Skip to main content
BMC Microbiology logoLink to BMC Microbiology
. 2008 Nov 17;8:199. doi: 10.1186/1471-2180-8-199

Structural Prediction and Mutational Analysis of the Gifsy-1 Xis Protein

Asa Flanigan 1,2, Jeffrey Gardner 1,✉
PMCID: PMC2603039  PMID: 19014640

Abstract

Background

The Gifsy-1 phage integrates into the Salmonella Typhimurium chromosome via an integrase mediated, site-specific recombination mechanism. Excision of the Gifsy-1 phage requires three proteins, the Gifsy-1 integrase (Int), the Gifsy-1 excisionase (Xis) protein, and host encoded Integration Host Factor (IHF). The Gifsy-1 xis gene encodes the 94-residue Gifsy-1 excisionase protein that has a molecular weight of 11.2 kDa and a pI of 10.2. Electrophoretic Mobility Shift Assays (EMSA) suggested at least one region of the protein is responsible for protein-DNA interactions with a tripartite DNA binding site composed of three direct imperfect repeats.

Results

Here we have undertaken experiments to dissect and model the structural motifs of Gifsy-1 Xis necessary for its observed DNA binding activity. Diethyl sulfate mutagenesis (DES) and mutagenic PCR techniques were used to generate Gifsy-1 xis mutants. Mutant Xis proteins that lacked activity in vivo were purified and tested by EMSA for binding to the Gifsy-1 Xis attP attachment site. Results from mutagenesis experiments and EMSA were compared to results of structural predictions and sequence analyses.

Conclusion

Sequence comparisons revealed evidence for three distinct structural motifs in the Gifsy-1 Xis protein. Multiple sequence alignments revealed unexpected homologies between the Gifsy-1 Xis protein and two distinct subsets of polynucleotide binding proteins. Our data may suggest a role for the Gifsy-1 Xis in the regulation of the Gifsy-1 phage excision beyond that of DNA binding and possible interactions with the Gifsy-1 Int protein.

Background

Temperate phages are capable of following alternative life styles [1]. Under appropriate conditions, they grow lytically to form progeny phage particles and lyse the host cell. Alternatively, they can form lysogens where they either integrate their chromosomes by site-specific recombination or exist as autonomous extra chromosomal plasmids. Because temperate phages are able to move between hosts, they serve as vectors for horizontal gene transfer in bacteria. Temperate bacteriophages often carry accessory genes that are not necessary for growth or survival of the phage. For example phage Gifsy-1 whose host is Salmonella Typhimurium, carries genes that encode pathogenicity factors [2-6]. The Gifsy-1 gipA gene product contributes to the survival of Salmonella Typhimurium in the Peyer's patches of the mouse intestine and, along with other pathogenicity factors encoded on the related Gifsy-2 phage, contributes to the ability of the bacterial pathogen to survive within a host organism and cause disease [7].

Gifsy-1 integrates into and excises from the host chromosome by site-specific recombination. Integration of Gifsy-1 into the host chromosome requires the phage encoded Integrase (Int) that catalyzes recombination between a 14 base pair core attachment site in the phage chromosome (attP) and an identical sequence in the host chromosome (attB). Integration also requires the Salmonella Typhimurium encoded integration host factor (IHF) that likely acts with Int to form a nucleoprotein structure called the intasome. This higher order complex facilitates synapsis and the recombination reaction.

Deletion analysis showed that excision of Gifsy-1 requires Int and a protein, called Xis, encoded by the phage xis gene [8]. The Gifsy-1 Xis protein is a typical recombination directionality factor (RDF) because it is a small (94 residue) and highly basic (pI = 10.2) protein [2,3,5,9]. Electrophoretic mobility shift assay (EMSA) and footprinting analyses identified a tripartite Xis binding site in attP DNA. This initial analysis of the protein-DNA interactions also demonstrated that tight, specific binding of the Gifsy-1 Xis protein to DNA involves sequential and cooperative interactions of three Xis protomers to the minimal attP binding site. These observations suggested that protein-protein interactions might occur between Gifsy-1 Xis monomers similar to results reported for the lambda Xis protein [9-11].

While the Gifsy-1 phage carries genes that affect the pathogenicity of Salmonella Typhimurium, the site-specific recombination system has not been characterized. To date only the DNA binding sites of the Gifsy-1 phage Xis protein have been characterized. Here we begin a mutational and structural analysis of the Gifsy-1 Xis protein to provide more information on the molecular mechanism of Gifsy-1 excision.

Results and discussion

Multiple Sequence Alignment (MSA) of the Gifsy-1 Xis protein with RDFs and Transcription Factors

NMR and crystallization of the lambda Xis protein revealed the presence of a short proline loop that connects the N-terminal α-helix region to a β-sheet "wing" structure [11,12]. The Clustal W program [13,14] was used to perform multiple sequence alignment (MSA) of the Gifsy-1 Xis protein with predicted and characterized RDF (recombination directionality factor) proteins and certain transcription factors [15]. This study indicated that several other RDF proteins and transcription factors also contain proline loop sequences. Our results also indicated that Gifsy-1 Xis shows significant homology to these proteins in a short proline loop region (Gifsy-1 Xis residues P39 to P43) (Figure 1). Thus, our results suggest that this proline loop is a conserved motif in a set of transcription factors and RDF proteins.

Figure 1.

Figure 1

CustalW analysis of Gifsy-1 Xis and proteins containing proline loops. A residue ruler is indicated along the top of the figure and is numbered according to the Gifsy-1 Xis sequence. The residue number for individual proteins is indicated on the left-hand side of the figure. Residues aligned with the Gifsy-1 Xis H-T-H motif are included in the blue box A. Residues aligned with the Gifsy-1 Xis FPPP loop are included in the red box B. Residues aligned with the Gifsy-1 Xis β-sheet are included in the black box C. The secondary structures assigned to the Gifsy-1 Xis protein are aligned with the sequences along the top of the diagram. Red rectangles indicate α-helix sequences and yellow arrows indicate β-sheet structures, respectively. The proteins listed from top to bottom are as follows: Shigella flexneri Orf41, Shigella flexineri Rox, P4 Vis, Yersinia Pestis YPO1904, E. coli Z112, Salmonella Typhimurium Gifsy-1 Xis, phage lambda Xis, E. coli phage Phi80 Xis, phage e14 Xis, phage P21 Xis, CP4-57 ALPA.

Gifsy-1 Xis possesses limited homology to these proteins in two other regions. The aligned proteins, Shigella flexneri Orf41, Shigella flexineri Rox, P4 Vis, Yersinia Pestis YPO1904, E. coli Z112, Salmonella Typhimurium Gifsy-1 Xis, phage Phi80 Xis, CP4-57 ALPA, share limited similarity in the putative helix turn helix (H-T-H) motif (Gifsy-1 Xis residues C18 to K32). An additional region of homology corresponds to the three strand β-sheet of the Gifsy-1 Xis protein (residues S46 to S68) that are C-terminal to the proline linker region. Salmonella Typhimurium Gifsy-1 Xis, E. coli phage Phi80 Xis, phage e14 Xis, phage P21 Xis, CP4-57 ALPA, proteins possess several conserved residues in this region. Studies with the Gifsy-1 Xis protein suggests that all three regions, the N-terminal H-T-H, the proline loop, and the C-terminal β-sheet, play a role in DNA binding. Our alignment results may indicate that these several proteins may use three regions for binding to DNA.

We also performed multiple sequence alignment studies of the Gifsy-1 Xis protein with the CTnDOT Orf2c protein [9] and the RDF of the conjugative element R391 that is identical to the characterized Xis of the R391 related Vibrio Cholera phage SXT [16,17], (Figure 2). All three proteins share homology in an N-terminal region corresponding to residues 40 to 62 of CTnDOT Orf2c, residues 10 to 32 of Gifsy-1 Xis, and residues 13 to 35 of the R391 Jef protein. Each short sequence of homology is predicted to form a H-T-H motif with a probability of 100% for CTnDOT Orf2c, 25% for Gifsy-1 Xis, and 50% for the Jef protein [18].

Figure 2.

Figure 2

Clustal W alignment of the R391 Jef, CTnDOT Orf2c, and Gifsy-1 Xis. A residue ruler is indicated along the top of the figure. The ruler corresponds to the residue number of the Gifsy-1 Xis protein. The residue number for individual proteins is indicated on the left-hand side of the figure. The boxed sequences indicate the region of homology shared by the three proteins.

These several alignment studies suggest that the regions of the Gifsy-1 Xis protein are related to two distinct groups of proteins. The first group contains a wide variety of DNA binding proteins in which the homology is located mostly in the proline loop and a putative β-sheet. The second group includes the RDFs of conjugative elements. The sequence conservation in this group is located in the putative N-terminal H-T-H motifs of the RDFs. While members of the two groups possess limited homology to the Gifsy-1 Xis protein, the groups do not show significant homology to each other.

Structure Prediction and Motif Analysis of Gifsy-1 Xis

The Gifsy-1 Xis protein, like the lambda and Tn916 Xis proteins, is a small basic DNA binding protein. Previous DNA binding studies suggest that Gifsy-1 Xis interacts with DNA in a similar manner to the lambda Xis protein. These similarities led us to use a modeling technique to determine if Gifsy-1 Xis protein could fold into a structure that is comparable to the structure of the two similar proteins, the lambda Xis protein, and the Tn916 Xis proteins, for which structural data exists. The Robetta program for 3-dimensional protein structure prediction [19] was used to generate a tertiary folding prediction for the Gifsy-1 Xis protein. A model with a reasonable Z-score (> 6.0) was generated by Robetta (Figure 3A). The model folded the first 72 N-terminal residues of the 94 residue Gifsy-1 Xis. Thus, our model includes two N-terminal α-helixes (residues C18 to L20 and S24 to K32) followed by a loop containing the proline-rich loop (residues R33 to C45). The loop connects the second helix to a 3-strand β-sheet that spans residues S46 to S68. Both Gifsy-1 Xis and lambda Xis contain an N-terminal H-T-H motif linked to a β-sheet by an intervening proline-rich loop. The overall structural arrangement is similar to the solved NMR and crystal structures of the lambda Xis (residues 1 to 55) and the Tn916 Xis proteins (Figure 3B, 3C). The Robetta software did not resolve the remainder of the protein from residues 73 to 94.

Figure 3.

Figure 3

A. Robetta generated model of the Gifsy-1 Xis residues 1 to 72. Red ribbons indicate α-helices. Yellow ribbons indicate β-sheets. The numbers next to the model delimit predicted resolved motifs and are colored according to the corresponding ribbon structure: Helix 1 = C18 to L20; Helix 2 = S24 to K32; β-sheet structure = S46 to S68. Proline residues involved in the "Proline loop" are indicated by ball and stick models (P39, P41, P43) and are indicated by grey numbers. B-D. Robetta 3-dimensional Structure prediction of Gifsy-1 Xis compared to empirical structure determinations. B. Tn916 Xis NMR structure [34]; C. Gifsy-1 Xis de novo Robetta prediction; D. lambda Xis [11]. Red arrows indicate "wing" structures. Blue arrows indicate positioning loops. Proline loop motifs are indicated by rendered ball-and-stick atom structures.

Limited proteolysis of the Gifsy-1 Xis protein

Limited proteolysis was performed using proteinase K to identify regions of the protein resistant to proteolysis. The cleavage properties of proteinase K predict that there are multiple potential sites of cleavage across the entire length of the Gifsy-1 Xis protein [20-22]. It is predicted that unstructured loops will be digested more rapidly by the broad specificity proteinase K than structured domains and motifs. Thus, fragments of Gifsy-1 Xis that remain after extended periods of proteolysis would result from the presence of compact structural motifs [23]. MALDI-TOF analysis of undigested Gifsy-1 Xis protein resulted in a peak of approximately 11.1 kDa (Figure 4A). This mass matches the predicted mass of Gifsy-1 Xis within the margin of error of the MALDI-TOF apparatus used in these studies. Two fragments of 5.5 kDa and 6.4 kDa were generated by the ionization of the protein. These fragments were labile to proteolysis and were not observed in significant amounts in spectra produced by the proteolysis of the Gifsy-1 Xis protein with proteinase K.

Figure 4.

Figure 4

Time course of Gifsy-1 Xis digested with proteinase K. Lane 1: Molecular mass marker. Lane 2: Undigested Gifsy-1 Xis. Lanes 3 to 6 contain Gifsy-1 Xis digested with proteinase K (proteinase to protein molar ratio of 1:8). Lane 3: 5 minutes. Lane 4: 10 minutes. Lane 5: 20 minutes. Lane 6: 40 minutes.

Gifsy-1 Xis was digested over a 40-minute period. Three proteolytic fragments were identified by SDS PAGE analysis (Figure 5). Two fragments accumulated in amounts that facilitated N-terminal sequence analysis and matched predicted Gifsy-1 Xis peptide products of limited proteolysis with proteinase K. N-terminal sequence analysis verified the identity of the two proteolytic fragments that spanned residues three to 36 and two to 72.

Figure 5.

Figure 5

MALDI-TOF analysis of Gifsy-1 Xis digested with proteinase K. Panel A contains a spectrum of undigested Gifsy-1 Xis. Panel B contains a spectrum of 20 minutes post addition of proteinase K. Panel C contains a spectrum 80 minutes post addition of proteinase K. Panel D contains a spectrum 160 minutes post addition of proteinase K. Peak identities are as follows. Peak 1: Residues 3–35, KKIRDFELMSTREICCQ LRISSRTLERYRKRPS; Peak 2: Residues 3–36, KKIRDFELMSTREICCQLRISSRTLERYRKRPSD; Peak 3: Residues 6–73, RDFELMSTREICCQLRISSR TLERYRKRPSDNNPFPEPDCSYMGGSNKWLKTKVNEWQVREMSRPTRR; Peak 4: Residues 2–72, SKKIRDFELMSTREICCQLRISSRTLERYRKRPSDNNPFPEPDCSYMGGSNK WLKTKVNEWQVRE MSRPTR; Peak 5: Residues 41–62, PEPDCSYMGGSNKWLKTKVNEW; Peak 6: Residues 9–30, ELMSTREICCQ LRISSRTLERY.

Mass spectrum analysis of Gifsy-1 Xis protein digested with proteinase K identified several Gifsy-1 Xis peptides that were specifically generated by proteolysis (Figure 4B–4D). These fragments were resistant to further proteolysis by proteinase K. Two additional peptides persisted corresponding to molecular masses of 4.6 kDa (Peak 1 = residues three to 35), and 4.4 kDa (Peak 2 = residues three to 36). Two related peptides, a 8.9 kDa peptide (Peak 3) and a 9.2 kDa peptide (Peak 4), were produced after 20 minutes of proteolysis. The 8.9 kDa peptide was identified as the sequence that spans residues six to 73. This fragment persisted for 160 minutes. The 9.2 kDa fragment represented the sequence that spans residues two to 72 and persisted for 80 minutes in our experimental conditions. The single residue difference observed at the N-terminus of fragments represented by Peaks 1 and 2 and Peak 4 may have been generated by chemical modification, mass spectroscopy-induced fragmentation, or non-specific clipping of the peptides by proteinase K [24,25]. This same phenomenon was observed at the C-terminus of fragments represented by Peaks 3 and 4. We interpret these results to indicate that fragments represented by peaks 1, 2, and 4 likely possess the same proteinase K cleavage site at their N-termini and that fragments represented by peaks 3 and 4 are likely to possess the identical proteinase K cleavage site at their C-terminal sequences. Peaks 5 (2.8 kDa) and 6 (3.1 kDa) were observed after 80 minutes of proteolysis and persisted in proteolysis reactions for 160 minutes. Peak 5 represented the Gifsy-1 Xis fragment that spans residues 41 to 62. Peak 6 represents the Gifsy-1 Xis fragment that spans the residues nine to 30. Fragments that span the C-terminal tail were not observed during mass spectroscopy analysis of proteinase K digests. This corresponds to our modeling data that suggests that residues 73 to 94 may participate in forming a C-terminal tail that lacks a defined secondary structure.

Peaks 1 and 2 represent stable proteolysis products and contain the N-terminus of Gifsy-1 Xis that includes the putative H-T-H motif (Figure 6). These two fragments span the N-terminus to the putative proline loop at residue 35. This result may indicate that the proline loop represents an exposed motif that is sensitive to proteolysis. Peaks 3 and 4 represent a larger fragment that spans the N-terminus and includes a significant portion of the C-terminal region of the Gifsy-1 Xis protein. Peak 5 represents a small fragment that closely corresponds to the predicted Gifsy-1 Xis β-sheet. Peak 6 contains a fragment that is predicted to span the N-terminal H-T-H motif. Fragments that are represented by peaks 1, 3, 5, and 6 include both the putative Gifsy-1 Xis H-T-H motif and the predicted β-sheet. These fragments persist after 160 minutes of proteolysis with proteinase K and may represent stable motifs within the Gifsy-1 Xis protein.

Figure 6.

Figure 6

Alignment of Gifsy-1 Xis proteolytic fragments. Red rectangles indicate the borders of the predicted H-T-H motif and yellow arrows delimit the predicted β-sheet motifs.

Mutational Analysis of Gifsy-1 Xis

In order to identify residues that are necessary for the DNA binding activity of the Gifsy-1 protein we performed chemical and PCR mutagenesis of the Gifsy-1 Xis gene resulting in the isolation of 17 substitution mutants along with two amber mutants. The 19 mutants isolated by PCR and DES chemical methods occurred over almost the entire length of the Gifsy-1 Xis protein, though mutations clustered in the two secondary structures predicted by the Robetta modeling program. The N-terminal α-helical region between C18 and K32 contained six of the 17 substitutions. We isolated substitution mutants of four of the six arginine residues in this highly basic region (R21K, R25K, R29C, and R33Q). Six more mutations occurred within the predicted β-sheet between residues S46 and S68. Two mutations occurred within the putative proline loop identified by sequence homology to the several RDF proteins and transcriptional regulators (Figure 7).

Figure 7.

Figure 7

Position of Gifsy-1 Xis mutants relative to Robetta secondary structure prediction. Red rectangles indicate sequences with a propensity to form α-helixes. Yellow arrows indicate sequences with a propensity to form β-strands. The positions and identities of random mutations generated in the protein are indicated above the primary amino acid sequence. Red characters indicate mutants generated through mutagenic PCR. Black characters indicate mutations generated through DES mutagenesis.

The Gifsy-1 Xis mutants with the following residue substitutions were purified: Arg29Cys, Ile16Asn, Ser51Pro, Arg25Lys, Cys17Tyr, Phe40Ser, and Ser24Phe. All proteins were tested by EMSA against a radiolabeled DNA probe consisting of the 160 base pairs of the Gifsy-1 attP region. The mutant proteins lacked detectable DNA binding activity. To determine the possible structural changes caused by the substitutions, the mutants and the wild-type Gifsy-1 Xis were subjected to limited proteolysis. The concentrations of each protein were normalized to that of the wild-type Gifsy-1 Xis. Each protein was then subjected to limited proteolysis with proteinase K. A molar ratio of Xis to proteinase of 80:1 was used. Limited proteolysis of wild-type Gifsy-1 Xis produced three bands on SDS-PAGE corresponding to undigested protein, peak 1 (residues 3 to 35), and peak three (residues 6 to 73) (Figure 8). Analysis of reactions containing the wild-type protein and proteinase K suggests that peaks 1 and 2 migrate in SDS-PAGE as a single band. Peaks 3 and 4 also migrate together as a single band. With the exception of undigested wild-type Gifsy-1 protein, this fragmentation pattern was equivalent to those obtained from proteolytic reactions that utilized a protein to proteinase ratio of 8:1.

Figure 8.

Figure 8

Limited proteolysis of wild-type Gifsy-1 Xis and Gifsy-1 Xis substitution mutants S51P and C17Y. Lanes 1, 3 and 5 contain protein without the addition of proteinase K. Lanes 2, 4, and 6 contain the indicated Gifsy-1 wild-type protein or substitution mutants S51P or C17Y. Limited proteolysis was accomplished using a protein to proteinase molar ratio of 80:1. Peaks corresponding to wild-type Gifsy-1 mass spectroscopy results are indicated.

Analysis of proteolytic fragments of Gifsy-1 Xis wild type protein and substitution mutants indicates that the small stable proteinase K proteolysis fragments that were observed as peaks 1 and 2 during mass spectroscopy analysis were produced from proteolysis of the Ser51Pro and Cys17Tyr substitution mutants. The larger proteolytic fragment represented by peaks 3 and 4 were not apparent in the limited digest of the Gifsy-1 Xis Ser51Pro and Cys17Tyr mutants. Limited proteolysis of the Cys17Tyr mutant resulted in the production of a band that represents peaks 1 and 2 and an additional uncharacterized band above 4.6 kDa. These altered peptide fingerprints may be created by changes the 3-dimensional folding pattern of the Gifsy-1 Xis by the substitutions at the 17th and 51st residues. The Cys17 residue lies within the predicted N-terminal α-helix and the Ser51 residue lies within the N-terminal β-sheet. This may indicate that the substitutions altered or destabilized the putative interactions of the two predicted motifs. As a result, the relative amount of the small fragment spanning residues 48 to 75 and residues 48 to 94 produced by limited proteolysis with proteinase K increased.

Conclusion

To further analyze the structure of the Gifsy-1 Xis protein, we used Clustal W to perform protein sequence-based homology analysis. We produced a multiple-sequence alignment (MSA) of the Gifsy-1 Xis and several predicted and characterized RDF proteins, transcription factors, and AlpA homologs [26]. Gifsy-1 Xis aligned with two distinct groups of proteins, (Figures 1 and 2). The proteins in the first group use diverse mechanisms to bind to DNA and RNA, and include the transcription factors, phage RDFs, the AlpA protein, and the multifunctional P4 Vis protein (Figure 1) [27-31]. For example, the Gifsy-1 Xis protein is known to bind to a tripartite binding site composed of direct imperfect repeats in the Gifsy-1 attP region in a cooperative and sequential manner similar to that of the lambda Xis protein [9]. P4 Vis acts as a lambda Xis-like excisionase protein by binding to DNA in the P4 attP region as determined by EMSA and DNase I footprint analysis. The P4 Vis protein also regulates recombination by binding to RNA transcripts [29]. The Shigella flexineri Rox protein stimulates Int mediated excision of the she pathogenicity island but is not essential for excision [32]. It is not known whether the Rox protein acts exclusively as a lambda-like RDF or as a transcription factor to stimulate excision. These proteins all possess a FPPP loop that follows a predicted N-terminal H-T-H motif. The FPPP loop is preceded by a third region of homology that corresponds to the predicted 3-sheet β-strand of the Gifsy-1 Xis protein.

We were led to the characterization of a second group of proteins that share limited homology to the Gifsy-1 Xis by the relationship of the Gifsy-1 Int and the R391 Int proteins. The Gifsy-1 phage encodes an Int with a 36% identity to the Int of the IncJ conjugative element R391 [33]. Clustal W analysis identified a subset RDF proteins belonging to conjugative elements that share homology with the Gifsy-1 Xis. In the putative N-terminal motif, the Gifsy-1 Xis possesses homology to the Orf2c protein of the CTnDOT conjugative transposon and the R391 Jef protein (Figure 2). The Orf2c protein binds specifically to CTnDOT DNA (Jieyong Lei and A. Salyers, personal communication) and functions in the excision of the CTnDOT element. The R391 Jef protein belongs to the RDFs encoded by a newly characterized SXT/R391 family of mobilizable integrating conjugative elements. All three proteins are predicted to form homologous N-terminal oriented H-T-H motifs. Our structure and sequence analysis of the Gifsy-1 Xis protein may add insight into the possible mechanism by which similar proteins such as the AlpA homologs, P4 Vis, Rox, e14 Xis, and the R391 Jef proteins might function.

Three-dimensional folding analysis with Robetta provided results that complemented those we obtained from the sequence-based analysis of the Gifsy-1 Xis protein and related DNA binding proteins. Robetta analysis [19] of the Gifsy-1 Xis protein indicates that it contains an α-helix rich region near its N-terminus (residues C18 to K32) followed by a β-sheet structure containing three β-strands (residues S46 to S68) (Figure 3A). The predicted α-helix sequence and the β-sheet are connected by a putative proline loop region. The remainder of the protein structure was unresolved by the Robetta tool. A similar structural arrangement was determined by NMR and X-ray analysis for the lambda Xis protein [11,12] (Figure 3D). In the case of the lambda Xis protein, the proline loop positions the third DNA-binding surface of the lambda Xis protein into the minor groove of DNA. In contrast, the NMR structure of the Tn916 Xis protein [34] possesses an arrangement similar to the lambda Xis even though it does not possess a proline loop that connects the helix-rich region to the β-sheet (Figure 3B).

The validation of this Gifsy-1 Xis model was investigated using limited proteolysis with proteinase K and random mutagenesis. MALDI-TOF analysis of proteolysis products several fragments of the Gifsy-1 Xis protein that are resistant to enzymatic proteolysis. Fragments corresponded to residues three to 36, six to 73, nine to 30, and 41 to 62. The two fragments that include residues nine to 30 and residues 41 to 62 correspond to the predicted H-T-H and β-sheet motifs respectively. Fragments of the C-terminal tail were not observed. This data corresponds to our prediction that the flexible C-terminal region is accessible to proteases and is not expected to possess a rigid globular structure [23,35,36]. Overall, data from proteolytic reactions agreed with the model generated by the Robetta server and suggested that the Gifsy-1 Xis might possess a structure similar to that of the lambda Xis and Tn916 Xis proteins.

Random amino acid substitutions generated by DES mutagenesis and mutagenic PCR occurred mostly within the regions of Gifsy-1 Xis for which structure predictions were obtained. Mutations of the Gifsy-1 Xis protein that occur in these regions (I16N, C17Y, R21K, E28K, N52H, V59D, and E66Q) result in a loss of DNA binding activity. Proteolysis studies of wild-type Gifsy-1 Xis and purified Xis substitution mutants suggest that the loss of DNA binding may be the result of altered or unstable protein structure. Our results suggest that residues within predicted helix, proline loop, and β-sheet regions of the Gifsy-1 Xis are essential for both proper folding and function of the protein.

Sequence analysis, proteolysis, and mutagenesis suggest that the Gifsy-1 Xis possesses at least two surfaces that are involved in DNA binding to Gifsy-1 attP DNA. The Gifsy-1 Xis protein is required for excision of the Gifsy-1 phage and binds to Gifsy-1 attP DNA. However, the mechanism through which the Gifsy-1 Xis influences the direction of Gifsy-1 Int mediated site-specific recombination is still unknown. Our studies suggest that the Gifsy-1 Xis protein possesses sequence characteristics of both transcription factors, lambda phage-like RDF proteins, and separately to an uncharacterized group of RDFs belonging to conjugative transposons. It is not known whether the Gifsy-1 Xis regulates the excision of the Gifsy-1 phage by means other than binding to specific DNA sequences in order to participate in a higher order nucleoprotein complex with Gifsy-1 Int, IHF, and att DNA.

Methods

Chemicals and enzymes

Antibiotics were added to media in the following concentrations: Carbenecillin, 100 μg/mL (Sigma); Kanamycin, 50 μg/mL (Sigma); Chloramphenicol, 20 μg/mL (Sigma). Rifampicin was used at a concentration of 200 μg/mL as previously indicated [9]. Isopropyl-β-D-thiogalactopyranoside (IPTG) was obtained from Research Products International Corp. and was used at a concentration of 1 mM. Diethyl Sulfate (DES) was purchased from Sigma. X-gal was obtained from Research Products International Corp. and was added to media to a concentration of 80 μg/mL. L-arabinose (Sigma) was added to media at a concentration of 1%. Proteinase K was obtained from Invitrogen. Platinum Pfx DNA polymerase (Invitrogen) was used to amplify DNA fragments for cloning into expression vectors. PCR mutagenesis was accomplished using a Genemorph II PCR kit (Stratagene). Automated fluorescent sequencing was carried out at the W. M. Keck Center at the University of Illinois at Urbana Champaign. The restriction enzymes SmaI and BamH1 were used to clone xis genes into the pKK223 vector (Fermentas) to result in the creation of the pSM13-1 plasmid. The restriction enzymes NdeI and BamHI were used to clone xis genes into the pET27b+ vector (Novagen). T4 DNA ligase used in cloning experiments was obtained from Invitrogen.

Bacterial strains and plasmids

All strains are derivatives of the Salmonella Typhimurium strain MA6052 that was cured of all three Gifsy phages (ATCC14028s Gifsy-1-, Gifsy-2-, Gifsy-3-) (Table 1) [37]. MA6052 possesses the wild-type attB sequences of all three Gifsy phages. This strain was donated by the L. Bossi laboratory. The strain JG15036 (MA6052 ara702::Tn10dTet) that contains the wild-type Gifsy-1 attB sequence was created by transducing MA6052 with a P22HT lysate of ara702::Tn10dTet (araB) [37-40]. The disruption of the araB gene by Tn10dTet allows efficient expression of Gifsy-1 Int from the pSM2 vector upon induction with arabinose [41]. Strain JG15049, a derivative of JG15036, contains the Integrase plasmid, pSM2-1 (camR). Strain JG15067, a derivative of JG15049, contains pSM2-1 and the suicide plasmid, pSM3-1 (kanR), integrated into the Salmonella Typhimurium Gifsy-1 attB site. The plasmid pSM3-1 encodes the oriR6K origin of replication and will not propagate in a pir- strain [42]. Salmonella Typhimurium strain JG15073 harbors the pSM13-1 plasmid (ampR) and was used in mutagenesis procedures. The strain JG15090 was used to overexpress Gifsy-1 xis gene from the pET27b+ vector and to purify wild-type and mutant proteins [9]. The several plasmids used were introduced into bacterial strains via electroporation (2 mm gap cuvette, 400 ohms, 2.4 kV, 25 μF).

Table 1.

Strain list

Strains Strain notes Plasmid Integrated element
MA6052 ATCC14028s; Gifsy-1-, Gifsy-2-, Gifsy-3- N/A N/A
JG15036 ATCC14028s ara702::Tn10dTet; Gifsy-1-, Gifsy-2-, Gifsy-3- N/A N/A
JG15049 ATCC14028s ara702::Tn10dTet; Gifsy-1-, Gifsy-2-, Gifsy-3- pSM2-1 (int) N/A
JG15067 ATCC14028s ara702::Tn10dTet; Gifsy-1-, Gifsy-2-, Gifsy-3- pSM2-1 (int) pSM3-1 (attB)
JG15073 Expression of Gifsy-1 Xis for excision assay pSM13-1 (xis) N/A
JG15090 Overexpression of Gifsy-1 Xis pET27b+ (xis) N/A

Gifsy-1 Xis was encoded on the plasmid pSM13-1 and expressed from a ptac promoter [37] on the pET27b+ plasmid. The pSM13-1 plasmid is a derivative of the pKK22-3 plasmid (Fermentas) [43,44]. Gifsy-1 Int was encoded on the pBR322 derived plasmid pSM2-1 with expression driven by a pBAD promoter [37]. The Pi-dependent plasmid pSM3-1 is a derivative of pRA111 [45] and possesses the wild-type Gifsy-1 attP sequence cloned between its BamH1 sites. The pSM3-1 plasmid also encodes a kanamycin resistance cassette and lacZ with its promoter and operator sequences.

Excision Assay

For the integration or excision assay, the plasmids were introduced into a Salmonella Typhimurium strain JG15049 (Table 1). This strain was cured of all three Gifsy phages and possesses the attB sites for the Gifsy-1, -2, and -3 phages. The Gifsy-1 attP site was encoded on the pir-dependent plasmid pSM3-1. The pSM3-1 plasmid was integrated into the Gifsy-1 attB site to form an integrated plasmid flanked by attL and attR sites after electroporation into strain JG15049 that carries the pSM2-1 plasmid [37]. To achieve integration of the pSM3-1 plasmid, JG15049 cells were grown in Luria Broth (LB) [46] to an O.D. at 600 nm of 0.4. L-arabinose was added (1%) and the cells were further grown to an O.D. 600 of 0.6. Cells were then harvested and made electrocompetent. The pSM3-1 plasmid was then electroporated into the JG15049 strain and cells were recovered in LB broth containing arabinose for 30 minutes and plated onto LB agar containing kanamycin, carbenicillin, and X-gal. Blue, kanamycin resistant colonies were screened by PCR to confirm the integration of the pSM3-1 plasmid into the Gifsy-1 attB site (Table 2). The resulting strain that harbors the integrated pSM3-1 plasmid and the pSM2-1 plasmid that encodes Gifsy-1 Int under the control of an arabinose inducible promoter was named JG15067.

Table 2.

Oligo nucleotides.

Oligonucleotide Sequence Function
Xis-1060f TACCCACGCCGAAACAAG Sequencing of pSM13-1
Xis genemorphf ATTTCACACAGGAAACAGAATTCCCGGGGGA PCR mutagenesis
Xis Genemorphr TCTCATCCGCCAAAACAGAAGCTTGGCTGCAGTTT PCR mutagenesis
pET27bplusXisNde1f GCGCGCGCGCCATATGAGCAAAAAAATTAGAGACTTTGAATTGATG Cloning of Gifsy-1 xis into pET27b+
pET27bplusXisBH1r GCGCGCGCGCGGATCCTCACGCCACGTCAGACCGGATGAGTCGACC Cloning of Gifsy-1 xis into pET27b+
T7 promoter TAATACGACTCACTATAGGG Sequencing of pET27b+ constructs

To induce excision, strain JG15067 was induced with 1% L-arabinose and made electrocompetent. The pSM13-1 plasmid, carrying Gifsy-1 xis, was then introduced to the cells by electroporation. Cells were recovered in LB broth containing IPTG (0.1 mM) and L-arabinose for one hour. Cultures were then plated onto LB agar containing 1 mM IPTG, 1% L-arabinose, chloramphenicol, and carbenicillin. The plates were incubated at 37°C and grown overnight. Colonies from the plate were then patched onto LB plates containing kanamycin, chloramphenicol and carbenicillin. Colonies that were both carbenicillin and chloramphenicol resistant were scored for the loss of resistance to kanamycin. The loss of kanamycin resistance indicated the expression of functional Xis protein and the excision of the integrated pSM3-1. The retention of kanamycin resistance indicated that a mutation occurred on the pSM13-1 plasmid that resulted in the loss of xis expression or a mutation within the xis gene that reduced or eliminated the function of the protein.

Mutagenesis of Gifsy-1 xis

Cultures of Salmonella Typhimurium strain JG15073 containing the plasmid pSM13-1 were treated with the mutagen DES for 55 minutes to achieve a 90% killing of cells [47]. Cells were then washed to remove DES and were then cultured overnight to amplify the DES exposed pSM13-1 plasmids. Plasmids were harvested from the cells by standard miniprep procedures (Qiagen, Inc.). The plasmids were then electroporated into Salmonella Typhimurium excision assay strains JG15067 and expression of Gifsy-1 int and Gifsy-1 xis genes were induced to identify potential mutants of the Gifsy-1 xis gene encoded by the pSM13-1 plasmid. Colonies that retained kanamycin resistance and produce blue color on X-gal plates after 48 hours of incubation were presumed to harbor mutated Gifsy-1 xis genes. Plasmids that carried putative xis mutations were harvested and back-crossed into the assay strain JG15067 to confirm the results of the excision screen. Individual mutant plasmids were isolated and all mutants were sequenced using primers that annealed to the pSM13-1 plasmid (Table 2).

In order to eliminate the occurrence of mutations outside of the xis gene, an in vitro PCR mutagenesis technique was also used. Mutagenic PCR was carried out using a Stratagene Genemorph II random mutagenesis kit. Briefly, primers (Integrated DNA Technologies) were designed to anneal to sequences immediately 5' and 3' to the Gifsy-1 xis gene on the plasmid pSM13-1 (Table 2). Mutagenic PCR reactions that contained 100 ng of the initial Gifsy-1 Xis target DNA were allowed to run for 20 cycles in order to generate an average of 4.5 mutations per 1 kb of DNA. The total PCR reaction was then digested with restriction enzymes and cloned in-frame with the ptac promoter in the pKK22-3 plasmid. The PCR inserts were then ligated into the pKK22-3 plasmid and electroporated into Salmonella Typhimurium strain 14028s carrying the pSM2-1 plasmid and integrated pSM3-1 plasmid. Putative mutants were backcrossed and sequenced as described above.

Protein purification

Purification of the wild-type and mutant Gifsy-1 Xis proteins was carried out as previously described [9]. Exceptions were made for amber mutations that resulted in truncations of Gifsy-1 Xis with molecular masses of less than 10 kDa. For these truncation mutants, Millipore Centrifugal concentrators with a molecular mass cut off of five kDa were used instead of concentrators with a molecular mass cut off of 10 kDa.

EMSA

Gel shift analysis of the binding of Gifsy-1 Xis and Gifsy-1 Xis substitution mutants was accomplished as previously described [9]. Briefly, the attP306 DNA fragment (a PCR product containing the Gifsy-1 attP sequence) was used in binding reactions at a concentration of 0.5 nM. Proteins were incubated with the DNA ligand for 45 minutes and then loaded onto and resolved on 8% native polyacrylamide gels.

Limited Proteolysis

Gifsy-1 Xis peptides were generated by digesting aliquots of protein in purification buffer (50 mM NaCl, 50 mM HEPES pH 7.0, 10 mM EDTA pH 8.0, 5% Glycerol, 1 mM DTT) with proteinase K. To determine the time course of proteolysis, 10 μg of Gifsy-1 Xis was diluted into 200 μL of purification buffer. A volume of 14 μL was removed and immediately denatured in SDS loading buffer (Tris Base pH 8.3 100 mM, Tricine 100 mM, SDS 0.1%) before the addition of proteinase K. This procedure was repeated for every time point after the addition of proteinase K. The final protein to proteinase K ratio was 8:1 (molar ratio) and proteolysis was carried out at room temperature. Aliquots were loaded onto 16% tricine-SDS-PAGE gels (49.5% T, 6% C mixture), resolved, and stained with Sypro Ruby (Invitrogen) [48]. For analysis of mutants, a protein to proteinase K ratio of 80:1 was used. For the preparation of peptides for N-terminal sequence analysis and MALDI-TOF analysis, 20 pmol of Gifsy-1 Xis were digested using a 80:1 (protein to proteinase) molar ratio of proteinase K. N-terminal sequence analysis and MALDI-TOF of peptides from wild-type Gifsy-1 Xis were carried out by the Protein Sciences Facility at the University of Illinois at Urbana-Champaign. Ten μg of purified Gifsy-1 Xis substitution mutants were dissolved in 50 μL of purification buffer. Each solution was then diluted to 200 μL in preparation for proteolysis with proteinase K. Proteolysis reactions were allowed to run for 10 minutes with an 80:1 protein to proteinase K ratio and resolved by Tricine-SDS-PAGE.

Spectral Analysis and Peak Assignment

Protein and peptide samples were submitted to the Proteomics laboratory at the University of Illinois. Samples were resolved on a MALDI-TOF apparatus. Mass data was then analyzed using the mMass software package [49].

Authors' contributions

AF contributed to the design of the study, carried out all studies, and drafted the manuscript. JG conceived of the study, contributed to its design and coordination, and edited the manuscript in preparation for publication.

Acknowledgments

Acknowledgements

We would like to give special thanks to Dr. Isaac Cann, Dr. John Cronan, Gloria Rendon, Dr. James Imlay, Dr. Abigail Salyers, Dr. James Slauch, and Dr. Maria Spies for their helpful discussions and use of equipment. We would also like to thank NIH for its support through awards GM-28717 and GM-65069

Contributor Information

Asa Flanigan, Email: akflanig@uiuc.edu.

Jeffrey Gardner, Email: jeffgard@life.uiuc.edu.

References

  1. Echols H. Developmental Pathways for the Temperate Phage: Lysis VS Lysogeny. Annual Review of Genetics. 1972;6:157–190. doi: 10.1146/annurev.ge.06.120172.001105. [DOI] [PubMed] [Google Scholar]
  2. Figueroa-Bossi N, Uzzau S, Maloriol D, Bossi L. Variable assortment of prophages provides a transferable repertoire of pathogenic determinants in Salmonella. Molecular microbiology. 2001;39:260–271. doi: 10.1046/j.1365-2958.2001.02234.x. [DOI] [PubMed] [Google Scholar]
  3. Figueroa-Bossi N, Coissac E, Netter P, Bossi L. Unsuspected prophage-like elements in Salmonella typhimurium. Molecular microbiology. 1997;25:161–173. doi: 10.1046/j.1365-2958.1997.4451807.x. [DOI] [PubMed] [Google Scholar]
  4. Slominski B, Calkiewicz J, Golec P, Wegrzyn G, Wrobel B. Plasmids derived from Gifsy-1/Gifsy-2, lambdoid prophages contributing to the virulence of Salmonella enterica serovar Typhimurium: implications for the evolution of replication initiation proteins of lambdoid phages and enterobacteria. Microbiology (Reading, England) 2007;153:1884–1896. doi: 10.1099/mic.0.2006/000802-0. [DOI] [PubMed] [Google Scholar]
  5. Figueroa-Bossi N, Bossi L. Inducible prophages contribute to Salmonella virulence in mice. Molecular microbiology. 1999;33:167–176. doi: 10.1046/j.1365-2958.1999.01461.x. [DOI] [PubMed] [Google Scholar]
  6. Brussow H, Canchaya C, Hardt WD. Phages and the evolution of bacterial pathogens: from genomic rearrangements to lysogenic conversion. Microbiol Mol Biol Rev. 2004;68:560–602. doi: 10.1128/MMBR.68.3.560-602.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  7. Stanley TL, Ellermeier CD, Slauch JM. Tissue-specific gene expression identifies a gene in the lysogenic phage Gifsy-1 that affects Salmonella enterica serovar typhimurium survival in Peyer's patches. Journal of bacteriology. 2000;182:4406–4413. doi: 10.1128/jb.182.16.4406-4413.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  8. Frye JG, Porwollik S, Blackmer F, Cheng P, McClelland M. Host gene expression changes and DNA amplification during temperate phage induction. Journal of bacteriology. 2005;187:1485–1492. doi: 10.1128/JB.187.4.1485-1492.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  9. Flanigan A, Gardner JF. Interaction of the Gifsy-1 Xis protein with the Gifsy-1 attP sequence. Journal of bacteriology. 2007;189:6303–6311. doi: 10.1128/JB.00577-07. [DOI] [PMC free article] [PubMed] [Google Scholar]
  10. Papagiannis CV, Sam MD, Abbani MA, Yoo D, Cascio D, Clubb RT, Johnson RC. Fis Targets Assembly of the Xis Nucleoprotein Filament to Promote Excisive Recombination by Phage Lambda. Journal of molecular biology. 2007;367:328–343. doi: 10.1016/j.jmb.2006.12.071. [DOI] [PMC free article] [PubMed] [Google Scholar]
  11. Sam MD, Cascio D, Johnson RC, Clubb RT. Crystal structure of the excisionase-DNA complex from bacteriophage lambda. Journal of molecular biology. 2004;338:229–240. doi: 10.1016/j.jmb.2004.02.053. [DOI] [PubMed] [Google Scholar]
  12. Sam MD, Papagiannis CV, Connolly KM, Corselli L, Iwahara J, Lee J, Phillips M, Wojciak JM, Johnson RC, Clubb RT. Regulation of directionality in bacteriophage lambda site-specific recombination: structure of the Xis protein. Journal of molecular biology. 2002;324:791–805. doi: 10.1016/s0022-2836(02)01150-6. [DOI] [PubMed] [Google Scholar]
  13. Thompson JD, Higgins DG, Gibson TJ. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic acids research. 1994;22:4673–4680. doi: 10.1093/nar/22.22.4673. [DOI] [PMC free article] [PubMed] [Google Scholar]
  14. Higgins DG, Sharp PM. CLUSTAL: a package for performing multiple sequence alignment on a microcomputer. Gene. 1988;73:237–244. doi: 10.1016/0378-1119(88)90330-7. [DOI] [PubMed] [Google Scholar]
  15. Lewis JA, Hatfull GF. Control of directionality in integrase-mediated recombination: examination of recombination directionality factors (RDFs) including Xis and Cox proteins. Nucleic acids research. 2001;29:2205–2216. doi: 10.1093/nar/29.11.2205. [DOI] [PMC free article] [PubMed] [Google Scholar]
  16. O'Halloran JA, McGrath BM, Pembroke JT. The orf4 gene of the enterobacterial ICE, R391, encodes a novel UV-inducible recombination directionality factor, Jef, involved in excision and transfer of the ICE. FEMS microbiology letters. 2007;272:99–105. doi: 10.1111/j.1574-6968.2007.00747.x. [DOI] [PubMed] [Google Scholar]
  17. Burrus V, Waldor MK. Control of SXT Integration and Excision. 2003;185:5045–5054. doi: 10.1128/JB.185.17.5045-5054.2003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  18. Dodd IB, Egan JB. Improved detection of helix-turn-helix DNA-binding motifs in protein sequences. Nucleic acids research. 1990;18:5019–5026. doi: 10.1093/nar/18.17.5019. [DOI] [PMC free article] [PubMed] [Google Scholar]
  19. Kim DE, Chivian D, Baker D. Protein structure prediction and analysis using the Robetta server. Nucleic Acids Res. 2004:W526–531. doi: 10.1093/nar/gkh468. [DOI] [PMC free article] [PubMed] [Google Scholar]
  20. Betzel C, Pal GP, Saenger W. Three-dimensional structure of proteinase K at 0.15-nm resolution. European journal of biochemistry/FEBS. 1988;178:155–171. doi: 10.1111/j.1432-1033.1988.tb14440.x. [DOI] [PubMed] [Google Scholar]
  21. Ebeling W, Hennrich N, Klockow M, Metz H, Orth HD, Lang H. Proteinase K from Tritirachium album Limber. European journal of biochemistry/FEBS. 1974;47:91–97. doi: 10.1111/j.1432-1033.1974.tb03671.x. [DOI] [PubMed] [Google Scholar]
  22. Lizardi PM, Engelberg A. Rapid isolation of RNA using proteinase K and sodium perchlorate. Analytical biochemistry. 1979;98:116–122. doi: 10.1016/0003-2697(79)90714-0. [DOI] [PubMed] [Google Scholar]
  23. Fontana A, de Laureto PP, Spolaore B, Frare E, Picotti P, Zambonin M. Probing protein structure by limited proteolysis. Acta biochimica Polonica. 2004;51:299–321. [PubMed] [Google Scholar]
  24. Cordoba AJ, Shyong B-J, Breen D, Harris RJ. Non-enzymatic hinge region fragmentation of antibodies in solution. J Chromatogr B Analyt Technol Biomed Life Sci. 2005;818:115–121. doi: 10.1016/j.jchromb.2004.12.033. [DOI] [PubMed] [Google Scholar]
  25. Karty JA, Ireland MME, Brun YV, Reilly JP. Artifacts and unassigned masses encountered in peptide mass mapping. J Chromatogr B Analyt Technol Biomed Life Sci. 2002;782:363–383. doi: 10.1016/s1570-0232(02)00550-0. [DOI] [PubMed] [Google Scholar]
  26. Luck SN, Turner SA, Rajakumar K, Adler B, Sakellaris H. Excision of the Shigella resistance locus pathogenicity island in Shigella flexneri is stimulated by a member of a new subgroup of recombination directionality factors. Journal of bacteriology. 2004;186:5551–5554. doi: 10.1128/JB.186.16.5551-5554.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  27. Polo S, Sturniolo T, Deho G, Ghisotti D. Identification of a Phage-coded DNA-binding Protein that Regulates Transcription from Late Promoters in Bacteriophage P4. Journal of molecular biology. 1996;257:745–755. doi: 10.1006/jmbi.1996.0199. [DOI] [PubMed] [Google Scholar]
  28. Piazzolla D, Cali S, Spoldi E, Forti F, Sala C, Magnoni F, Deho G, Ghisotti D. Expression of phage P4 integrase is regulated negatively by both Int and Vis. J Gen Virol. 2006;87:2423–2431. doi: 10.1099/vir.0.81875-0. [DOI] [PubMed] [Google Scholar]
  29. Cali S, Spoldi E, Piazzolla D, Dodd IB, Forti F, Deho G, Ghisotti D. Bacteriophage P4 Vis protein is needed for prophage excision. Virology. 2004;322:82–92. doi: 10.1016/j.virol.2004.01.016. [DOI] [PubMed] [Google Scholar]
  30. Trempy JE, Kirby JE, Gottesman S. Alp suppression of Lon: dependence on the slpA gene. Journal of bacteriology. 1994;176:2061–2067. doi: 10.1128/jb.176.7.2061-2067.1994. [DOI] [PMC free article] [PubMed] [Google Scholar]
  31. Kirby JE, Trempy JE, Gottesman S. Excision of a P4-like cryptic prophage leads to Alp protease expression in Escherichia coli. Journal of bacteriology. 1994;176:2068–2081. doi: 10.1128/jb.176.7.2068-2081.1994. [DOI] [PMC free article] [PubMed] [Google Scholar]
  32. Sakellaris H, Luck SN, Al-Hasani K, Rajakumar K, Turner SA, Adler B. Regulated site-specific recombination of the she pathogenicity island of Shigella flexneri. Molecular microbiology. 2004;52:1329–1336. doi: 10.1111/j.1365-2958.2004.04048.x. [DOI] [PubMed] [Google Scholar]
  33. Boltner D, MacMahon C, Pembroke JT, Strike P, Osborn AM. R391: a Conjugative Integrating Mosaic Comprised of Phage, Plasmid, and Transposon Elements. 2002;184:5158–5169. doi: 10.1128/JB.184.18.5158-5169.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  34. Abbani M, Iwahara M, Clubb RT. The structure of the excisionase (Xis) protein from conjugative transposon Tn916 provides insights into the regulation of heterobivalent tyrosine recombinases. Journal of molecular biology. 2005;347:11–25. doi: 10.1016/j.jmb.2005.01.019. [DOI] [PubMed] [Google Scholar]
  35. Hubbard SJ. The structural aspects of limited proteolysis of native proteins. Biochim Biophys Acta. 1998;1382:191–206. doi: 10.1016/s0167-4838(97)00175-1. [DOI] [PubMed] [Google Scholar]
  36. Fontana A, Polverino de Laureto P, De Filippis V, Scaramella E, Zambonin M. Probing the partly folded states of proteins by limited proteolysis. Folding & design. 1997;2:R17–26. doi: 10.1016/S1359-0278(97)00010-2. [DOI] [PubMed] [Google Scholar]
  37. Mischo S, Gardner J. Host Factor Requirements For Gifsy-1 Integration and Analysis of The IHF Binding Region. Thesis, University of Illinois at Urbana-Champaign. 2002.
  38. Lin HC, Lei SP, Studnicka G, Wilcox G. The araBAD operon of Salmonella typhimurium LT2. III. Nucleotide sequence of araD and its flanking regions, and primary structure of its product, L-ribulose-5-phosphate 4-epimerase. Gene. 1985;34:129–134. doi: 10.1016/0378-1119(85)90303-8. [DOI] [PubMed] [Google Scholar]
  39. Lin HC, Lei SP, Wilcox G. The araBAD operon of Salmonella typhimurium LT2. I. Nucleotide sequence of araB and primary structure of its product, ribulokinase. Gene. 1985;34:111–122. doi: 10.1016/0378-1119(85)90301-4. [DOI] [PubMed] [Google Scholar]
  40. Lin HC, Lei SP, Wilcox G. The araBAD operon of Salmonella typhimurium LT2. II. Nucleotide sequence of araA and primary structure of its product, L-arabinose isomerase. Gene. 1985;34:123–128. doi: 10.1016/0378-1119(85)90302-6. [DOI] [PubMed] [Google Scholar]
  41. Guzman LM, Belin D, Carson MJ, Beckwith J. Tight regulation, modulation, and high-level expression by vectors containing the arabinose PBAD promoter. Journal of bacteriology. 1995;177:4121–4130. doi: 10.1128/jb.177.14.4121-4130.1995. [DOI] [PMC free article] [PubMed] [Google Scholar]
  42. Kolter R, Inuzuka M, Helinski DR. Trans-complementation-dependent replication of a low molecular weight origin fragment from plasmid R6K. Cell. 1978;15:1199–1208. doi: 10.1016/0092-8674(78)90046-6. [DOI] [PubMed] [Google Scholar]
  43. Brosius J, Holy A. Regulation of Ribosomal RNA Promoters with a Synthetic lac Operator. Proc Natl Acad Sci U S A. 1984;81:6929–6933. doi: 10.1073/pnas.81.22.6929. [DOI] [PMC free article] [PubMed] [Google Scholar]
  44. Vieira J, Messing J. The pUC plasmids, an M13mp7-derived system for insertion mutagenesis and sequencing with synthetic universal primers. Gene. 1982;19:259–268. doi: 10.1016/0378-1119(82)90015-4. [DOI] [PubMed] [Google Scholar]
  45. Cheng Q, Swalla BM, Beck M, Alcaraz R, Jr, Gumport RI, Gardner JF. Specificity determinants for bacteriophage Hong Kong 022 integrase: analysis of mutants with relaxed core-binding specificities. Molecular microbiology. 2000;36:424–436. doi: 10.1046/j.1365-2958.2000.01860.x. [DOI] [PubMed] [Google Scholar]
  46. Sambrook J, Fritsch EF, Maniatis T. Molecular cloning, a laboratory manual, 2nd ed. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY; 1989. p. A.1. [Google Scholar]
  47. Maloy SR. Localized mutagenesis. Methods in enzymology. 2007;421:42–50. doi: 10.1016/S0076-6879(06)21006-1. [DOI] [PubMed] [Google Scholar]
  48. Schagger H. Tricine-SDS-PAGE. Nat Protocols. 2006;1:16–22. doi: 10.1038/nprot.2006.4. [DOI] [PubMed] [Google Scholar]
  49. Strohalm M, Hassman M, Kosata B, Kodicek M. mMass data miner: an open source alternative for mass spectrometric data analysis. Rapid Commun Mass Spectrom. 2008;22:905–908. doi: 10.1002/rcm.3444. [DOI] [PubMed] [Google Scholar]

Articles from BMC Microbiology are provided here courtesy of BMC

RESOURCES