca2+ exchange in organisms with NCX4. It has been recently demonstrated that NCX4 is expressed in the zebrafish [21] but characterization of its Na+/Ca2+ exchange and tissue localization requires exploration. As for the duplicate NCX genes in teleosts, only one NCX1a from the zebrafish [19] and three NCX1b have been cloned and demonstrated to be functional in cardiac tissue in zebrafish [19], trout [17] and tilapia [18]. Zebrafish is the only teleost in which both NCX1 have been cloned from cardiac (NCX1h/NCX1b) [GenBank:AY934775] and neural tissues (NCX1n/NCX1a) [GenBank:AY934776] [19]. The NCX gene redundancies in teleosts may indicate subfunctionality and substitute usage of alternative splicing exons as seen in mammalian organisms that have only three NCX genes.

When NCX sequences are compared among all species, the main areas of conservation (i.e.: TMS and regulatory sites) can be observed. These phylogeny studies can provide an overall evolution of the NCX gene family. However, with further gene structure analysis, this report pinpoints the N-terminus segment including the central variable segment to be the main part of the protein to adapt to the requirements of environmental changes as organisms evolve. This is seen in our previous reports [41] in which temperature dependence comparisons between a mammalian and rainbow trout NCX1 differ due to sequences differences in the NH2-terminal transmembrane segment.

Materials and Methods

Data Mining of NCX sequences

tBLASTn searches were performed using known NCX protein sequences in available genome sequences in ENSEMBL database. Predicted and mRNA sequences of interest have yielded over 100 candidate genes for NCXs from GenBank, Ensembl, University of California, Santa Cruz Genome browser, and Elephant Shark genome project website [31]. Species names, gene names and location are listed in Table 1. The available genomic sequences of invertebrate and vertebrate species were analyzed to identify homologous NCX sequences. Due to some inaccuracies and missed annotations of NCX genes in Ensembl, the tBLASTn search method was utilized to find/correct predicted exons and complete segmented NCX protein sequences with cloned mammalian NCX protein sequences. Identification of candidate NCX sequences was based on conservation within the 9 TMSs, α-repeats and regulatory sites, originally established by known sequences. Hence, we have been able to categorize and/or complete over 35 NCX protein sequences in 10 different species' genomes.

Targeted databases included: the non-redundant protein and nucleotide databases at NCBI BLAST [42] and the Ensembl Genome Browser v31–v34 and v39 [43] as seen in Table 1. The NCX ESTs (expressed sequenced tags) and clones were obtained from NCBI Nucleotide database [44]. The lizard (Feb.2007) sequences were obtained from the University of California Santa Cruz (UCSC) Genome Browser [45].

Phylogenetic analyses

To understand the origins of the eukaryotic NCX family, we performed a phylogenetic study of all NCX sequences from all species. Multiple sequence alignments and bootstrapped Neighbour-Joining rooted trees were prepared using ClustalX (v. 1.83) [46]; alignments were manually edited with Genedoc to remove the alternative spliced exons and visualized with TreeView32. Bootstrapping was performed (1000 replicates), and most nodes demonstrated high confidence values. PHYLIP-3.63 (.)[47] was used to construct 1000 Maximum Parsimony trees and PHYML online [48] was used to obtain 500 Maximum Likelihood trees and a consensus tree for each algorithm is shown with TreeView32. Protein sequence names were assigned according to species scientific name and NCX homolog number (i.e. = human NCX1 is labelled as H. sapiens1). Incomplete NCX sequences missing over 10% of the total amino acids were not included in the phylogenetic tree although some are listed in Table 1. A related NCX from the bacterium pirellula (Rhodopirellula baltica) was used as the outgroup to root the phylogenetic tree.

Synteny alignment

The Ensembl database and Evolutionarily Conserved Regions (ECR) browser [49] were used to locate syntenic regions among teleost, avian, and mammalian genomes. In the ECR browser, a scaffold section known to contain the NCX4 gene flanked by a minimum of 30,000 base pairs was used to align with all other available genomes to find synteny patterns. The Ensembl database was used to find the predicted orthologs in the genomic regions found in the ECR browser.

List of Abbreviations

Sodium-Calcium exchanger: NCX; Chromosome: Chr; Scaffold: Scf; duplicate: dupl./d; contig: cntg; unknown: unk; basepairs: bp; kilobasepairs: kb.

Supplementary Material

Additional file 1

Figure S1. Maximum Parsimony Phylogenetic Tree. A consensus Maximum Parsimony tree that was obtained with 1000 replicates from the Phylip program.

Click here for file (76.5KB, doc)
Additional file 2

Figure S2. Neighbour-Joining Phylogenetic Tree. A Neighbour-Joining phylogenetic tree that was obtained with 1000 replicates from the ClustalX program.

Click here for file (76KB, doc)
Additional file 3

Figure S3. Teleost, amphibian and reptilian NCX4 amino acid alignments. NCX4 transcript and genomic sequences found in teleost, amphibian and reptilian genomic data have been aligned with ClustalX and viewed with Genedoc.

Click here for file (1.5MB, doc)

Contributor Information

Caly On, Email: con@sfu.ca.

Christian R Marshall, Email: crm@sickkids.ca.

Nansheng Chen, Email: chenn@sfu.ca.

Christopher D Moyes, Email: chris.moyes@queensu.ca.

Glen F Tibbits, Email: tibbits@sfu.ca.

Acknowledgements

The data in relation to the medaka NCX sequences have been provided freely by the National Institute of Genetics and the University of Tokyo for use in this publication only.

This work was supported by a grant from the Natural Sciences and Engineering Research Council (NSERC) of Canada to GFT. CRM was supported by a Ph.D. research trainee scholarship from the Michael Smith Foundation for Health Research (MSFHR). NC is a MSFHR scholar and GFT is the recipient of Tier I Canada Research Chair.

References

  1. Cai X, Lytton J. The cation/Ca2+ exchanger superfamily: phylogenetic analysis and structural implications. Mol Biol Evol. 2004;21(9):1692–1703. doi: 10.1093/molbev/msh177. [DOI] [PubMed] [Google Scholar]
  2. Iwamoto T. Forefront of Na+/Ca2+ exchanger studies: molecular pharmacology of Na+/Ca2+ exchange inhibitors. J Pharmacol Sci. 2004;96(1):27–32. doi: 10.1254/jphs.FMJ04002X6. [DOI] [PubMed] [Google Scholar]
  3. Nicoll DA, Hryshko LV, Matsuoka S, Frank JS, Philipson KD. Mutagenesis studies of the cardiac Na+-Ca2+ exchanger. Ann N Y Acad Sci. 1996;779:86–92. doi: 10.1111/j.1749-6632.1996.tb44772.x. [DOI] [PubMed] [Google Scholar]
  4. Bers DM. Ca2+ influx and sarcoplasmic reticulum Ca2+ release in cardiac muscle activation during postrest recovery. Am J Physiol Heart Circ Physiol. 1985;248(3 Pt 2):H366–H381. doi: 10.1152/ajpheart.1985.248.3.H366. [DOI] [PubMed] [Google Scholar]
  5. Sipido KR, Volders PG, Vos MA, Verdonck F. Altered Na+/Ca2+ exchange activity in cardiac hypertrophy and heart failure: a new target for therapy? Cardiovasc Res. 2002;53(4):782–805. doi: 10.1016/S0008-6363(01)00470-9. [DOI] [PubMed] [Google Scholar]
  6. Huang J, Hove-Madsen L, Tibbits GF. Na+/Ca2+ exchange activity in neonatal rabbit ventricular myocytes. Am J Physiol Cell Physiol. 2005;288(1):C195–203. doi: 10.1152/ajpcell.00183.2004. [DOI] [PubMed] [Google Scholar]
  7. Hove-Madsen L, Llach A, Tibbits GF, Tort L. Triggering of sarcoplasmic reticulum Ca2+ release and contraction by reverse mode Na+/Ca2+ exchange in trout atrial myocytes. Am J Physiol Regul Integr Comp Physiol. 2003;284(5):R1330–9. doi: 10.1152/ajpregu.00404.2002. [DOI] [PubMed] [Google Scholar]
  8. Dyck C, Maxwell K, Buchko J, Trac M, Omelchenko A, Hnatowich M, Hryshko LV. Structure-function analysis of CALX1.1, a Na+-Ca2+ exchanger from Drosophila. Mutagenesis of ionic regulatory sites. J Biol Chem. 1998;273(21):12981–12987. doi: 10.1074/jbc.273.21.12981. [DOI] [PubMed] [Google Scholar]
  9. He Z, Tong Q, Quednau BD, Philipson KD, Hilgemann DW. Cloning, expression, and characterization of the squid Na+-Ca2+ exchanger (NCX-SQ1) J Gen Physiol. 1998;111(6):857–873. doi: 10.1085/jgp.111.6.857. [DOI] [PMC free article] [PubMed] [Google Scholar]
  10. Conway SJ, Kruzynska-Frejtag A, Wang J, Rogers R, Kneer PL, Chen H, Creazzo T, Menick DR, Koushik SV. Role of sodium-calcium exchanger (NCX1) in embryonic heart development: a transgenic rescue? Ann N Y Acad Sci. 2002;976:268–281. doi: 10.1111/j.1749-6632.2002.tb04749.x. [DOI] [PubMed] [Google Scholar]
  11. Armoundas AA, Rose J, Aggarwal R, Stuyvers BD, O'Rourke B, Kass DA, Marban E, Shorofsky SR, Tomaselli GF, William Balke C. Cellular and molecular determinants of altered Ca2+ handling in the failing rabbit heart: primary defects in SR Ca2+ uptake and release mechanisms. Am J Physiol Heart Circ Physiol. 2007;292(3):H1607–18. doi: 10.1152/ajpheart.00525.2006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  12. Niggli E, Lederer WJ. Molecular operations of the sodium-calcium exchanger revealed by conformation currents. Nature. 1991;349(6310):621–624. doi: 10.1038/349621a0. [DOI] [PubMed] [Google Scholar]
  13. Sipido KR, Volders PG, de Groot SH, Verdonck F, Van de Werf F, Wellens HJ, Vos MA. Enhanced Ca2+ release and Na+/Ca2+ exchange activity in hypertrophied canine ventricular myocytes: potential link between contractile adaptation and arrhythmogenesis. Circulation. 2000;102(17):2137–2144. doi: 10.1161/01.cir.102.17.2137. [DOI] [PubMed] [Google Scholar]
  14. Nicholas SB, Yang W, Lee SL, Zhu H, Philipson KD, Lytton J. Alternative promoters and cardiac muscle cell-specific expression of the Na+/Ca2+ exchanger gene. Am J Physiol Heart Circ Physiol. 1998;274(1 Pt 2):H217–H232. doi: 10.1152/ajpheart.1998.274.1.H217. [DOI] [PubMed] [Google Scholar]
  15. Li Z, Matsuoka S, Hryshko LV, Nicoll DA, Bersohn MM, Burke EP, Lifton RP, Philipson KD. Cloning of the NCX2 isoform of the plasma membrane Na+-Ca2+ exchanger. J Biol Chem. 1994;269(26):17434–17439. [PubMed] [Google Scholar]
  16. Nicoll DA, Quednau BD, Qui Z, Xia YR, Lusis AJ, Philipson KD. Cloning of a third mammalian Na+-Ca2+ exchanger, NCX3. J Biol Chem. 1996;271(40):24914–24921. doi: 10.1074/jbc.271.40.24914. [DOI] [PubMed] [Google Scholar]
  17. Xue XH, Hryshko LV, Nicoll DA, Philipson KD, Tibbits GF. Cloning, expression, and characterization of the trout cardiac Na+-Ca2+ exchanger. Am J Physiol Cell Physiol. 1999;277(4 Pt 1):C693–700. doi: 10.1152/ajpcell.1999.277.4.C693. [DOI] [PubMed] [Google Scholar]
  18. Marshall CR, Pan TC, Le HD, Omelchenko A, Hwang PP, Hryshko LV, Tibbits GF. cDNA cloning and expression of the cardiac Na+/Ca2+ exchanger from Mozambique tilapia (Oreochromis mossambicus) reveal a teleost membrane transporter with mammalian temperature dependence. J Biol Chem. 2005;280(32):28903–28911. doi: 10.1074/jbc.M504807200. [DOI] [PubMed] [Google Scholar]
  19. Langenbacher AD, Dong Y, Shu X, Choi J, Nicoll DA, Goldhaber JI, Philipson KD, Chen JN. Mutation in sodium-calcium exchanger 1 (NCX1) causes cardiac fibrillation in zebrafish. PNAS. 2005;102(49):17699–17704. doi: 10.1073/pnas.0502679102. [DOI] [PMC free article] [PubMed] [Google Scholar]
  20. Marshall CR, Fox JA, Butland SL, Ouellette BF, Brinkman FS, Tibbits GF. Phylogeny of Na+/Ca2+ exchanger (NCX) genes from genomic data identifies new gene duplications and a new family member in fish species. Physiol Genomics. 2005;21(2):161–173. doi: 10.1152/physiolgenomics.00286.2004. [DOI] [PubMed] [Google Scholar]
  21. Shu X, Huang J, Dong Y, Choi J, Langenbacher A, Chen JN. Na,K-ATPase a-2 and NCX4a regulate zebrafish left-right patterning. Development. 2007;134(10):1921–1930. doi: 10.1242/dev.02851. [DOI] [PubMed] [Google Scholar]
  22. Iwamoto T, Nakamura TY, Pan Y, Uehara A, Imanaga I, Shigekawa M. Unique topology of the internal repeats in the cardiac Na+/Ca2+ exchanger. FEBS Lett. 1999;446(2-3):264–268. doi: 10.1016/S0014-5793(99)00218-5. [DOI] [PubMed] [Google Scholar]
  23. Nicoll DA, Ottolia M, Lu L, Lu Y, Philipson KD. A new topological model of the cardiac sarcolemmal Na+-Ca2+ exchanger. J Biol Chem. 1999;274(2):910–917. doi: 10.1074/jbc.274.2.910. [DOI] [PubMed] [Google Scholar]
  24. Quednau BD, Nicoll DA, Philipson KD. Tissue specificity and alternative splicing of the Na+/Ca2+ exchanger isoforms NCX1, NCX2, and NCX3 in rat. Am J Physiol Cell Physiol. 1997;272(4 Pt 1):C1250–61. doi: 10.1152/ajpcell.1997.272.4.C1250. [DOI] [PubMed] [Google Scholar]
  25. Schulze DH, Polumuri SK, Gille T, Ruknudin A. Functional regulation of alternatively spliced Na+/Ca2+ exchanger (NCX1) isoforms. Ann N Y Acad Sci. 2002;976:187–196. doi: 10.1111/j.1749-6632.2002.tb04740.x. [DOI] [PubMed] [Google Scholar]
  26. Dyck C, Omelchenko A, Elias CL, Quednau BD, Philipson KD, Hnatowich M, Hryshko LV. Ionic Regulatory Properties of Brain and Kidney Splice Variants of the NCX1 Na+-Ca2+ Exchanger. J Gen Physiol. 1999;114(5):701–711. doi: 10.1085/jgp.114.5.701. [DOI] [PMC free article] [PubMed] [Google Scholar]
  27. Hurtado C, Prociuk M, Maddaford TG, Dibrov E, Mesaeli N, Hryshko LV, Pierce GN. Cells expressing unique Na+/Ca2+ exchange (NCX1) splice variants exhibit different susceptibilities to Ca2+ overload. Am J Physiol Heart Circ Physiol. 2006;290(5):H2155–62. doi: 10.1152/ajpheart.00958.2005. [DOI] [PubMed] [Google Scholar]
  28. Bailey GS, Poulter RT, Stockwell PA. Gene duplication in tetraploid fish: model for gene silencing at unlinked duplicated loci. Proc Natl Acad Sci U S A. 1978;75(11):5575–5579. doi: 10.1073/pnas.75.11.5575. [DOI] [PMC free article] [PubMed] [Google Scholar]
  29. Dehal P, Satou Y, Campbell RK, Chapman J, Degnan B, De Tomaso A, Davidson B, Di Gregorio A, Gelpke M, Goodstein DM, al.. The draft genome of Ciona intestinalis: insights into chordate and vertebrate origins. Science. 2002;298(5601):2157–2167. doi: 10.1126/science.1080049. [DOI] [PubMed] [Google Scholar]
  30. Okamura Y, Nishino A, Murata Y, Nakajo K, Iwasaki H, Ohtsuka Y, Tanaka-Kunishima M, Takahashi N, Hara Y, Yoshida T, al.. Comprehensive analysis of the ascidian genome reveals novel insights into the molecular evolution of ion channel genes. Physiol Genomics. 2005;22(3):269–282. doi: 10.1152/physiolgenomics.00229.2004. [DOI] [PubMed] [Google Scholar]
  31. Venkatesh B, Kirkness EF, Loh YH, Halpern AL, Lee AP, Johnson J, Dandona N, Viswanathan LD, Tay A, Venter JC, Strausberg RL, Brenner S. Survey sequencing and comparative analysis of the elephant shark (Callorhinchus milii) genome. PLoS Biol. 2007;5(4(101e)):932–944. doi: 10.1371/journal.pbio.0050101. [DOI] [PMC free article] [PubMed] [Google Scholar]
  32. Blair JE, Hedges SB. Molecular phylogeny and divergence times of deuterostome animals. Mol Biol Evol. 2005;22(11):2275–2284. doi: 10.1093/molbev/msi225. [DOI] [PubMed] [Google Scholar]
  33. Panopoulou G, Poustka AJ. Timing and mechanism of ancient vertebrate genome duplications -- the adventure of a hypothesis. Trends Genet. 2005;21(10):559–567. doi: 10.1016/j.tig.2005.08.004. [DOI] [PubMed] [Google Scholar]
  34. Hokamp K, McLysaght A, Wolfe KH. The 2R hypothesis and the human genome sequence. Journal of Structural and Functional Genomics. 2003;3(1):95–110. doi: 10.1023/A:1022661917301. [DOI] [PubMed] [Google Scholar]
  35. Rexroad CE, Lee Y, Keele JW, Karamycheva S, Brown G, Koop B, Gahr SA, Palti Y, Quackenbush J. Sequence analysis of a rainbow trout cDNA library and creation of a gene index. Cytogenet Genome Res. 2003;102(1-4):347–354. doi: 10.1159/000075773. [DOI] [PubMed] [Google Scholar]
  36. Ovcharenko I, Nobrega MA, Loots GG, Stubbs L. ECR Browser: a tool for visualizing and accessing data from comparisons of multiple vertebrate genomes. Nucleic Acids Res. 2004;32(Web Server issue):W280–6. doi: 10.1093/nar/gkh355. [DOI] [PMC free article] [PubMed] [Google Scholar]
  37. Amores A, Force A, Yan YL, Joly L, Amemiya C, Fritz A, Ho RK, Langeland J, Prince V, Wang YL, Westerfield M, Ekker M, Postlethwait JH. Zebrafish hox Clusters and Vertebrate Genome Evolution. Science. 1998;282(5394):1711–1714. doi: 10.1126/science.282.5394.1711. [DOI] [PubMed] [Google Scholar]
  38. Taylor JS, Braasch I, Frickey T, Meyer A, Van de Peer Y. Genome duplication, a trait shared by 22000 species of ray-finned fish. Genome Res. 2003;13(3):382–390. doi: 10.1101/gr.640303. [DOI] [PMC free article] [PubMed] [Google Scholar]
  39. Gabellini N, Bortoluzzi S, Danieli GA, Carafoli E. The human SLC8A3 gene and the tissue-specific Na+/Ca2+ exchanger 3 isoforms. Gene. 2002;298(1):1–7. doi: 10.1016/S0378-1119(02)00982-4. [DOI] [PubMed] [Google Scholar]
  40. Schisler NJ, Palmer JD. The IDB and IEDB: intron sequence and evolution databases. Nucleic Acids Res. 2000;28(1):181–184. doi: 10.1093/nar/28.1.181. [DOI] [PMC free article] [PubMed] [Google Scholar]
  41. Marshall C, Elias C, Xue XH, Le HD, Omelchenko A, Hryshko LV, Tibbits GF. Determinants of cardiac Na+/Ca2+ exchanger temperature dependence: NH2-terminal transmembrane segments. Am J Physiol Cell Physiol. 2002;283(2):C512–20. doi: 10.1152/ajpcell.00558.2001. [DOI] [PubMed] [Google Scholar]
  42. NCBI BLAST. http://www.ncbi.nlm.nih.gov/BLAST/
  43. Ensembl. http://www.ensembl.org/
  44. NCBI Nucleotide. http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=Nucleotide
  45. University of California Santa Cruz (UCSC) Genome Browser . http://genome.ucsc.edu/
  46. Thompson JD, Higgins DG, Gibson TJ. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res. 1994;22(22):4673–4680. doi: 10.1093/nar/22.22.4673. [DOI] [PMC free article] [PubMed] [Google Scholar]
  47. Felsenstein J. PHYLIP - Phylogeny Inference Package (Version 3.2) Cladistics. 1989;5:164–166. [Google Scholar]
  48. Guindon S, Lethiec F, Duroux P, Gascuel O. PHYML Online--a web server for fast maximum likelihood-based phylogenetic inference. Nucleic Acids Res. 2005;33(Web Server issue):W557–9. doi: 10.1093/nar/gki352. [DOI] [PMC free article] [PubMed] [Google Scholar]
  49. Evolutionarily Conserved Regions (ECR) browser. http://ecrbrowser.dcode.org/

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Additional file 1

Figure S1. Maximum Parsimony Phylogenetic Tree. A consensus Maximum Parsimony tree that was obtained with 1000 replicates from the Phylip program.

Click here for file (76.5KB, doc)
Additional file 2

Figure S2. Neighbour-Joining Phylogenetic Tree. A Neighbour-Joining phylogenetic tree that was obtained with 1000 replicates from the ClustalX program.

Click here for file (76KB, doc)
Additional file 3

Figure S3. Teleost, amphibian and reptilian NCX4 amino acid alignments. NCX4 transcript and genomic sequences found in teleost, amphibian and reptilian genomic data have been aligned with ClustalX and viewed with Genedoc.

Click here for file (1.5MB, doc)

Articles from BMC Evolutionary Biology are provided here courtesy of BMC

RESOURCES